PREDICTED: hemocytin-like, maker-scaffold556_size137522-snap-gene-0.33 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of PREDICTED: hemocytin-like vs. L. salmonis genes
Match: EMLSAG00000001081 (supercontig:LSalAtl2s:LSalAtl2s117:715360:716166:1 gene:EMLSAG00000001081 transcript:EMLSAT00000001081 description:"maker-LSalAtl2s117-augustus-gene-7.26") HSP 1 Score: 107.071 bits (266), Expect = 2.209e-32 Identity = 49/68 (72.06%), Postives = 57/68 (83.82%), Query Frame = 0 Query: 27 QAKPWIQGVELDLPREVDPESPIVAHPDDCHVFYMYNYPMTCGEELVFNPDTLACEPAANVSSRPECA 94 +AKPWIQGV+L LPREVDPE+PI AHPDDC VFY+YNYPMTCGEELVF+ ++L+C P RPECA Sbjct: 17 EAKPWIQGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSCVPK---EKRPECA 81 The following BLAST results are available for this feature:
BLAST of PREDICTED: hemocytin-like vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of PREDICTED: hemocytin-like vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of PREDICTED: hemocytin-like vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold556_size137522:132694..133573+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold556_size137522-snap-gene-0.33 ID=maker-scaffold556_size137522-snap-gene-0.33|Name=PREDICTED: hemocytin-like|organism=Tigriopus kingsejongensis|type=gene|length=880bp|location=Sequence derived from alignment at scaffold556_size137522:132694..133573+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'PREDICTED: hemocytin-like' has the following synonyms
Add to Basket
|