EMLSAP00000000394, EMLSAP00000000394 (polypeptide) Lepeophtheirus salmonis

Overview


Name	EMLSAP00000000394
Unique Name	EMLSAP00000000394
Type	polypeptide
Organism	Lepeophtheirus salmonis (salmon louse)
Sequence length	131

Associated RNAi Experiments

Nothing found

InterPro

Analysis Name: InterproScan 5
Date Performed: 2014-05-02


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR018614	Uncharacterised protein family KRTCAP2	PFAM	PF09775	Keratin_assoc	coord: 1..129 e-value: 3.0E-37 score: 126.9
None	No IPR available	PANTHER	PTHR32001:SF1	SUBFAMILY NOT NAMED	coord: 2..131
None	No IPR available	PANTHER	PTHR32001	FAMILY NOT NAMED	coord: 2..131
None	No IPR available	TMHMM	TMhelix		coord: 76..98
None	No IPR available	TMHMM	TMhelix		coord: 41..63
None	No IPR available	TMHMM	TMhelix		coord: 7..26

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
EBI Gene Prediction Pipeline	2013-07-17
InterproScan 5	2014-05-02

Cross References

External references for this polypeptide


Database	Accession
Ensembl Metazoa (protein)	EMLSAP00000000394 (primary cross-reference)

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type
EMLSAT00000000394	EMLSAT00000000394-696241	Lepeophtheirus salmonis	mRNA

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>EMLSAP00000000394 ID=EMLSAP00000000394|Name=EMLSAP00000000394|organism=Lepeophtheirus salmonis|type=polypeptide|length=131bp
MALIPSASFVVSSILSLLTFSGMQMAKPYLVASRLSTIFGGFLGSLFFVF
FFTAVGNLEIVLFGKGHVTRLGETIFSLLVSVIISGTIHRVSATSCILFS
LAMLLSMYKISQDTYNHVQETSHEKSSKRKK

Add to Basket

Search form