EMLSAG00000000002, EMLSAG00000000002-682768 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000002
Unique NameEMLSAG00000000002-682768
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:EXOSC8 "Exosome complex component RRP43" species:9913 "Bos taurus" [GO:0000178 "exosome (RNase complex)" evidence=ISS] [GO:0005730 "nucleolus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006364 "rRNA processing" evidence=IEA] [GO:0017091 "AU-rich element binding" evidence=IEA] InterPro:IPR015847 Pfam:PF01138 INTERPRO:IPR001247 GO:GO:0005737 GO:GO:0005730 GO:GO:0017091 GO:GO:0000178 InterPro:IPR020568 SUPFAM:SSF54211 GO:GO:0006364 eggNOG:COG2123 Gene3D:3.30.230.70 InterPro:IPR027408 Pfam:PF03725 SUPFAM:SSF55666 HOGENOM:HOG000229504 GeneTree:ENSGT00530000063093 EMBL:BC112881 RefSeq:NP_001073074.1 UniGene:Bt.55156 ProteinModelPortal:Q2KHU3 SMR:Q2KHU3 STRING:9913.ENSBTAP00000015733 Ensembl:ENSBTAT00000015733 GeneID:532080 KEGG:bta:532080 CTD:11340 HOVERGEN:HBG051522 InParanoid:Q2KHU3 KO:K12586 OMA:YVDATCI OrthoDB:EOG7D59PC TreeFam:TF320415 NextBio:20875602 Uniprot:Q2KHU3)

HSP 1 Score: 63.5438 bits (153), Expect = 1.486e-11
Identity = 40/129 (31.01%), Postives = 69/129 (53.49%), Query Frame = 0
Query:   11 SISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +++ G I T DGS++VK  N  V+CG   +  +P  + P++G ++       LC++        +   +++ +  F+ DV++NS +I  E L I S + + VL  +  C NH G++ DA    LL ALK
Sbjct:   36 TVNVGSIGTADGSALVKLGNTTVICGIKAEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGE---EAQVASQFIADVIENSQIIQKEDLCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:Exosc8 "exosome component 8" species:10090 "Mus musculus" [GO:0000178 "exosome (RNase complex)" evidence=ISO] [GO:0003723 "RNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006364 "rRNA processing" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0017091 "AU-rich element binding" evidence=ISO] InterPro:IPR015847 MGI:MGI:1916889 Pfam:PF01138 INTERPRO:IPR001247 GO:GO:0005737 GO:GO:0005730 GO:GO:0017091 GO:GO:0000178 InterPro:IPR020568 SUPFAM:SSF54211 GO:GO:0006364 eggNOG:COG2123 Gene3D:3.30.230.70 InterPro:IPR027408 Pfam:PF03725 SUPFAM:SSF55666 GeneTree:ENSGT00530000063093 CTD:11340 HOVERGEN:HBG051522 KO:K12586 OMA:YVDATCI OrthoDB:EOG7D59PC TreeFam:TF320415 EMBL:AK009584 RefSeq:NP_081424.3 UniGene:Mm.29253 ProteinModelPortal:Q9D753 SMR:Q9D753 IntAct:Q9D753 MINT:MINT-4094795 STRING:10090.ENSMUSP00000029316 PhosphoSite:Q9D753 PaxDb:Q9D753 PRIDE:Q9D753 Ensembl:ENSMUST00000029316 GeneID:69639 KEGG:mmu:69639 UCSC:uc008pfq.2 InParanoid:Q9D753 NextBio:329962 PRO:PR:Q9D753 ArrayExpress:Q9D753 Bgee:Q9D753 CleanEx:MM_EXOSC8 Genevestigator:Q9D753 Uniprot:Q9D753)

HSP 1 Score: 61.2326 bits (147), Expect = 9.329e-11
Identity = 40/134 (29.85%), Postives = 70/134 (52.24%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G I+T DGS++VK  N  V+CG   +  +P  + P+RG ++       LC++        +   +++ +  F+ DV+ NS VI  E L I   + + VL  +  C ++ G++ DA    LL ALK
Sbjct:   31 EFRATTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGE---EAQVTSQFIADVVDNSQVIKKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:LOC100858560 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0000178 "exosome (RNase complex)" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0017091 "AU-rich element binding" evidence=IEA] InterPro:IPR015847 Pfam:PF01138 INTERPRO:IPR001247 InterPro:IPR020568 SUPFAM:SSF54211 Gene3D:3.30.230.70 InterPro:IPR027408 Pfam:PF03725 SUPFAM:SSF55666 GeneTree:ENSGT00530000063093 CTD:11340 KO:K12586 OrthoDB:EOG7D59PC TreeFam:TF320415 EMBL:AADN03000625 RefSeq:XP_003640625.1 UniGene:Gga.4656 Ensembl:ENSGALT00000027544 GeneID:100858560 KEGG:gga:100858560 PRO:PR:E1BUV1 Uniprot:E1BUV1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.705e-10
Identity = 43/140 (30.71%), Postives = 70/140 (50.00%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRY-----------SPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G ITT DGS++VK  N  V+CG   ++ +P  +  N+G I+          N+   SL  +R+           +  F+ DV++NS VI  E L I   + + VL  +  C ++ G++ DA    LL ALK
Sbjct:   31 EFRATTVNIGSITTADGSALVKLGNTTVICGVKAELAAPALDSANKGYIVP---------NVELPSLCSTRFRSGPPGEEAQAASQFIADVIENSQVIAKEDLCIADGKLAWVLYCDIICLDYDGNILDASTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:EXOSC8 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000178 "exosome (RNase complex)" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0017091 "AU-rich element binding" evidence=IEA] InterPro:IPR015847 Pfam:PF01138 INTERPRO:IPR001247 GO:GO:0005634 GO:GO:0005737 GO:GO:0017091 GO:GO:0000178 InterPro:IPR020568 SUPFAM:SSF54211 Gene3D:3.30.230.70 InterPro:IPR027408 Pfam:PF03725 SUPFAM:SSF55666 GeneTree:ENSGT00530000063093 CTD:11340 KO:K12586 TreeFam:TF320415 EMBL:AAEX03014203 RefSeq:XP_534492.2 Ensembl:ENSCAFT00000009898 GeneID:477300 KEGG:cfa:477300 NextBio:20852818 Uniprot:E2R7U8)

