hypothetical protein, maker-scaffold119_size336447-snap-gene-2.28 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of hypothetical protein vs. L. salmonis genes
Match: EMLSAG00000006490 (supercontig:LSalAtl2s:LSalAtl2s355:2804:4923:-1 gene:EMLSAG00000006490 transcript:EMLSAT00000006490 description:"maker-LSalAtl2s355-augustus-gene-1.10") HSP 1 Score: 77.411 bits (189), Expect = 4.410e-19 Identity = 37/72 (51.39%), Postives = 52/72 (72.22%), Query Frame = 0 Query: 57 KRS--SVEFMGMTVSYPQYIRLRNIQREVIRMDKVIRRMRQTRDPMELAQNPHWTELMELYDALKSMLPVDY 126 KRS SV+FMGM VSYP Y+RL +Q++VI +DK+IR+MR++ +L +NP W L+ + +LK MLPV Y Sbjct: 94 KRSPFSVDFMGMRVSYPIYLRLTALQKKVIELDKIIRKMRKSNREEDLLKNPRWQTLLMYHKSLKKMLPVSY 165 The following BLAST results are available for this feature:
BLAST of hypothetical protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of hypothetical protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of hypothetical protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold119_size336447:239770..240793+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold119_size336447-snap-gene-2.28 ID=maker-scaffold119_size336447-snap-gene-2.28|Name=hypothetical protein|organism=Tigriopus kingsejongensis|type=gene|length=1024bp|location=Sequence derived from alignment at scaffold119_size336447:239770..240793+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'hypothetical protein' has the following synonyms
Add to Basket
|