EMLSAG00000000004, EMLSAG00000000004-682770 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000004
Unique NameEMLSAG00000000004-682770
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:grsm "granny smith" species:7227 "Drosophila melanogaster" [GO:0004177 "aminopeptidase activity" evidence=ISS] [GO:0005737 "cytoplasm" evidence=IEA;ISS] [GO:0006508 "proteolysis" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 eggNOG:COG0260 GO:GO:0008235 OrthoDB:EOG7966GR EMBL:BT001371 ProteinModelPortal:Q8IH82 SMR:Q8IH82 MINT:MINT-789885 MEROPS:M17.A04 PaxDb:Q8IH82 PRIDE:Q8IH82 FlyBase:FBgn0040493 InParanoid:Q8IH82 Bgee:Q8IH82 Uniprot:Q8IH82)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 300/512 (58.59%), Postives = 376/512 (73.44%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVT------------------KKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENY 509
            +IIG L +LN LKFS +  K+   +TE+ +   +  L+PAPTD +SL L+   +AALP K SRHNT S AH IT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG  +                   + +VNVEF+L N     +  P++ DE   +      I+  ARIVD PCNEM+V+ FI+EV+++ ++L ITP +I+G+EL E+G GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIK KT MPGMKRDCGGAA ILG FY+AV+ GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WE+K+L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGVALL TLFG H ++ LL++  ++ +E  ++ +
Sbjct:  144 LIIGQLRHLNLLKFSHLESKLSPRVTEETFLNAVACLHPAPTDKVSLYLDVATVAALPLKASRHNTASRAHVITRLVKNHVLNVSEE---SVVLVCERENLFASACAVVRAFPLYSRKTGNLLASSQPKLNLGCGDGNANSGRNVVNVEFVLINKDGCIESEPLTDDELNCLNETTRAIRMTARIVDMPCNEMNVDHFIQEVEDVGRELCITPKVIRGEELLEQGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGKYHGAILTNSETWEAKSLQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFIAAHLGFDYPGIWMHVDMATPVHCGERATGYGVALLLTLFGGHTDSKLLQSIASTDEEPPSKRW 652          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:npepl1 "aminopeptidase-like 1" species:7955 "Danio rerio" [GO:0019538 "protein metabolic process" evidence=IEA] [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0006508 "proteolysis" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] [GO:0005622 "intracellular" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0008233 "peptidase activity" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 ZFIN:ZDB-GENE-050417-177 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 UniGene:Dr.935 MEROPS:M17.006 CTD:79716 HOVERGEN:HBG053563 KO:K09611 EMBL:BC093321 RefSeq:NP_001017688.1 ProteinModelPortal:Q561T4 GeneID:550383 KEGG:dre:550383 InParanoid:Q561T4 NextBio:20879634 Uniprot:Q561T4)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 292/513 (56.92%), Postives = 375/513 (73.10%), Query Frame = 0
Query:   11 TAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFI-LANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKIK 519
            +A   E  N   +I+G L NL +  ++ +  K+  ++T++ W   + +LNP PTD+  L L+   +AALP++ SRHN+PS AH +T++++  L  G+     I ++CE+   FAS CA+ARA+P ++R++ +  +  KK V +EFI +  D  P+       + +A  G++ AARIVDTPC+EM+ + F+EE+K +   LGITP II+G+EL+++G GGIYGVGKAA NPPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA ILGAF + +K GF  NLHA+FCLAENSVGP ATRPDDIH LYSGKTVEINNTDAEGRLV+SDGVVYA KDL ADII+D+ TLTG+QG++TG  HAA +TN+ +WE   + AGRSSGDL  PLVYCPE+HFSEF S +ADMKNSVADR NA SSCAGLFI +HLGF++PG W+HVD+ASP + GERATG+GVA L +LFG      LL NSV+ L     +N  +    +  K
Sbjct:   11 SAGDSEPQNRPVLIVGQLANLQQANWTQVKGKLQPVVTKELWQAALSSLNPNPTDSCPLYLSHAAVAALPSRVSRHNSPSSAHFLTRLIRTCLPAGNNRC--IVMVCERTEVFASACAIARAFPLFTRRSASSRRTEKKHVTLEFITVGQDNGPLELSTLECLANAADGVRLAARIVDTPCSEMNTDDFLEEIKTVGNALGITPTIIRGEELKQKGFGGIYGVGKAALNPPALAVLSHTPSGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKATIKQGFKDNLHAVFCLAENSVGPAATRPDDIHTLYSGKTVEINNTDAEGRLVLSDGVVYASKDLSADIILDMATLTGAQGISTGKHHAAVMTNSEQWELACVRAGRSSGDLAHPLVYCPELHFSEFTSALADMKNSVADRENAQSSCAGLFIASHLGFDWPGVWVHVDIASPVHAGERATGFGVAPLLSLFGQASEDPLL-NSVSPLGAATVKNASEDQMERDCK 520          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 OrthoDB:EOG7966GR CTD:79716 KO:K09611 EMBL:AADN03007805 RefSeq:XP_417486.2 Ensembl:ENSGALT00000012184 GeneID:419314 KEGG:gga:419314 Uniprot:F1NSZ4)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 290/482 (60.17%), Postives = 363/482 (75.31%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFILANDRN-PISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSL 501
            +++G L+NL++L ++ +  K+   ++E+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS A  IT++++N   G   +  I ++CE+   FAS CA+ARA+P ++ ++    +  KK V VEF L    N PI  +  + +  A  GI+ AARIVDTPCNEM+ + F+EE+K + K LGITP +I+ +EL+ERG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA ILGAF + VK GF  NLHA+FCLAEN+VGP ATRPDDIHVLYSGKTVEINNTDAEGRL+++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTNN EWE   + AGR+ GDL  PLVYCPE+HFSEF S VADMKNSVADR N  SSCAGLFI +H+GF++PG W+H+D+A+P + GERATGYGVALL +LFG      LL N V+ L