HSP 1 Score: 59.3066 bits (142), Expect = 5.393e-10
Identity = 38/129 (29.46%), Postives = 69/129 (53.49%), Query Frame = 0
Query:   11 SISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +++ G I+T DGS++VK  N  V+CG   +  +P  + P++G ++       LC++        +   +++ +  F+ DV++NS +I  E L I   + S VL  +  C ++ G++ DA    LL ALK
Sbjct:   36 TVNIGSISTADGSALVKLGNTTVICGIKAEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGE---EAQVASQFIADVIENSQIIQKEDLCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:rrp43 "exosome subunit Rrp43" species:4896 "Schizosaccharomyces pombe" [GO:0000177 "cytoplasmic exosome (RNase complex)" evidence=ISO] [GO:0000176 "nuclear exosome (RNase complex)" evidence=ISO] [GO:0000175 "3'-5'-exoribonuclease activity" evidence=ISO] [GO:0000467 "exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)" evidence=ISO] [GO:0070651 "nonfunctional rRNA decay" evidence=ISO] [GO:0071042 "nuclear polyadenylation-dependent mRNA catabolic process" evidence=ISO] [GO:0071035 "nuclear polyadenylation-dependent rRNA catabolic process" evidence=ISO] [GO:0071038 "nuclear polyadenylation-dependent tRNA catabolic process" evidence=ISO] [GO:0070478 "nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay" evidence=ISO] [GO:0070481 "nuclear-transcribed mRNA catabolic process, non-stop decay" evidence=ISO] [GO:0034661 "ncRNA catabolic process" evidence=ISO] [GO:0005634 "nucleus" evidence=IDA] [GO:0005730 "nucleolus" evidence=IDA] [GO:0005829 "cytosol" evidence=IDA] [GO:0003723 "RNA binding" evidence=IEA] [GO:0000178 "exosome (RNase complex)" evidence=IDA] PomBase:SPBC17D1.03c InterPro:IPR015847 Pfam:PF01138 INTERPRO:IPR001247 GO:GO:0005829 GO:GO:0005730 EMBL:CU329671 GO:GO:0003723 GO:GO:0071035 GO:GO:0071038 InterPro:IPR020568 SUPFAM:SSF54211 GO:GO:0000176 GO:GO:0000175 GO:GO:0070651 eggNOG:COG2123 Pfam:PF03725 SUPFAM:SSF55666 HOGENOM:HOG000229504 GO:GO:0000177 GO:GO:0000467 GO:GO:0071042 GO:GO:0070478 GO:GO:0070481 KO:K12586 OMA:YVDATCI PIR:T39706 RefSeq:NP_596385.1 ProteinModelPortal:Q10205 BioGrid:276722 MINT:MINT-4697788 STRING:4896.SPBC17D1.03c-1 EnsemblFungi:SPBC17D1.03c.1 GeneID:2540189 KEGG:spo:SPBC17D1.03c OrthoDB:EOG7HTHTS NextBio:20801321 PRO:PR:Q10205 Uniprot:Q10205)

HSP 1 Score: 58.9214 bits (141), Expect = 5.683e-10
Identity = 42/134 (31.34%), Postives = 62/134 (46.27%), Query Frame = 0
Query:   12 ISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDV-----------LKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            I+   I+T +GS+I++   N+ VCG   +I  P E  PN G I+          NL    L  S++ P    D+           L+ S +INL+SL I  ++ + VL  +  C N+ GS  D     L  ALK
Sbjct:   49 INDNCISTANGSAIIRAGENVFVCGIKAEIAEPFENSPNEGWIVP---------NLELSPLCSSKFKPGPPSDLAQVVSQELHQTLQQSNLINLQSLCIFEKKAAWVLYADIICLNYDGSAFDYAWAALFAALK 173          
BLAST of EMLSAG00000000002 vs. GO
Match: - (symbol:EXOSC8 "Exosome complex component RRP43" species:9606 "Homo sapiens" [GO:0000178 "exosome (RNase complex)" evidence=IDA] [GO:0000288 "nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=IDA] [GO:0005730 "nucleolus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005829 "cytosol" evidence=TAS] [GO:0006364 "rRNA processing" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0010467 "gene expression" evidence=TAS] [GO:0016070 "RNA metabolic process" evidence=TAS] [GO:0016071 "mRNA metabolic process" evidence=TAS] [GO:0017091 "AU-rich element binding" evidence=IDA] [GO:0043928 "exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay" evidence=TAS] [GO:0004532 "exoribonuclease activity" evidence=IDA] Reactome:REACT_71 Reactome:REACT_21257 InterPro:IPR015847 Pfam:PF01138 INTERPRO:IPR001247 GO:GO:0005829 GO:GO:0005634 GO:GO:0010467 GO:GO:0005730 EMBL:CH471075 GO:GO:0017091 GO:GO:0000178 EMBL:AL138706 InterPro:IPR020568 SUPFAM:SSF54211 GO:GO:0006364 eggNOG:COG2123 Gene3D:3.30.230.70 InterPro:IPR027408 Pfam:PF03725 SUPFAM:SSF55666 HOGENOM:HOG000229504 GO:GO:0043928 PDB:2NN6 PDBsum:2NN6 CTD:11340 HOVERGEN:HBG051522 KO:K12586 OMA:YVDATCI OrthoDB:EOG7D59PC TreeFam:TF320415 EMBL:BC020773 EMBL:AF025438 RefSeq:NP_852480.1 UniGene:Hs.294041 ProteinModelPortal:Q96B26 SMR:Q96B26 BioGrid:116468 IntAct:Q96B26 MINT:MINT-4536555 STRING:9606.ENSP00000374354 PhosphoSite:Q96B26 DMDM:21759409 SWISS-2DPAGE:Q96B26 PaxDb:Q96B26 PeptideAtlas:Q96B26 PRIDE:Q96B26 DNASU:11340 Ensembl:ENST00000389704 GeneID:11340 KEGG:hsa:11340 UCSC:uc001uwa.3 GeneCards:GC13P037572 HGNC:HGNC:17035 HPA:CAB034240 HPA:HPA039702 HPA:HPA043942 MIM:606019 neXtProt:NX_Q96B26 PharmGKB:PA134922251 InParanoid:Q96B26 EvolutionaryTrace:Q96B26 GeneWiki:Exosome_component_8 GenomeRNAi:11340 NextBio:43089 PRO:PR:Q96B26 ArrayExpress:Q96B26 Bgee:Q96B26 CleanEx:HS_EXOSC8 Genevestigator:Q96B26 Uniprot:Q96B26)

