lactate 2-monooxygenase, maker-scaffold899_size83673-snap-gene-0.19 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of lactate 2-monooxygenase vs. L. salmonis genes
Match: EMLSAG00000000629 (supercontig:LSalAtl2s:LSalAtl2s109:774756:806135:1 gene:EMLSAG00000000629 transcript:EMLSAT00000000629 description:"maker-LSalAtl2s109-snap-gene-8.30") HSP 1 Score: 71.2478 bits (173), Expect = 3.201e-16 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 35 MCQSEYSKRQKQARTYHMGLVTRVGLEKSLSDVSDEKFRKHYPVPPNIP 83 MC+ EY+ R+K++ YHMGLVTR G+EKSL VS+ FR Y VPPNIP Sbjct: 171 MCKEEYTMREKKSNKYHMGLVTRQGIEKSLQSVSNSDFRDSYSVPPNIP 219 The following BLAST results are available for this feature:
BLAST of lactate 2-monooxygenase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of lactate 2-monooxygenase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of lactate 2-monooxygenase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold899_size83673:69590..70151- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold899_size83673-snap-gene-0.19 ID=maker-scaffold899_size83673-snap-gene-0.19|Name=lactate 2-monooxygenase|organism=Tigriopus kingsejongensis|type=gene|length=562bp|location=Sequence derived from alignment at scaffold899_size83673:69590..70151- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'lactate 2-monooxygenase' has the following synonyms
Add to Basket
|