Sbjct:   23 LVLGQLHNLHRLPWAQLRGKLQPRVSEELWQSALGTLNPNPTDSCPLYLNYATVAALPSRVSRHNSPSAAQFITRLVRNCLPGGV-NRCIVMVCERSEVFASACALARAFPLFTHRSSASRRTEKKTVTVEFFLVGQNNGPIEVETLKCLASATEGIRLAARIVDTPCNEMNTDNFLEEIKKVGKDLGITPTVIRDEELKERGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFKATVKQGFKDNLHAVFCLAENAVGPRATRPDDIHVLYSGKTVEINNTDAEGRLILADGVAYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNNEEWEKACVKAGRNCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNTPSSCAGLFIASHIGFDWPGVWVHIDIAAPVHAGERATGYGVALLLSLFGGASEDPLL-NMVSPL 502          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Probable aminopeptidase NPEPL1" species:9606 "Homo sapiens" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 EMBL:CH471077 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 eggNOG:COG0260 GO:GO:0008235 TreeFam:TF314954 OrthoDB:EOG7966GR EMBL:AK021645 EMBL:AK297667 EMBL:AK307771 EMBL:AK223094 EMBL:AL139349 EMBL:BC020507 EMBL:AB075854 EMBL:AL833971 RefSeq:NP_001191801.1 RefSeq:NP_001191802.1 RefSeq:NP_078939.3 RefSeq:XP_005260608.1 UniGene:Hs.654868 ProteinModelPortal:Q8NDH3 SMR:Q8NDH3 BioGrid:122832 MEROPS:M17.006 PhosphoSite:Q8NDH3 DMDM:68847034 PaxDb:Q8NDH3 PRIDE:Q8NDH3 DNASU:79716 Ensembl:ENST00000356091 Ensembl:ENST00000525817 Ensembl:ENST00000525967 GeneID:79716 KEGG:hsa:79716 UCSC:uc002xzp.3 UCSC:uc010gjo.2 UCSC:uc010zzr.2 UCSC:uc010zzs.1 CTD:79716 GeneCards:GC20P057267 HGNC:HGNC:16244 HPA:CAB004986 HPA:CAB017025 HPA:HPA036356 neXtProt:NX_Q8NDH3 PharmGKB:PA31702 HOVERGEN:HBG053563 InParanoid:Q8NDH3 KO:K09611 OMA:PGVWVHV GenomeRNAi:79716 NextBio:69055 PRO:PR:Q8NDH3 ArrayExpress:Q8NDH3 Bgee:Q8NDH3 CleanEx:HS_NPEPL1 Genevestigator:Q8NDH3 Uniprot:Q8NDH3)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 288/481 (59.88%), Postives = 359/481 (74.64%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAEN 508
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP + SRHN+PS AH IT++++  L  G      I ++CE+   FAS CA+ARA+P ++ ++G   ++ KK V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ +TF+EE+  + K+LGI P II+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E D E 
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRC--IVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLGCEVDVEE 510          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 OrthoDB:EOG7966GR OMA:PGVWVHV EMBL:DAAA02036332 Ensembl:ENSBTAT00000022232 Uniprot:F1MPJ8)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 287/474 (60.55%), Postives = 354/474 (74.68%), Query Frame = 0
Query:   52 WDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAENYQDTIQPKKIKL 520
            W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH IT++++  L  G      I ++CE+ +AFAS CA+ARA+P ++ ++G   +  KK V VEF L   D  P+     + +  A  G++ AARIVDTPCNEM+ +TF+EE+K + K+LGI P +I+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLS+KGKT MPGMKRDCGGAA +LGAF +AVK GF   LHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+DV TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E DA+        K+ +L
Sbjct:    3 WQAALSTLNPNPTDSCPLYLNYATVAALPSRVSRHNSPSAAHFITRLVRTCLPPGTHRC--ILMVCERSDAFASACALARAFPLFTHRSGASRRTEKKTVTVEFFLVGQDNGPVEVSTLQCLTSATEGVRLAARIVDTPCNEMNTDTFLEEIKKVGKELGIVPTVIRDEELKARGFGGIYGVGKAAIHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSMKGKTTMPGMKRDCGGAAAVLGAFRAAVKQGFKDTLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDVATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRQCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGQASEDPLL-NLVSPLGCEVDAQEGDAERDSKRRRL 473          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:Npepl1 "aminopeptidase-like 1" species:10090 "Mus musculus" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0005622 "intracellular" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006508 "proteolysis" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0008233 "peptidase activity" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0019538 "protein metabolic process" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 MGI:MGI:2448523 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 eggNOG:COG0260 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 HOGENOM:HOG000243131 OrthoDB:EOG7966GR MEROPS:M17.006 CTD:79716 HOVERGEN:HBG053563 KO:K09611 OMA:PGVWVHV EMBL:AL669896 EMBL:BC069933 EMBL:BC080707 RefSeq:NP_998898.1 UniGene:Mm.295629 ProteinModelPortal:Q6NSR8 SMR:Q6NSR8 PhosphoSite:Q6NSR8 PaxDb:Q6NSR8 PRIDE:Q6NSR8 Ensembl:ENSMUST00000044415 GeneID:228961 KEGG:mmu:228961 UCSC:uc008oeo.2 InParanoid:A2ACM6 NextBio:379269 PRO:PR:Q6NSR8 ArrayExpress:Q6NSR8 Bgee:Q6NSR8 CleanEx:MM_NPEPL1 Genevestigator:Q6NSR8 Uniprot:Q6NSR8)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 284/481 (59.04%), Postives = 360/481 (74.84%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAEN 508
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH IT++++  L  G      I ++CE+   FAS CA+ARA+P ++ ++G   +  K+ V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ + F+EE+  + K+LGITP II+ ++L+ +G GGIYGVGKAA +PPAL +LSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAEN+VGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADIIVD+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E DA+ 