HSP 1 Score: 57.7658 bits (138), Expect = 1.797e-9
Identity = 37/129 (28.68%), Postives = 68/129 (52.71%), Query Frame = 0
Query:   11 SISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +++ G I+T DGS++VK  N  V+CG   +  +P  + P++G ++       LC++        +   +++ +  F+ DV++NS +I  E L I   +   VL  +  C ++ G++ DA    LL ALK
Sbjct:   36 TVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGE---EAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832375|gb|GAXK01125169.1| (TSA: Calanus finmarchicus comp25224_c12_seq12 transcribed RNA sequence)

HSP 1 Score: 63.1586 bits (152), Expect = 2.991e-12
Identity = 42/130 (32.31%), Postives = 66/130 (50.77%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G     I +  +C+ L          + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H G++ DA ++ L  AL+
Sbjct:   70 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPG---PPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDHSGNIMDASVSALTSALE 450          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832380|gb|GAXK01125164.1| (TSA: Calanus finmarchicus comp25224_c12_seq7 transcribed RNA sequence)

HSP 1 Score: 62.7734 bits (151), Expect = 6.106e-12
Identity = 42/130 (32.31%), Postives = 66/130 (50.77%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G     I +  +C+ L          + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H G++ DA ++ L  AL+
Sbjct:  169 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPG---PPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDHSGNIMDASVSALTSALE 549          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832385|gb|GAXK01125159.1| (TSA: Calanus finmarchicus comp25224_c12_seq2 transcribed RNA sequence)

HSP 1 Score: 62.3882 bits (150), Expect = 2.172e-11
Identity = 42/130 (32.31%), Postives = 66/130 (50.77%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G     I +  +C+ L          + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H G++ DA ++ L  AL+
Sbjct:  521 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPG---PPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDHSGNIMDASVSALTSALE 901          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832412|gb|GAXK01125132.1| (TSA: Calanus finmarchicus comp25224_c2_seq3 transcribed RNA sequence)

HSP 1 Score: 62.7734 bits (151), Expect = 2.475e-11
Identity = 42/130 (32.31%), Postives = 66/130 (50.77%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G     I +  +C+ L          + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H G++ DA ++ L  AL+
Sbjct:  122 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPG---PPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDHSGNIMDASVSALTSALE 502          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832414|gb|GAXK01125130.1| (TSA: Calanus finmarchicus comp25224_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 62.3882 bits (150), Expect = 2.743e-11
Identity = 42/130 (32.31%), Postives = 66/130 (50.77%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G     I +  +C+ L          + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H G++ DA ++ L  AL+
Sbjct:  146 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPG---PPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDHSGNIMDASVSALTSALE 526          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592832371|gb|GAXK01125173.1| (TSA: Calanus finmarchicus comp25224_c12_seq16 transcribed RNA sequence)

HSP 1 Score: 53.5286 bits (127), Expect = 5.187e-9
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII--YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNH 117
            LS+S+G ITT DGS++VK     VVCG   ++ +PR E P  G ++    L     T+       + ++ +  F+  VL  S  +  E L I   +   VL I+  C +H
Sbjct:    1 LSVSAGNITTADGSAVVKLGATTVVCGVRAELATPRTEEPELGYLVPNISLPPMCSTLFKPGPPSVAAQSTSQFLATVLATSGCVRQEDLCISPGKMVWVLYIDLVCLDH 330          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592792574|gb|GAXK01161994.1| (TSA: Calanus finmarchicus comp34906_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 42.743 bits (99), Expect = 1.093e-4
Identity = 37/136 (27.21%), Postives = 60/136 (44.12%), Query Frame = 0
Query:    4 WLDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIY------LLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLAL 133
            WL+   L ++ G      GS  V     IV+   + Q+T PR   PN GI++       +         + ++ +  +R     +   LK S  ++LESL I+S E    + ++ H  NH G++ DA     L AL
Sbjct:  112 WLEERKLEMTFGKDW---GSCQVNLGRTIVLAQVSAQVTEPRVARPNEGILMVNVELSPIAAPKFDVGRMTEEGVEINRT----IERCLKESRCLDLESLCIISEEKVWTVRLDLHILNHCGNLTDACSVAGLAAL 498          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592928564|gb|GAXK01029981.1| (TSA: Calanus finmarchicus comp210425_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.099e+0
Identity = 13/43 (30.23%), Postives = 28/43 (65.12%), Query Frame = 0
Query:   69 DKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEIN 111
            D SL+ +  S NF++  + N+ ++N +  ++  ++Y R+LE+N
Sbjct: 2135 DNSLLVNDIS-NFMLGFVYNNTIVNSQETFMAVQKYKRILELN 2260          
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Match: gi|592928565|gb|GAXK01029980.1| (TSA: Calanus finmarchicus comp210425_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.099e+0
Identity = 13/43 (30.23%), Postives = 28/43 (65.12%), Query Frame = 0
Query:   69 DKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEIN 111
            D SL+ +  S NF++  + N+ ++N +  ++  ++Y R+LE+N
Sbjct: 2176 DNSLLVNDIS-NFMLGFVYNNTIVNSQETFMAVQKYKRILELN 2301          
BLAST of EMLSAG00000000002 vs. L. salmonis peptides
Match: EMLSAP00000000002 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1000:41727:44138:1 gene:EMLSAG00000000002 transcript:EMLSAT00000000002 description:"maker-LSalAtl2s1000-snap-gene-0.12")

