PREDICTED: hypothetical protein LOC100748423, maker-scaffold71_size417697-snap-gene-3.14 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of PREDICTED: hypothetical protein LOC100748423 vs. L. salmonis genes
Match: EMLSAG00000010389 (supercontig:LSalAtl2s:LSalAtl2s68:1167984:1172625:-1 gene:EMLSAG00000010389 transcript:EMLSAT00000010389 description:"snap_masked-LSalAtl2s68-processed-gene-11.2") HSP 1 Score: 103.219 bits (256), Expect = 2.146e-27 Identity = 51/115 (44.35%), Postives = 78/115 (67.83%), Query Frame = 0 Query: 105 MSPDGFDDAAVEEEDHGHGDEVAEEEAKEDVALVVEVLVQVVVGAGEEHALRGESTPDVQQRGERDAHGVAPNGEEDSQSLATGDLDSIEPLDNDIVSVVT-DYHHGEDGHDAAH 218 M P DD AVEEE GH ++V E+ K+DV V+ ++ QVV+G G+E AL ++PDV++ R+++G++P G D++SL++ + SIEPLDND+VS+VT D H ED + + Sbjct: 1 MCPYSLDDGAVEEEYEGHWEQVHEKTGKKDVRNVICIIRQVVIGTGKEKALHSVASPDVKKCQSRNSNGISPYGHNDNKSLSSRNFSSIEPLDNDVVSIVTNDNHVDEDFYKFSF 115 The following BLAST results are available for this feature:
BLAST of PREDICTED: hypothetical protein LOC100748423 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of PREDICTED: hypothetical protein LOC100748423 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of PREDICTED: hypothetical protein LOC100748423 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold71_size417697:309553..310414+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold71_size417697-snap-gene-3.14 ID=maker-scaffold71_size417697-snap-gene-3.14|Name=PREDICTED: hypothetical protein LOC100748423|organism=Tigriopus kingsejongensis|type=gene|length=862bp|location=Sequence derived from alignment at scaffold71_size417697:309553..310414+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'PREDICTED: hypothetical protein LOC100748423' has the following synonyms
Add to Basket
|