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALATLNPNPTDSCPLYLNCATVAALPSRVSRHNSPSAAHFITRLVRTCLPPGTHRC--ILMVCEQTEVFASACALARAFPLFTHRSGASRRAEKRTVMVEFFLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGFGGIYGVGKAALHPPALAILSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLDCEVDAQE 510          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 eggNOG:COG0260 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 HOGENOM:HOG000243131 OrthoDB:EOG7966GR MEROPS:M17.006 CTD:79716 HOVERGEN:HBG053563 KO:K09611 OMA:PGVWVHV EMBL:CR956405 RefSeq:NP_001116620.1 UniGene:Ssc.34895 ProteinModelPortal:A5GFT5 STRING:9823.ENSSSCP00000008018 Ensembl:ENSSSCT00000008237 GeneID:100144530 KEGG:ssc:100144530 Uniprot:A5GFT5)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 276/458 (60.26%), Postives = 348/458 (75.98%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFG 486
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH IT++++  L  G      I ++CE+ +AFAS CA+ARA+P ++ ++G   +  KK V VEF L   D  P+     + +  A  G++ AARIVDTPCNEM+ + F+EE+K + + LGI P +I+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLS+KGKT MPGMKRDCGGAA +LGAF +AV+ GF  NLHA+FCLAENSVGP ATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLV+CPE+HF EF S VADMKNSVADR N+ SSCAGLFI +HLGF++PG W+H+D+A+P + GERATG+GVALL  LFG
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNCATVAALPSRVSRHNSPSAAHFITRLVRTCLPPGTHRC--ILMVCERSDAFASACALARAFPLFTHRSGAARRPEKKTVVVEFFLVGQDNGPVEVSTLQCLTSATEGVRLAARIVDTPCNEMNTDAFLEEIKKVGQDLGIAPTVIRDEELKTRGFGGIYGVGKAAVHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSMKGKTTMPGMKRDCGGAAAVLGAFRAAVRQGFKDNLHAVFCLAENSVGPKATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDIATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRQCGDLVHPLVFCPELHFCEFTSAVADMKNSVADRDNSPSSCAGLFIASHLGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFG 488          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 OMA:PGVWVHV EMBL:AAEX03014051 Ensembl:ENSCAFT00000019299 Uniprot:E2RR46)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 283/493 (57.40%), Postives = 360/493 (73.02%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAENYQDTIQPKKIKL 520
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH +T++++  L  G      I ++CE+ +AFAS CA+ARA+P ++ ++G   +  KK V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ +TF+EE+K + K LGITP II+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP+ AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTN+ +WE+  L A     DL  PL Y PE+HF+   S V DMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E DA+        K+ +L
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPSRVSRHNSPSAAHFVTRLVRTCLPPGTHRC--ILMVCERSDAFASACALARAFPLFTHRSGASRRSEKKTVTVEFFLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDTFLEEIKKVGKDLGITPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPEGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDMATLTGAQGIATGK-HAAVLTNSAQWEAACLKARPKCRDLVHPLGYWPELHFAS-PSAVGDMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLGCEVDAQEGDVERDSKRRRL 520          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:Npepl1 "aminopeptidase-like 1" species:10116 "Rattus norvegicus" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 RGD:1311351 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 GeneTree:ENSGT00530000063255 TreeFam:TF314954 OrthoDB:EOG7966GR EMBL:CH474062 MEROPS:M17.006 CTD:79716 KO:K09611 OMA:PGVWVHV EMBL:AABR06028158 RefSeq:NP_001101276.1 UniGene:Rn.8518 Ensembl:ENSRNOT00000034915 GeneID:311671 KEGG:rno:311671 UCSC:RGD:1311351 NextBio:35572220 PRO:PR:D4A3E2 Uniprot:D4A3E2)

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 251/399 (62.91%), Postives = 311/399 (77.94%), Query Frame = 0
Query:  114 ILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAEN 508
            ++CE+   FAS CA+ARA+P ++ ++G   +  K+ V VEF L   D  P+     + + +A  G++ AARIVDTPC+EM+ + F+EE+  + ++LGITP II+ ++L+ +G GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA ILGAF +A+K GF  NLHA+FCLAEN+VGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADIIVD+ TLTG+QG+ATG  HAA LTN+ EWE+  + AG+  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E DA+ 
Sbjct:    1 MVCEQPEVFASACALARAFPLFTHRSGASRRTEKRTVMVEFFLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCSEMNTDIFLEEISQVGRELGITPTIIRDEQLKTKGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFRAAIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGQKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLDCEVDAQE 398          
BLAST of EMLSAG00000000004 vs. GO
Match: - (symbol:NPEPL1 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004177 "aminopeptidase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008235 "metalloexopeptidase activity" evidence=IEA] [GO:0030145 "manganese ion binding" evidence=IEA] InterPro:IPR000819 InterPro:IPR011356 Pfam:PF00883 PRINTS:PR00481 PROSITE:PS00631 GO:GO:0005737 GO:GO:0004177 GO:GO:0006508 GO:GO:0030145 GO:GO:0008235 GeneTree:ENSGT00530000063255 OrthoDB:EOG7966GR EMBL:AAEX03014051 Ensembl:ENSCAFT00000045553 Uniprot:J9NWB8)

HSP 1 Score: 426.017 bits (1094), Expect = 6.427e-142
Identity = 206/345 (59.71%), Postives = 262/345 (75.94%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQ 373