HSP 1 Score: 267.314 bits (682), Expect = 7.671e-93
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 0
Query:    1 IGLWLDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            IGLWLDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK
Sbjct:    1 IGLWLDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134          
BLAST of EMLSAG00000000002 vs. L. salmonis peptides
Match: EMLSAP00000008750 (pep:novel supercontig:LSalAtl2s:LSalAtl2s543:201996:206114:1 gene:EMLSAG00000008750 transcript:EMLSAT00000008750 description:"maker-LSalAtl2s543-augustus-gene-1.61")

HSP 1 Score: 121.709 bits (304), Expect = 1.830e-32
Identity = 71/132 (53.79%), Postives = 85/132 (64.39%), Query Frame = 0
Query:    7 LLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII--YLLCTNLGTINLLDKSLIKSRYS--PNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L  LS S   I T DGSSI+KK N IV+CG TLQI +P EE+PNRG I+    L T     N   +  I         FVMDVL+NS VINL++L IV  EY+ VL+I+F C NH G+VKDAIIT L+LALK
Sbjct:  718 LXPLSXSXXSIXTADGSSIIKKGNTIVICGITLQIATPTEEHPNRGFIVPHVDLPTMCNPRNYKSRGQISDEIQVLSKFVMDVLENSGVINLDTLCIVPGEYAWVLKIDFSCLNHDGNVKDAIITALILALK 849          
BLAST of EMLSAG00000000002 vs. SwissProt
Match: gi|122135904|sp|Q2KHU3.1|EXOS8_BOVIN (RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome component 8; AltName: Full=Ribosomal RNA-processing protein 43)

HSP 1 Score: 63.5438 bits (153), Expect = 8.980e-12
Identity = 40/129 (31.01%), Postives = 69/129 (53.49%), Query Frame = 0
Query:   11 SISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +++ G I T DGS++VK  N  V+CG   +  +P  + P++G ++       LC++        +   +++ +  F+ DV++NS +I  E L I S + + VL  +  C NH G++ DA    LL ALK
Sbjct:   36 TVNVGSIGTADGSALVKLGNTTVICGIKAEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGE---EAQVASQFIADVIENSQIIQKEDLCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. SwissProt
Match: gi|21759414|sp|Q9D753.1|EXOS8_MOUSE (RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome component 8; AltName: Full=Ribosomal RNA-processing protein 43)

HSP 1 Score: 61.2326 bits (147), Expect = 5.592e-11
Identity = 40/134 (29.85%), Postives = 70/134 (52.24%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G I+T DGS++VK  N  V+CG   +  +P  + P+RG ++       LC++        +   +++ +  F+ DV+ NS VI  E L I   + + VL  +  C ++ G++ DA    LL ALK
Sbjct:   31 EFRATTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGE---EAQVTSQFIADVVDNSQVIKKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. SwissProt
Match: gi|1723274|sp|Q10205.1|RRP43_SCHPO (RecName: Full=Exosome complex component rrp43; AltName: Full=Ribosomal RNA-processing protein 43)

HSP 1 Score: 58.9214 bits (141), Expect = 3.502e-10
Identity = 42/134 (31.34%), Postives = 62/134 (46.27%), Query Frame = 0
Query:   12 ISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDV-----------LKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            I+   I+T +GS+I++   N+ VCG   +I  P E  PN G I+          NL    L  S++ P    D+           L+ S +INL+SL I  ++ + VL  +  C N+ GS  D     L  ALK
Sbjct:   49 INDNCISTANGSAIIRAGENVFVCGIKAEIAEPFENSPNEGWIVP---------NLELSPLCSSKFKPGPPSDLAQVVSQELHQTLQQSNLINLQSLCIFEKKAAWVLYADIICLNYDGSAFDYAWAALFAALK 173          
BLAST of EMLSAG00000000002 vs. SwissProt
Match: gi|21759409|sp|Q96B26.1|EXOS8_HUMAN (RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome component 8; AltName: Full=Opa-interacting protein 2; Short=OIP-2; AltName: Full=Ribosomal RNA-processing protein 43; AltName: Full=p9)

HSP 1 Score: 57.7658 bits (138), Expect = 1.074e-9
Identity = 37/129 (28.68%), Postives = 68/129 (52.71%), Query Frame = 0
Query:   11 SISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIII-----YLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +++ G I+T DGS++VK  N  V+CG   +  +P  + P++G ++       LC++        +   +++ +  F+ DV++NS +I  E L I   +   VL  +  C ++ G++ DA    LL ALK
Sbjct:   36 TVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGE---EAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALK 161          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: EFX69223.1 (hypothetical protein DAPPUDRAFT_301019 [Daphnia pulex])

HSP 1 Score: 72.0182 bits (175), Expect = 3.551e-15
Identity = 44/137 (32.12%), Postives = 78/137 (56.93%), Query Frame = 0
Query:    5 LDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKS-------RYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L+   +++++G I T DGS+IVK  N  V+CG   ++ +P  E P++G II  +     T+  L  S IKS       + +  F+ +++ N+++++LE+L I   +++ VL  +  C N  GS+ DA +  L+ ALK
Sbjct:   30 LEFRKMTLNAGSIGTADGSAIVKCGNTTVICGIKAELAAPEREEPSKGFIIPNV-----TLPSLCSSQIKSGPPGETAQAATQFIAELVNNNIIMDLETLCIKVSKWAWVLHCDLLCINLDGSLLDACVMALVAALK 161          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: gb|EFA02571.1| (Exosome complex component RRP43-like Protein [Tribolium castaneum])

