|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | GENE3D | 1.10.150.50 | | coord: 154..202
e-value: 5.7E-15
score: 56.8 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 39..81 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 108..124 |
| None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 23..143 |
| None | No IPR available | PANTHER | PTHR12247:SF127 | POLYHOMEOTIC DISTAL, ISOFORM A-RELATED | coord: 30..202 |
| None | No IPR available | PANTHER | PTHR12247 | LETHAL 3 MALIGNANT BRAIN TUMOR-RELATED | coord: 30..202 |
| IPR001660 | Sterile alpha motif domain | PFAM | PF00536 | SAM_1 | coord: 161..202
e-value: 1.4E-7
score: 31.7 |
| IPR001660 | Sterile alpha motif domain | PROSITE | PS50105 | SAM_DOMAIN | coord: 162..202
score: 10.191 |
| IPR013761 | Sterile alpha motif/pointed domain superfamily | SUPERFAMILY | 47769 | SAM/Pointed domain | coord: 156..202 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk01218 ID=Tk01218|Name=Tk01218|organism=Tigriopus kingsejongensis|type=polypeptide|length=202bp
MATTERRDSANWRNLLFQSTPRNERLRVAARKTKKSDKTSVGVSVNGTTT
ATTISTSLSGTTPTITSSHNGLTSSHNGKKSDGTPATEKKRGPGRPPGST
RQSIEQQRLNADKAKNHGDGPPPSKKSKGMEQSAMSADPSDLKAKNKIDV
EALLKGTNPLKWSVQQVCDFVKELPGCSDYVEDFLLQEIDGQALMLLKAD
HL back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0005515 | protein binding |
|