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH +T++++  L  G      I ++CE+ +AFAS CA+ARA+P ++ ++G   +  KK V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ +TF+EE+K + K LGITP II+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP+ AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+Q
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPSRVSRHNSPSAAHFVTRLVRTCLPPGTHRC--ILMVCERSDAFASACALARAFPLFTHRSGASRRSEKKTVTVEFFLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDTFLEEIKKVGKDLGITPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPEGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDMATLTGAQ 375          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592778012|gb|GAXK01176556.1| (TSA: Calanus finmarchicus comp3577_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 289/514 (56.23%), Postives = 370/514 (71.98%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQ--------VTKKLVNVEFILANDR------NPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNS--VTSLKEFDAENYQDTIQPKKIKL 520
            +++G + +LN++ +  I  K+   + ++ W   + +L+P+PTD++SL +N   +AALP K SRHNT S AHSITKI+++L  G  E+  + ++C   + +ASGCAVARAY  YSRKT  +        V +  V VEF++ +          +S  + +++E +   IQ AAR+VD PCNEM+   F+EE   +A  LGI P II+G+EL ERG GG+YGVGKA+ +PPALVVLSH P ++T  +AWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAG+LGAF  AV+NGF   LH + CLAENSVGP ATRPDDIH +YSGKTVEINNTDAEGRLV+SDGV YA KDL  DI++D+ TLTG+QG+ATG  HA+ + N+  WE+    AGR SGDL+FP V+CPE+ F EF S VADMKNSVADR+NA  SCAGLFI A+LGF+FPG W+HVDMA+PA +GERATGYGV+LLNTLFG    A +L+ +  VT        + Q+    KKIKL
Sbjct:  231 MVVGQVKHLNRINWDTIKAKLEPRVNKELWTAAVASLSPSPTDSVSLYMNLATVAALPAKVSRHNTQSRAHSITKIVKSLTAGSNET--VVVVCTTQDMYASGCAVARAYSLYSRKTVGEPPNAQPRPVREVQVKVEFLVVDGEVGSARPASLSPSDKQALETSCEAIQLAARLVDAPCNEMNTTAFVEEAVKVASSLGIVPTIIRGEELRERGFGGLYGVGKASVHPPALVVLSHKPVTSTKAIAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGVLGAFSVAVRNGFTDTLHCVLCLAENSVGPLATRPDDIHTMYSGKTVEINNTDAEGRLVLSDGVAYAAKDLGCDIVLDMATLTGAQGIATGRYHASHMANDQTWETALSQAGRVSGDLSFPAVFCPELQFPEFTSAVADMKNSVADRNNAQPSCAGLFIFANLGFDFPGVWMHVDMAAPANSGERATGYGVSLLNTLFGSASKAEMLQTASPVTQENGMVERSSQEGGLSKKIKL 1766          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592762277|gb|GAXK01192136.1| (TSA: Calanus finmarchicus comp40429_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 136.732 bits (343), Expect = 6.817e-34
Identity = 86/286 (30.07%), Postives = 139/286 (48.60%), Query Frame = 0
Query:  179 AARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMA 464
            A ++++ P N +    F  E +     L +  ++ + +  +E GMG    V + +  P   + + ++    +  V  VGKG+ +DTGG+SIK    M  M+ D GGAA +     +    G   NL  L  L EN  G  AT+P D+    +G T++++NTDAEGRL+++D + YA   L+  +++DV TLTG+  VA G       +N  E  S     G S+GD  + +           NS +AD+ N        + + AG   N    F    +W+H+D+A
Sbjct:  605 ARQLMEAPANFLTPTQFCLEAEREMAGLPVELVVREEEWAKEMGMGSFLSVSRGSIEPAKFLEMKYSAGGDSKPVVLVGKGVTFDTGGISIKPSGKMDAMRADMGGAATVTATMKAVASMGMKVNLVVLVPLTENMPGGAATKPGDVVTAMNGVTIQVDNTDAEGRLILADALCYADT-LEPRLVMDVATLTGAMSVALGTAATGVFSNKGEDFSLLAECGTSTGDRVWRMPLWQTYKDKMKNSPLADLNNISLTPGGGSCTAAGFLAN----FTTCPSWMHLDIA 1447          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775750|gb|GAXK01178818.1| (TSA: Calanus finmarchicus comp14149_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 83.1889 bits (204), Expect = 5.465e-16
Identity = 75/246 (30.49%), Postives = 115/246 (46.75%), Query Frame = 0
Query:  171 HAIFGIQTAARIVDTPCNEMHVNTFIE-EVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPK-SATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRD-CGGAA--GILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD 404
            HAI   +  AR +     E      +E  V+   K   +   +++G+E  E+    +  V + AE  P     L+ L++  + +A   V  VGKGI YDTGG  IK    M GM RD CG AA  G++         G    + A  C+  NSVG NA   D+I    +G  + I NTDAEGR+ + D +  A++   +D    ++ + TLTG   +A G  ++  + N      +T    + +GD
Sbjct:  425 HAIEAGRVVARDIGGSDPERMAAPKVEVYVQEAFKGTNVKVEVMKGQEFFEKEYPCLAAVNRCAEQVPRHDGRLIWLTYEGEGTAKKTVYVVGKGITYDTGGADIKAGGVMAGMSRDKCGAAATAGLMKTIAELQPKGIK--VVAALCMVRNSVGANAYVSDEIFTSRAGVRIRIGNTDAEGRMAMVDVLCRAKEMALSDTNPHLLTMATLTGHACLAMGP-YSIIMDNGPARAEQTAQKVQKAGD 1153          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775751|gb|GAXK01178817.1| (TSA: Calanus finmarchicus comp14149_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 83.1889 bits (204), Expect = 5.939e-16
Identity = 75/246 (30.49%), Postives = 115/246 (46.75%), Query Frame = 0
Query:  171 HAIFGIQTAARIVDTPCNEMHVNTFIE-EVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPK-SATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRD-CGGAA--GILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD 404
            HAI   +  AR +     E      +E  V+   K   +   +++G+E  E+    +  V + AE  P     L+ L++  + +A   V  VGKGI YDTGG  IK    M GM RD CG AA  G++         G    + A  C+  NSVG NA   D+I    +G  + I NTDAEGR+ + D +  A++   +D    ++ + TLTG   +A G  ++  + N      +T    + +GD