HSP 1 Score: 56.6102 bits (135), Expect = 1.455e-9
Identity = 39/131 (29.77%), Postives = 61/131 (46.56%), Query Frame = 0
Query:   15 GFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            G I+T DGS+I K     VVCG   ++  P+ E  N G +I          N+    L  S++ P             V D+LKNS  ++L++L I   + +  L  +  C +  G++ DA +  L+ ALK
Sbjct:   40 GSISTADGSAIAKVGRTTVVCGIKAELCQPKAEAANEGFLIP---------NVELPPLCSSKFRPGPPTEQAQVATQLVADILKNSDCLDLKTLCIFPDKLAWCLYADLICLDLDGALIDACVVALMAALK 161          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: EAA00202.3 (AGAP012402-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 49.6766 bits (117), Expect = 3.228e-7
Identity = 40/137 (29.20%), Postives = 59/137 (43.07%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP---------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLAL 133
            +L  L+IS   I + DGS+IVK  N  VVCG   ++ +P    P  G ++         ++L   S    R  P           V D + N+  I+L+ L I   +    L  +  C +H G V DA I  L+ A 
Sbjct:   32 ELRPLAISFDVIKSADGSAIVKVGNTTVVCGIKAELATPNALAPRHGFLV-------PNVDLSPVSSPSYRPGPPCDEAQVYSQSVADAISNARCIDLQQLCISPGKLVWCLYCDLVCLDHDGCVLDAAIIALVAAF 161          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: EEB11694.1 (Exosome complex exonuclease RRP43, putative [Pediculus humanus corporis])

HSP 1 Score: 49.6766 bits (117), Expect = 3.377e-7
Identity = 36/122 (29.51%), Postives = 57/122 (46.72%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGS 120
            +SI+       DGS+IVK  N  VVCG  L++  P+ E P++G +I          N+    L   +Y P            FV ++L  S  I+L++L IV    + V+ ++  C N  G+
Sbjct:   35 ISINVNSFHNADGSAIVKIGNTAVVCGVKLELAKPKAETPDQGYLIP---------NVDLPPLCSGQYQPGPPCDYAQEATKFVNEILLESQCIDLKALCIVPDRLAWVIYLDIICLNQDGN 147          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: gb|KPM04330.1| (Exosome complex exonuclease RRP43-like protein, partial [Sarcoptes scabiei])

HSP 1 Score: 48.521 bits (114), Expect = 3.556e-7
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 0
Query:   12 ISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGII---IYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +S   IT+ +GS+++K  ++ V+CG T+ I  P    P  GI+   +    T    I+  D++   S Y    ++ +L NS  I+L  L ++ R+ +  +     C N  G + D  +  LL ALK
Sbjct:   19 LSCNNITSANGSALIKFGSSSVLCGLTMAIVKPEMNRPEEGILSIDVRFSSTISNEIDNPDRTTYSS-YVRECLLKILANSKFIDLRELCLIPRKKAWQISAEIVCLNMDGCIIDQSLIVLLAALK 143          
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Match: gb|KFM67344.1| (Exosome complex component RRP43, partial [Stegodyphus mimosarum])

HSP 1 Score: 50.0618 bits (118), Expect = 3.565e-7
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 0
Query:   12 ISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRG-----IIIYLLCTNLGTINLLDKSLIKSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            I  G   T  GS++V+     V+CG  +++T+P    PN+G     + +  +C+N  T     +   +++     +MD+ KNS  ++ E L I+  + +  +     C ++ G++ DA +  L+ ALK
Sbjct:  136 IDVGSFATASGSALVRLSGTSVLCGVKVELTNPTNNEPNKGFFVPNVTLTSICSNRFTAGPPSE---QAQVYTRLIMDLWKNSEFLSPEKLCILEGKLAWCIFAEMICLSYDGNILDACVLALIAALK 260          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|225711778|gb|ACO11735.1| (Exosome complex exonuclease RRP43 [Caligus rogercresseyi])

HSP 1 Score: 73.559 bits (179), Expect = 4.588e-13
Identity = 46/123 (37.40%), Postives = 71/123 (57.72%), Query Frame = 0
Query:   20 VDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYS--------PNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
             DGS+IV+K +  V+CG TLQI S  EE P +G I+     ++   ++    + KS+            F+MDV+ NS V++ + L IV  E   VL+I+  C N  G+++DA++T L+LALK
Sbjct:   49 ADGSAIVRKGHTTVICGITLQIASLDEETPTKGYIV----PHVDLPSMCHPRIYKSKGPTAEEAMILTKFIMDVILNSEVVDPKDLCIVPGEIVWVLKIDLTCLNQDGNLRDALVTALILALK 167          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|321458150|gb|EFX69223.1| (hypothetical protein DAPPUDRAFT_301019 [Daphnia pulex])

HSP 1 Score: 72.0182 bits (175), Expect = 1.737e-12
Identity = 44/137 (32.12%), Postives = 78/137 (56.93%), Query Frame = 0
Query:    5 LDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKS-------RYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L+   +++++G I T DGS+IVK  N  V+CG   ++ +P  E P++G II  +     T+  L  S IKS       + +  F+ +++ N+++++LE+L I   +++ VL  +  C N  GS+ DA +  L+ ALK
Sbjct:   30 LEFRKMTLNAGSIGTADGSAIVKCGNTTVICGIKAELAAPEREEPSKGFIIPNV-----TLPSLCSSQIKSGPPGETAQAATQFIAELVNNNIIMDLETLCIKVSKWAWVLHCDLLCINLDGSLLDACVMALVAALK 161          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|676443852|ref|XP_009050238.1| (hypothetical protein LOTGIDRAFT_201434, partial [Lottia gigantea] >gi|556110430|gb|ESO99081.1| hypothetical protein LOTGIDRAFT_201434, partial [Lottia gigantea])

HSP 1 Score: 68.9366 bits (167), Expect = 1.978e-11
Identity = 44/134 (32.84%), Postives = 69/134 (51.49%), Query Frame = 0
Query:   12 ISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            I+ G ITT +GS++VK  N  V+CG   ++ +P+ EYP +G I+          N+    +  S++ P            F +DVL+NS  INLE L I   +    L+ +  C ++ G+V DA +  L+ ALK
Sbjct:   37 INIGCITTAEGSALVKLGNTTVICGIKAELANPKAEYPKKGFIVP---------NVELSPMCSSQFRPGPPGEQAQVLSQFSVDVLQNSGCINLEDLCITPGKLVWSLQCDMICLDYDGNVTDACVLSLISALK 161          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|646723040|gb|KDR23812.1| (Exosome complex exonuclease RRP43 [Zootermopsis nevadensis])