Sbjct:  575 HAIEAGRVVARDIGGSDPERMAAPKVEVYVQEAFKGTNVKVEVMKGQEFFEKEYPCLAAVNRCAEQVPRHDGRLIWLTYEGEGTAKKTVYVVGKGITYDTGGADIKAGGVMAGMSRDKCGAAATAGLMKTIAELQPKGIK--VVAALCMVRNSVGANAYVSDEIFTSRAGVRIRIGNTDAEGRMAMVDVLCRAKEMALSDTNPHLLTMATLTGHACLAMGP-YSIIMDNGPARAEQTAQKVQKAGD 1303          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775752|gb|GAXK01178816.1| (TSA: Calanus finmarchicus comp14149_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 80.8777 bits (198), Expect = 3.024e-15
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 0
Query:  171 HAIFGIQTAARIVDTPCNEMHVNTFIE-EVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPK-SATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRD-CGGAA--GILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD 404
            HAI   +  AR +     E      +E  V+   K   +   +++G+E  E+    +  V + A   P     L+ L++  + +A   V  VGKGI YDTGG  IK    M GM RD CG AA  G++         G    + A  C+  NSVG NA   D+I    +G  + I NTDAEGR+ + D +  A++   +D    ++ + TLTG   +A G  ++  + N      +T    + +GD
Sbjct:  602 HAIEAGRVVARDIGGSDPERMAAPKVEVYVQEAFKGTNVKVEVMKGQEFFEKEYPCLAAVNRCANQVPRHDGRLIWLTYEGEGTAKKTVYVVGKGITYDTGGADIKAGGVMAGMSRDKCGAAATAGLMKTIAELQPKGIK--VVAALCMVRNSVGANAYVSDEIFTSRAGVRIRIGNTDAEGRMAMVDVLCRAKEMALSDTNPHLLTMATLTGHACLAMGP-YSIIMDNGPARAEQTAQKVQKAGD 1330          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775753|gb|GAXK01178815.1| (TSA: Calanus finmarchicus comp14149_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 80.8777 bits (198), Expect = 3.244e-15
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 0
Query:  171 HAIFGIQTAARIVDTPCNEMHVNTFIE-EVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPK-SATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRD-CGGAA--GILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD 404
            HAI   +  AR +     E      +E  V+   K   +   +++G+E  E+    +  V + A   P     L+ L++  + +A   V  VGKGI YDTGG  IK    M GM RD CG AA  G++         G    + A  C+  NSVG NA   D+I    +G  + I NTDAEGR+ + D +  A++   +D    ++ + TLTG   +A G  ++  + N      +T    + +GD
Sbjct:  602 HAIEAGRVVARDIGGSDPERMAAPKVEVYVQEAFKGTNVKVEVMKGQEFFEKEYPCLAAVNRCANQVPRHDGRLIWLTYEGEGTAKKTVYVVGKGITYDTGGADIKAGGVMAGMSRDKCGAAATAGLMKTIAELQPKGIK--VVAALCMVRNSVGANAYVSDEIFTSRAGVRIRIGNTDAEGRMAMVDVLCRAKEMALSDTNPHLLTMATLTGHACLAMGP-YSIIMDNGPARAEQTAQKVQKAGD 1330          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775313|gb|GAXK01179255.1| (TSA: Calanus finmarchicus comp14545_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 75.8702 bits (185), Expect = 1.229e-13
Identity = 68/228 (29.82%), Postives = 106/228 (46.49%), Query Frame = 0
Query:  164 DEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEE-VKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPKSATLNVAW-VGKGIVYDTGGLSIKGKTAMPGMKRD-CG--GAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGN 379
            +EA +IE      +  AR +     E      +EE V+ + K   +   +++G++  ER    +  V + A   P     L+ L++  +       + VGKGI YDTGG  IK    M GM RD CG   AAG++         G    +    C+  NSVG N    D+I    +G  + + NTDAEGR+ + D +  A++   +D    ++ V TLTG   +A G+
Sbjct:  774 EEALAIEKG----RVVARDIGGSDPERMAAPRVEEYVQEVFKGTKVKVEVMKGQDFFEREYPCLAAVNRCASTVPRHDGRLIWLTYQGEGVVEKTLYLVGKGITYDTGGADIKAGGVMAGMSRDKCGAAAAAGLMKTISELQPAGV--KVVVALCMVRNSVGANCYVADEIITSRAGVRIRVGNTDAEGRMAMVDVLCRAKELALSDPDPQLMTVATLTGHACLAVGD 1439          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775314|gb|GAXK01179254.1| (TSA: Calanus finmarchicus comp14545_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 75.8702 bits (185), Expect = 1.278e-13
Identity = 68/228 (29.82%), Postives = 106/228 (46.49%), Query Frame = 0
Query:  164 DEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEE-VKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPKSATLNVAW-VGKGIVYDTGGLSIKGKTAMPGMKRD-CG--GAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGN 379
            +EA +IE      +  AR +     E      +EE V+ + K   +   +++G++  ER    +  V + A   P     L+ L++  +       + VGKGI YDTGG  IK    M GM RD CG   AAG++         G    +    C+  NSVG N    D+I    +G  + + NTDAEGR+ + D +  A++   +D    ++ V TLTG   +A G+
Sbjct:  866 EEALAIEKG----RVVARDIGGSDPERMAAPRVEEYVQEVFKGTKVKVEVMKGQDFFEREYPCLAAVNRCASTVPRHDGRLIWLTYQGEGVVEKTLYLVGKGITYDTGGADIKAGGVMAGMSRDKCGAAAAAGLMKTISELQPAGV--KVVVALCMVRNSVGANCYVADEIITSRAGVRIRVGNTDAEGRMAMVDVLCRAKELALSDPDPQLMTVATLTGHACLAVGD 1531          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592775315|gb|GAXK01179253.1| (TSA: Calanus finmarchicus comp14545_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 75.8702 bits (185), Expect = 1.287e-13
Identity = 68/228 (29.82%), Postives = 106/228 (46.49%), Query Frame = 0
Query:  164 DEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEE-VKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPKSATLNVAW-VGKGIVYDTGGLSIKGKTAMPGMKRD-CG--GAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGN 379
            +EA +IE      +  AR +     E      +EE V+ + K   +   +++G++  ER    +  V + A   P     L+ L++  +       + VGKGI YDTGG  IK    M GM RD CG   AAG++         G    +    C+  NSVG N    D+I    +G  + + NTDAEGR+ + D +  A++   +D    ++ V TLTG   +A G+
Sbjct:  885 EEALAIEKG----RVVARDIGGSDPERMAAPRVEEYVQEVFKGTKVKVEVMKGQDFFEREYPCLAAVNRCASTVPRHDGRLIWLTYQGEGVVEKTLYLVGKGITYDTGGADIKAGGVMAGMSRDKCGAAAAAGLMKTISELQPAGV--KVVVALCMVRNSVGANCYVADEIITSRAGVRIRVGNTDAEGRMAMVDVLCRAKELALSDPDPQLMTVATLTGHACLAVGD 1550          
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Match: gi|592903040|gb|GAXK01055335.1| (TSA: Calanus finmarchicus comp85622_c2_seq8 transcribed RNA sequence)

HSP 1 Score: 38.1206 bits (87), Expect = 5.473e-2
Identity = 19/68 (27.94%), Postives = 35/68 (51.47%), Query Frame = 0
Query:  150 VEFILANDRNPISGDEARSIEHAIFGIQTAARIV--------DTPCNEMHVNTFIEEVKNIAKKLGIT 209
            V  +L  D +P++G    ++ H   G+Q A R+         D P +++H N    +VKN++K++  T
Sbjct:   56 VLLVLPVDHHPVTGVAVHTVLHC--GVQLAIRLFWYYMFFCSDLPGHKVHFNIIFRKVKNLSKRIPFT 253          
BLAST of EMLSAG00000000004 vs. L. salmonis peptides
Match: EMLSAP00000000004 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:13254:18935:1 gene:EMLSAG00000000004 transcript:EMLSAT00000000004 description:"snap_masked-LSalAtl2s1003-processed-gene-0.9")

HSP 1 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 522/522 (100.00%), Postives = 522/522 (100.00%), Query Frame = 0
Query:    1 MDTKIKVVTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKIKLSV 522
            MDTKIKVVTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKIKLSV
Sbjct:    1 MDTKIKVVTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKIKLSV 522          
BLAST of EMLSAG00000000004 vs. L. salmonis peptides
Match: EMLSAP00000002733 (pep:novel supercontig:LSalAtl2s:LSalAtl2s157:295955:297988:1 gene:EMLSAG00000002733 transcript:EMLSAT00000002733 description:"maker-LSalAtl2s157-snap-gene-3.1")

HSP 1 Score: 191.045 bits (484), Expect = 1.766e-57
Identity = 93/133 (69.92%), Postives = 104/133 (78.20%), Query Frame = 0
Query:  344 RLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGY 476
            +L+VSDGVVYAQKDLKAD IVDVCTLTGSQ  A+GN++AAFLTNNYE ESKT +AGRSS DL FP VYCPEV            KN + D SNATSS AGLFINAHLG NFPGTWLH+DM + AY+GE+ T Y
Sbjct:   42 KLIVSDGVVYAQKDLKADTIVDVCTLTGSQRXASGNLYAAFLTNNYEGESKTFSAGRSSEDLIFPFVYCPEVK---------CYKNYIEDLSNATSSSAGLFINAHLGVNFPGTWLHLDMVTLAYSGEKPTSY 165          
BLAST of EMLSAG00000000004 vs. L. salmonis peptides
Match: EMLSAP00000006113 (pep:novel supercontig:LSalAtl2s:LSalAtl2s332:452120:457604:1 gene:EMLSAG00000006113 transcript:EMLSAT00000006113 description:"augustus_masked-LSalAtl2s332-processed-gene-4.0")

HSP 1 Score: 117.857 bits (294), Expect = 4.935e-28
Identity = 74/213 (34.74%), Postives = 111/213 (52.11%), Query Frame = 0
Query:  161 ISG--DEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEER-GMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLT 370
            ISG  DE  S  H   G   A  +++TP N +    + E+V           + +  +    + GMG    V   +  PP  + +++  ++ T  V  VGKG+ +DTGG+SIK    M  M+ D GGAA + GA  SAV      +L  L  L EN  G  AT+P D+    +GKT++++NTDAEGRL+++D + YA    K  +++D  TLT
Sbjct:  681 ISGNCDEWYSGFHKAEGQNFARTLMETPANHLTPTLYAEKVVKAFSAFKNVNIQVHDQSWAAKMGMGSFLSVSAGSAEPPKFLEMTYQ-QNDTPPVILVGKGVTFDTGGISIKPSKGMDLMRADMGGAAVVTGALLSAVSLNLPLHLKVLIPLCENMPGSKATKPGDVVKAMNGKTIQVDNTDAEGRLILADALCYADT-FKPSMVIDAATLT 891          
BLAST of EMLSAG00000000004 vs. L. salmonis peptides
Match: EMLSAP00000001093 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:789285:793687:-1 gene:EMLSAG00000001093 transcript:EMLSAT00000001093 description:"maker-LSalAtl2s117-augustus-gene-8.12")

HSP 1 Score: 80.1073 bits (196), Expect = 5.566e-16
Identity = 95/362 (26.24%), Postives = 151/362 (41.71%), Query Frame = 0
Query:  118 KHNAFAS--GCAVARAYPSYSRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKA----AENPPALVVLSHTPKSATLNVAW-VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLA--ENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTN----NYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADR---SNATSSCAGLFINAHLGFNFPGTWLH 460
            K+  FA   G   A   P   R+   Q   K       LA D N ++ ++ RS+   I G         +    M      E V+++ K  G+   ++ G +  E+    +  V +A    A +   ++ L++ P+      A  VGKGI YDTGG  IK    M GM RD  GAA   G F   +     +NL  +  +A   NSVG N    D+I    +G  + + NTDAEGR+ + D + + ++    ++   ++ + TLTG   +A G  + A + N    + ++ S  +  G   GD      +       E   M+ D+     D    +NA SS          G  FP  ++H
Sbjct:  603 KYAEFAXLMGAYTALYVPLEMREEVPQRAIKAXXXXXFLARDAN-MALEKGRSVSRDIGG---------SDPERMAPPRVEEYVRSVFKDSGVKIEVVAGHDTFEKXYPCLAAVNRAXSTVARHQGRVIWLTYEPEGKVEKTAMIVGKGITYDTGGADIKAGGIMAGMSRDKCGAADAAG-FMKTISELKPKNLKVVVGMAMVRNSVGSNCYVSDEIITSRAGVRIRVGNTDAEGRMAMVDVLCHMREKALREVNPHLMTIATLTGHAVIAVGP-YTAVMDNGPASDIDFASNMVKLGTEIGD-----PFEKSTIRREDYKMIQDVSGEYVDVLQCNNAASS------RTPRGHQFPAAFMH 941          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|68565875|sp|Q5R7G6.2|PEPL1_PONAB (RecName: Full=Probable aminopeptidase NPEPL1; AltName: Full=Aminopeptidase-like 1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 290/493 (58.82%), Postives = 363/493 (73.63%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAENYQDTIQPKKIKL 520
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP + SRHN+PS AH IT++++  L  G      I ++CE+   FAS CA+ARA+P ++ ++G   ++ KK V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ +TF+EE+  + K+LGI P II+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E D E        K+ +L