HSP 1 Score: 68.5514 bits (166), Expect = 3.327e-11
Identity = 45/131 (34.35%), Postives = 68/131 (51.91%), Query Frame = 0
Query:   10 LSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLI------KSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +SI+ G I T +GS+IVK  N  VVCG   ++  P+ E PN G ++     N+    L            +++ S NF+ + L NS  I+L  L IVS   + VL  +  C +H GS+ DA +  L+ AL+
Sbjct:   35 VSINVGSIKTAEGSAIVKIGNTTVVCGIKAELAKPKAEEPNFGYLV----PNVELPPLCSPKFRPGPPSDQAQVSSNFIAETLTNSRCIDLRDLCIVSEHLAWVLHCDLICLDHDGSLLDACVIALVAALR 161          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|942315457|gb|JAN39661.1| (Exosome complex component RRP43, partial [Daphnia magna])

HSP 1 Score: 67.0106 bits (162), Expect = 5.774e-11
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 0
Query:    5 LDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKS-------RYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L+   +++++G I T DGS+IVK  N  V+CG   +I  P  + P +G II  +     T+  L  S IKS       + +  F+ +++ N+++++L +L I S +++ VL  +  C N  GS+ DA +  L+ ALK
Sbjct:   30 LEFRKVTVNAGSIGTADGSAIVKCGNTTVICGIKAEIAVPGMDEPAKGFIIPNV-----TLPPLCSSKIKSGPPGEAAQTATQFIAELVANNIILDLHTLCIHSSKWAWVLHCDLVCINLDGSLLDACVIALITALK 161          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|254675240|ref|NP_001157042.1| (exosome complex component RRP43 isoform 1 [Mus musculus])

HSP 1 Score: 67.3958 bits (163), Expect = 9.203e-11
Identity = 41/135 (30.37%), Postives = 70/135 (51.85%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLI------KSRYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G I+T DGS++VK  N  V+CG   +  +P  + P+RG +++L   N+    L            +++ +  F+ DV+ NS VI  E L I   + + VL  +  C ++ G++ DA    LL ALK
Sbjct:   31 EFRATTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRGYVVFLSVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALK 165          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|678220236|gb|KFV87215.1| (Exosome complex component RRP43, partial [Struthio camelus australis])

HSP 1 Score: 67.0106 bits (162), Expect = 9.605e-11
Identity = 45/140 (32.14%), Postives = 72/140 (51.43%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G ITT DGS++VK  N  V+CG   ++ +P  + PN+G I+          N+   SL  +R+ P            F+ DV++NS +I  E L I + + + VL  +  C ++ G+V DA    LL ALK
Sbjct:   27 EFRATTVNIGSITTADGSALVKLGNTTVICGVKAELATPPVDSPNKGYIVP---------NVELPSLCSTRFRPGPPGEEAQAASQFIADVIENSQIIEKEDLCIANGKLAWVLYCDIICLDYDGNVLDASTFALLAALK 157          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|697516693|ref|XP_009684893.1| (PREDICTED: exosome complex component RRP43 [Struthio camelus australis])

HSP 1 Score: 67.3958 bits (163), Expect = 1.310e-10
Identity = 45/140 (32.14%), Postives = 72/140 (51.43%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            +  A +++ G ITT DGS++VK  N  V+CG   ++ +P  + PN+G I+          N+   SL  +R+ P            F+ DV++NS +I  E L I + + + VL  +  C ++ G+V DA    LL ALK
Sbjct:  123 EFRATTVNIGSITTADGSALVKLGNTTVICGVKAELATPPVDSPNKGYIVP---------NVELPSLCSTRFRPGPPGEEAQAASQFIADVIENSQIIEKEDLCIANGKLAWVLYCDIICLDYDGNVLDASTFALLAALK 253          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|942376777|gb|JAN70318.1| (Exosome complex component RRP43 [Daphnia magna])

HSP 1 Score: 67.0106 bits (162), Expect = 1.411e-10
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 0
Query:    5 LDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKS-------RYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L+   +++++G I T DGS+IVK  N  V+CG   +I  P  + P +G II  +     T+  L  S IKS       + +  F+ +++ N+++++L +L I S +++ VL  +  C N  GS+ DA +  L+ ALK
Sbjct:   30 LEFRKVTVNAGSIGTADGSAIVKCGNTTVICGIKAEIAVPGMDEPAKGFIIPNV-----TLPPLCSSKIKSGPPGEAAQTATQFIAELVANNIILDLHTLCIHSSKWAWVLHCDLVCINLDGSLLDACVIALITALK 161          
BLAST of EMLSAG00000000002 vs. nr
Match: gi|942360747|gb|JAN62303.1| (Exosome complex component RRP43 [Daphnia magna] >gi|942365125|gb|JAN64492.1| Exosome complex component RRP43 [Daphnia magna] >gi|1022760066|gb|KZS06329.1| Exosome complex component RRP43 [Daphnia magna])

HSP 1 Score: 66.6254 bits (161), Expect = 1.433e-10
Identity = 44/137 (32.12%), Postives = 76/137 (55.47%), Query Frame = 0
Query:    5 LDLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKS-------RYSPNFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLALK 134
            L+   +++++G I T DGS+IVK  N  V+CG   +I  P  + P +G II  +     T+  L  S IKS       + +  F+ +++ N+++++L +L I S +++ VL  +  C N  GS+ DA +  L+ ALK
Sbjct:   30 LEFRKVTVNAGSIGTADGSAIVKCGNTTVICGIKAEIAVPGMDEPAKGFIIPNV-----TLPPLCSSKIKSGPPGEAAQTATQFIAELVANNIILDLHTLCIHSSKWAWVLHCDLVCINLDGSLLDACVIALITALK 161          
BLAST of EMLSAG00000000002 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold552_size138156-snap-gene-0.29 (protein:Tk00647 transcript:maker-scaffold552_size138156-snap-gene-0.29-mRNA-1 annotation:"exosome complex component rrp43")