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRC--IVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLGCEVDVEEGDVGRDSKRRRL 522          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|68847034|sp|Q8NDH3.3|PEPL1_HUMAN (RecName: Full=Probable aminopeptidase NPEPL1; AltName: Full=Aminopeptidase-like 1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 288/481 (59.88%), Postives = 359/481 (74.64%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAEN 508
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP + SRHN+PS AH IT++++  L  G      I ++CE+   FAS CA+ARA+P ++ ++G   ++ KK V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ +TF+EE+  + K+LGI P II+ +EL+ RG GGIYGVGKAA +PPAL VLSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAENSVGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADII+D+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E D E 
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRC--IVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLGCEVDVEE 510          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|68565890|sp|Q6NSR8.1|PEPL1_MOUSE (RecName: Full=Probable aminopeptidase NPEPL1; AltName: Full=Aminopeptidase-like 1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 284/481 (59.04%), Postives = 360/481 (74.84%), Query Frame = 0
Query:   33 KLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN-LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--QVTKKLVNVEFIL-ANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLK-EFDAEN 508
            ++ +S +  K+   +TE+ W   + TLNP PTD+  L LN   +AALP++ SRHN+PS AH IT++++  L  G      I ++CE+   FAS CA+ARA+P ++ ++G   +  K+ V VEF L   D  P+     + + +A  G++ AARIVDTPCNEM+ + F+EE+  + K+LGITP II+ ++L+ +G GGIYGVGKAA +PPAL +LSHTP  AT  +AWVGKGIVYDTGGLSIKGKT MPGMKRDCGGAA +LGAF +A+K GF  NLHA+FCLAEN+VGPNATRPDDIH+LYSGKTVEINNTDAEGRLV++DGV YA KDL ADIIVD+ TLTG+QG+ATG  HAA LTN+ EWE+  + AGR  GDL  PLVYCPE+HFSEF S VADMKNSVADR N+ SSCAGLFI +H+GF++PG W+H+D+A+P + GERATG+GVALL  LFG      LL N V+ L  E DA+ 
Sbjct:   33 RVPWSHVRGKLQPRVTEELWQAALATLNPNPTDSCPLYLNCATVAALPSRVSRHNSPSAAHFITRLVRTCLPPGTHRC--ILMVCEQTEVFASACALARAFPLFTHRSGASRRAEKRTVMVEFFLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGFGGIYGVGKAALHPPALAILSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLL-NLVSPLDCEVDAQE 510          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|466102|sp|P34629.1|AMPL_CAEEL (RecName: Full=Leucine aminopeptidase 1)

HSP 1 Score: 365.54 bits (937), Expect = 2.317e-120
Identity = 199/481 (41.37%), Postives = 298/481 (61.95%), Query Frame = 0
Query:   20 SSNIIIGHLNNLNKLKFSDISKKVGS-LITE-DAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFIL-CEKHNAFASGCAVARAYPSYSRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNS-VADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            +S II+G  + L  + F    K+V    +T+ D+W+  I  +  +    +   L  +I   +P   SR NTP++AHSI K L+ +N+     +  F+L  E  +  +   A+AR +  +S KT + + +  VN++ +     + ++ ++A  +      ++  AR++DTP N +  +  ++E   +    G    +I+G+EL + G GGIY VGKA   PPA VVLSH    +T ++A VGKG+VYDTGGL IK KT MP MKRD GGAAG+L A+ + VK+GF+Q LHA  C+ EN+V P A +PDDI  + SGKTVEINNTDAEGRL+++DGV YA++ LKA  I D+ TLTG+Q   +G +H A +TN+ + E++ + AG++SGDL  P+++ P++ F +  S +ADMKNS +       S+ AGLFI AH+GF     WLH+D+A+PA  G+R TGYG AL +TL G + +  +LK 
Sbjct:   18 TSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLI--TVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKT-SGIRELNVNIDVVC----DKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLFIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLKQ 491          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|56404562|sp|Q7M8W6.1|AMPA_WOLSU (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 181.03 bits (458), Expect = 8.470e-50
Identity = 118/355 (33.24%), Postives = 190/355 (53.52%), Query Frame = 0
Query:  136 SRKTGTQVTKKLVNVEFILANDRNPISGDEARSIEHAI-FGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEF-NSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGER-------ATGYGVALL 481
            S+K+ +++T+ L++++  L    +  S +   + + AI   +  A  +V+TP  +       +  + +A++  +   I   K LE+  MG    V +A+ + P L+ L+H      L VA VGKG+ YD+GGLS+K    M  MK D GG   ++    +A + G    LH +    EN +G NA +PDD+    +GKT+EI NTDAEGRLV++D +VYAQ +LK D I+D+ TLTG+  V  G   +  L ++ E + + +     SG+LT  L +    H  +   S VAD+ N  + R    S  AGLF++  +  ++   WLH+D+A PAY  +        A+G GV ++
Sbjct:  122 SQKSESKLTQILISLQTHLGRQIDSKSFETILARQSAIARAVNLARELVNTPPEDATPQKIAQAAQKVAQEHQLECRIEDEKFLEKEQMGAFLAVSRASIHRPRLIHLTHQSPKPKLKVALVGKGLTYDSGGLSLKPADFMVTMKADKGGGCAVIAILQAAKELGLELELHGIVGATENMIGGNAYKPDDVLRAKNGKTIEIRNTDAEGRLVLADCLVYAQ-ELKPDYIIDLATLTGACVVGLGEYTSGVLGHSQELKHRFIECATQSGELTADLPF--NRHLKKLIESKVADVCNVSSTRYGG-SITAGLFLSEFIEESYKEKWLHLDIAGPAYVEKEWDVNPHGASGAGVRMV 472          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|56404525|sp|Q6NG90.1|AMPA_CORDI (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 180.644 bits (457), Expect = 1.667e-49
Identity = 110/295 (37.29%), Postives = 167/295 (56.61%), Query Frame = 0
Query:  182 IVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGY 476