HSP 1 Score: 73.1738 bits (178), Expect = 1.294e-16
Identity = 45/139 (32.37%), Postives = 71/139 (51.08%), Query Frame = 0
Query:    6 DLLALSISSGFITTVDGSSIVKKENNIVVCGTTLQITSPREEYPNRGIIIYLLCTNLGTINLLDKSLIKSRYSP-----------NFVMDVLKNSVVINLESLYIVSREYSRVLEINFHCPNHGGSVKDAIITPLLLAL 133
            +L  +SIS G I + DGS+IVK+   IVVCG  L++  P    P++G ++          N+    L   ++ P            F+ +VL NS +++L+ L I   +YS VL ++  C NH G+V D  +  L+ AL
Sbjct:   39 ELRPVSISQGTIGSADGSAIVKQGQTIVVCGLKLELAPPHANDPDQGFMVP---------NVDFPPLCHPQFKPGPPPEPAQVASKFIHEVLTNSGIVDLKDLCIQESKYSWVLHMDLMCLNHDGNVLDCALKALVAAL 168          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000002 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 6
Match NameE-valueIdentityDescription
-1.486e-1131.01symbol:EXOSC8 "Exosome complex component RRP43" sp... [more]
-9.329e-1129.85symbol:Exosc8 "exosome component 8" species:10090 ... [more]
-1.705e-1030.71symbol:LOC100858560 "Uncharacterized protein" spec... [more]
-5.393e-1029.46symbol:EXOSC8 "Uncharacterized protein" species:96... [more]
-5.683e-1031.34symbol:rrp43 "exosome subunit Rrp43" species:4896 ... [more]
-1.797e-928.68symbol:EXOSC8 "Exosome complex component RRP43" sp... [more]
back to top
BLAST of EMLSAG00000000002 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 9
Match NameE-valueIdentityDescription
gi|592832375|gb|GAXK01125169.1|2.991e-1232.31TSA: Calanus finmarchicus comp25224_c12_seq12 tran... [more]
gi|592832380|gb|GAXK01125164.1|6.106e-1232.31TSA: Calanus finmarchicus comp25224_c12_seq7 trans... [more]
gi|592832385|gb|GAXK01125159.1|2.172e-1132.31TSA: Calanus finmarchicus comp25224_c12_seq2 trans... [more]
gi|592832412|gb|GAXK01125132.1|2.475e-1132.31TSA: Calanus finmarchicus comp25224_c2_seq3 transc... [more]
gi|592832414|gb|GAXK01125130.1|2.743e-1132.31TSA: Calanus finmarchicus comp25224_c2_seq1 transc... [more]
gi|592832371|gb|GAXK01125173.1|5.187e-931.82TSA: Calanus finmarchicus comp25224_c12_seq16 tran... [more]
gi|592792574|gb|GAXK01161994.1|1.093e-427.21TSA: Calanus finmarchicus comp34906_c0_seq1 transc... [more]
gi|592928564|gb|GAXK01029981.1|1.099e+030.23TSA: Calanus finmarchicus comp210425_c0_seq2 trans... [more]
gi|592928565|gb|GAXK01029980.1|1.099e+030.23TSA: Calanus finmarchicus comp210425_c0_seq1 trans... [more]
back to top
BLAST of EMLSAG00000000002 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 2
Match NameE-valueIdentityDescription
EMLSAP000000000027.671e-93100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1000:4172... [more]
EMLSAP000000087501.830e-3253.79pep:novel supercontig:LSalAtl2s:LSalAtl2s543:20199... [more]
back to top
BLAST of EMLSAG00000000002 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
gi|122135904|sp|Q2KHU3.1|EXOS8_BOVIN8.980e-1231.01RecName: Full=Exosome complex component RRP43; Alt... [more]
gi|21759414|sp|Q9D753.1|EXOS8_MOUSE5.592e-1129.85RecName: Full=Exosome complex component RRP43; Alt... [more]
gi|1723274|sp|Q10205.1|RRP43_SCHPO3.502e-1031.34RecName: Full=Exosome complex component rrp43; Alt... [more]
gi|21759409|sp|Q96B26.1|EXOS8_HUMAN1.074e-928.68RecName: Full=Exosome complex component RRP43; Alt... [more]
back to top
BLAST of EMLSAG00000000002 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 6
Match NameE-valueIdentityDescription
EFX69223.13.551e-1532.12hypothetical protein DAPPUDRAFT_301019 [Daphnia pu... [more]
gb|EFA02571.1|1.455e-929.77Exosome complex component RRP43-like Protein [Trib... [more]
EAA00202.33.228e-729.20AGAP012402-PA [Anopheles gambiae str. PEST][more]
EEB11694.13.377e-729.51Exosome complex exonuclease RRP43, putative [Pedic... [more]
gb|KPM04330.1|3.556e-728.57Exosome complex exonuclease RRP43-like protein, pa... [more]
gb|KFM67344.1|3.565e-725.78Exosome complex component RRP43, partial [Stegodyp... [more]
back to top
BLAST of EMLSAG00000000002 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|225711778|gb|ACO11735.1|4.588e-1337.40Exosome complex exonuclease RRP43 [Caligus rogercr... [more]
gi|321458150|gb|EFX69223.1|1.737e-1232.12hypothetical protein DAPPUDRAFT_301019 [Daphnia pu... [more]
gi|676443852|ref|XP_009050238.1|1.978e-1132.84hypothetical protein LOTGIDRAFT_201434, partial [L... [more]
gi|646723040|gb|KDR23812.1|3.327e-1134.35Exosome complex exonuclease RRP43 [Zootermopsis ne... [more]
gi|942315457|gb|JAN39661.1|5.774e-1132.12Exosome complex component RRP43, partial [Daphnia ... [more]
gi|254675240|ref|NP_001157042.1|9.203e-1130.37exosome complex component RRP43 isoform 1 [Mus mus... [more]
gi|678220236|gb|KFV87215.1|9.605e-1132.14Exosome complex component RRP43, partial [Struthio... [more]
gi|697516693|ref|XP_009684893.1|1.310e-1032.14PREDICTED: exosome complex component RRP43 [Struth... [more]
gi|942376777|gb|JAN70318.1|1.411e-1032.12Exosome complex component RRP43 [Daphnia magna][more]
gi|942360747|gb|JAN62303.1|1.433e-1032.12Exosome complex component RRP43 [Daphnia magna] >g... [more]

Pages

back to top
BLAST of EMLSAG00000000002 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold552_size138156-snap-gene-0.291.294e-1632.37protein:Tk00647 transcript:maker-scaffold552_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1000supercontigLSalAtl2s1000:41727..44138 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteExosome complex component RRP43
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1000-snap-gene-0.12
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000002 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000002EMLSAT00000000002-695849Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1000:41727..44138+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000002-682768 ID=EMLSAG00000000002-682768|Name=EMLSAG00000000002|organism=Lepeophtheirus salmonis|type=gene|length=2412bp|location=Sequence derived from alignment at LSalAtl2s1000:41727..44138+ (Lepeophtheirus salmonis)
ATAGGTAAAAGAGATTTTTCTCATTCCAACTCATAACTATGTCCATTAAT GCTGAAAAATATAATTGTATCAAATAAGCAAACGATTTTCAATCTTTGTA TGTTCCATTTATTTATAACATGTCATTGTCTCAAATATATCTACGAGTTT ATTTGTACTGAATATTTAAGAATGTTAAGGCTTTTTAATTCAGATTTGGA CTCAAACTTGGACATGAATTTGAATCTGAACGAATACAGGTTTTAGGGGA CAGGCCATAACCCTTTAACAAAAGAAATAACGGCCAAGGGCCTTTCAAAT TCTTAATTTCTTTCAATATTTTGTGATCATTTAAAATATAATGAATATAA AATGGACTCACATTATTTTCTATTATCCAAACCTGGATTCAAAGTTATCT CTTACAAAAAAAGATTTGAAATGTATGTTATAAAACAAAAATTGAAGTTA ATTTATAACTGTGCTTAGTTTAGATACTCGGTTTTTTAGGGAAGGAAAAT ACTGAAGCTCAGTTTATACAGTGTATGAACAATATCTGATAGGATTGTCA ATACTGTGTAAAATAACACTAAAAATTTGTACTATTATGAAACATAAATA TTCTCTTTAACTCTAACATTTTTAAAACTTTTCGAATATATTGATGGGTT ATGTTGCAAGACGAAGGGTCCTGCTCATTTACTTTTGCCTTCGGTTTCAC TCTCGGTAAAACTGGTCCTGCTTTTAAACATATGGAATTGATTAGAAGTC GAGCTTCAGTCCTTAAGCTTGACTTGGAGTCGGAAAAATGAAGCCAAATA CAGGTCTGCTCTTAATCTAATCTTGTTTATTTTTACTAAAAAATTTTCTG CAATATTTTTGATAGAACCATAATTTTTATTTTTAAAATTAGACTTTCCA TCAACTTTTTAGATGTTAATGCATTGTTTTTATTTGTTTTAAACCTATAA ACAACTATATCAATATCTCTTAACATACATTATTATAAACTATTACCATA ATACCATGTTGACATAGTATTTATCAGAAGATCCAGTACGGAAGGKACAG KAATTTTTTTGGTATATCAATCATTCCTTAAGGCTACAAAAATATATGTA TATATATATCTACTTTATTTATTTACTTTATTTCACACTTAGAGTCAAAA TCTTCCAGTTTTACCCTCATCAATCTTAATTAACCTATCTATGTTATAAT AACATCAATCACAAAAGGGCATAATGATATTCTGTCAAAAACATACCTAT TGAAATATTATCATTGATGATTTAAGGCATAATCGAACGTTATTTGTGTC ACTCGCAATACCCGTCGTCTTGCAACATAACCCATCAATATATTCGAAGA GTTTTAAAAATGTAAGAATGTCAAAACGTGGTAATTATTACGTATCTCAA CCTTTTCTTCAAAATATGAAAGAAAAAGGTCTATAATTAACTAGTCGTTA ATCAATGTCGTCACTCTTTCTAATAGGTAAACTATTATCCCTTTTATAAT AGGGATTTTCACAGCTCAGAGAGGTTAAATTCGAGTTCAATAAACTGGTT CTAGGTAAGTTTGTTGCAGGGAATGTATTCAATTTTATGGGATACAGCTC AGTAGACAACGCCCTAGAAAGAAATTATTCTCTTAAATTCAATGTGCGCA TGTTCGATTCAGGTTTGCTGCTAGTGAAGAAGTTATGTTGATGAGGTTAT TATAATACTATGTATAATGTTTACTTATAATAATTAAGTGCAATTACATA TAATCAATTAAAATAACATTAGAAAGAAATTAATTATCTTCATTTAAATC CCAAATCTTGTCATACAATCTTACATAAAACATTACTGTCATAAATCTTG TCTTATATATTTTATTAGTACAAGTTAATAAATCCCTTAAATGGACCAAG TAATAGTACGTGTCTTTTACAAATAGTCAGGAATATGAGTGTCTATGAGG TGCTTTGACGTGTGTAGCCCAAAGAATACTTTAATTAACATTTTGATAAA GGTCTTTGGTTAGACTTACTAGCTTTAAGCATTTCTTCCGGCTTCATTAC TACCGTTGATGGTTCATCCATTGTCAAAAAAGAAAACAATATTGTTGTTT GTGGAACAACTCTCCAAATTACATCACCTAGAGAAGAATATCCAAATAGA GGCATCATCGTATAACATATAGATTTATCTACTATGTACAAACCTAGGAA CTATAAATCTCCTGGACAAATCTCTGATTAAATCCAGATACTCTCCCAAT TTTGTTATGGATGTTTTAAAAAACTCCGTTGTCATTAATTTGGAATCTCT TTATATTGTTTCTAGAGAATATTCCAGGGTACTTGAAATAAACTTCCATT GTCCCAATCACGGTGGAAGTGTTAAGGATGCAATAATAACTCCACTCTTA TTAGCTTTAAAA
back to top
Add to Basket