            +V+ P + ++  ++   +++ A+K+G+   I+  K+LE++G GGI  VG  +   P LV L+  PK A  ++A VGKGI +DTGG+S+K    M  M  D GG+A ++    +A + G   N+ A   LAEN  G NA RP D+   Y G T EI NTDAEGRLV++D +  A +D K D +++V TLTG+Q VA G+  +  + ++   +S  LT GR+ G+  + +   PE    +  S VAD++N    RS      AG +++  +G      W HVD+A PAY      GY
Sbjct:  189 LVNAPSSHLYPESYAAIIRDTAEKIGLGVEILDEKKLEKQGFGGILAVGTGSSRKPRLVRLTWAPKKAKKSIALVGKGITFDTGGISLKPGAGMDDMISDMGGSATMVATIIAAARLGVKLNVTATIPLAENMPGGNAFRPGDVITHYGGITSEILNTDAEGRLVLADAIARASED-KPDYLLNVATLTGAQIVALGDRTSGVMGSDEFRDSVALT-GRTVGEPAWAM-PLPEEIGEDVKSPVADIRNVTGSRSGGM-MAAGWYLSHFVGEGI--EWAHVDIAGPAYNKAGVYGY 477          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|166215792|sp|A6X259.1|AMPA_OCHA4 (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 180.259 bits (456), Expect = 2.415e-49
Identity = 121/342 (35.38%), Postives = 177/342 (51.75%), Query Frame = 0
Query:  159 NPISGDEARSIEHAIF-GIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLS-HTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVD-----MASPA--YTGERATGYGVALLNTLFGDHMNA 491
            +P +   A  +  A+  G+  A  +V+ P N +    F +E + + +KLG+   ++  KE+++ GMG + GV + +  PP LV++     KS    VA+VGKG+V+DTGG+SIK    M  MK D GGAA + G   +        N   +  L EN    NA RP DI    SG+T+E+ NTDAEGRLV++D + Y     K   I+++ TLTG+  VA G  HA   +N+ E   +   AG+ +G+  + L    E +    +S  ADMKNS        S  A  F+   +G      W H+D     M SPA  Y+   A+GYGV LL+ L  DH  +
Sbjct:  164 DPHTAKRAFEVAEAVADGVIQARNLVNEPANILGPVEFAQEAEKL-EKLGVKIEVLGEKEMKKLGMGALLGVAQGSVRPPRLVIMEWQGAKSKEKPVAFVGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAVTGLMRALAGRKAKVNAIGIIGLVENMPDGNAQRPGDIVTSMSGQTIEVINTDAEGRLVLADALHYTNDRFKPRFIINLATLTGAVMVALGQYHAGLFSNDDELADQLYDAGQLTGEKLWRLPLGTE-YDKMIDSKFADMKNSAGRYGG--SITAAQFLKRFVGET---AWAHLDVAGTAMGSPANEYSQTWASGYGVRLLDRLVRDHFES 498          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|166198340|sp|A5VPM3.1|AMPA_BRUO2 (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 179.104 bits (453), Expect = 6.444e-49
Identity = 119/325 (36.62%), Postives = 169/325 (52.00%), Query Frame = 0
Query:  175 GIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLS-HTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVD-----MASPA--YTGERATGYGVALLNTLFGDHMNA 491
            G+  A  +V+ P N +    F EE + + +KLG+   ++  KEL++ GMG + GV + +  PP LVV+  H  K     +A+VGKG+V+DTGG+SIK    M  MK D GGAA + G   +        N   +  L EN    NA RP DI    SG+T+E+ NTDAEGRLV++D + Y     K   I+++ TLTG+  VA G  HA   +N+ E   +   AG+S+G+  + L    E +    +S  ADMKNS        S  A  F+   +G      W H+D     M SPA  Y    A+G+GV LL+ L  D   +
Sbjct:  180 GVIQARNLVNEPANILGPVEFAEEAEKL-EKLGVKVEVLGEKELKKLGMGALLGVAQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKPAANMEDMKGDMGGAAAVTGLMRALAGRKAKVNAIGVIGLVENMPDGNAQRPGDIVTSMSGQTIEVINTDAEGRLVLADALHYTNDRFKPRFIINLATLTGAVMVALGQYHAGLFSNDDELADQLYDAGQSTGEKLWRLPLGTE-YDKMIDSKFADMKNSAGRYGG--SITAAQFLKRFVGET---PWAHLDVAGTAMGSPANEYNQSWASGFGVRLLDRLVRDQFES 497          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|254802497|sp|B1V932.1|AMPA_PHYAS (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 178.718 bits (452), Expect = 6.961e-49
Identity = 118/364 (32.42%), Postives = 186/364 (51.10%), Query Frame = 0
Query:  134 SYSRK-TGTQVTKKLVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLN-VAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPA-------YTGERATGYGVALLNTLFGDH 488
            SYS K   TQ TK   N+E     +   +   E   ++  + G+     +V+ P N +  N F+E  + + + LG+   ++  + LE+ GM  + GV + ++ PP LVV+     +     VA+VGKG+V+DTGG+S+K    M  MK D  GAA ++G  ++        N+  +  L EN  G NA RP DI    SG+T+E+ NTDAEGRLV++D + Y +  L+  +I+D+ TLTG+  VA G  +A   +NN E   + + +G  + +  +     PE +    +   AD+ N       A S  A  F+   +G + P  W H+D+A  A       +    A+G+GV LLN L  D+
Sbjct:  131 SYSFKHYHTQKTKNEKNLEITFITENAELCQKEFDDVKAILGGVNLTKELVNEPANILGTNEFVERTQQL-QTLGVEVEVLNKETLEKLGMNALLGVAQGSQRPPYLVVMKWLGGNENEKPVAFVGKGVVFDTGGISLKPSNKMEDMKGDMAGAATVVGLMHALAARKAKVNVLGVIGLVENMPGSNAQRPGDIVTSMSGQTIEVINTDAEGRLVLADALWYCKTKLQPKMIIDLATLTGAIVVALGYEYAGLFSNNKELVKQLVHSGEVTEEKVWQFPLGPE-YDRLVDGKFADISNCPVGYG-AGSITAAQFLKRFVGDDIP--WAHIDIAGVASGKKKNEFNSSWASGFGVRLLNHLVKDY 489          
BLAST of EMLSAG00000000004 vs. SwissProt
Match: gi|29336740|sp|Q8G1M4.1|AMPA_BRUSU (RecName: Full=Probable cytosol aminopeptidase; AltName: Full=Leucine aminopeptidase; Short=LAP; AltName: Full=Leucyl aminopeptidase)

HSP 1 Score: 178.718 bits (452), Expect = 7.664e-49
Identity = 119/325 (36.62%), Postives = 169/325 (52.00%), Query Frame = 0
Query:  175 GIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLS-HTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVD-----MASPA--YTGERATGYGVALLNTLFGDHMNA 491
            G+  A  +V+ P N +    F EE + + +KLG+   ++  KEL++ GMG + GV + +  PP LVV+  H  K     +A+VGKG+V+DTGG+SIK    M  MK D GGAA + G   +        N   +  L EN    NA RP DI    SG+T+E+ NTDAEGRLV++D + Y     K   I+++ TLTG+  VA G  HA   +N+ E   +   AG+S+G+  + L    E +    +S  ADMKNS        S  A  F+   +G      W H+D     M SPA  Y    A+G+GV LL+ L  D   +
Sbjct:  180 GVIQARNLVNEPANILGPVEFAEEAEKL-EKLGVKVEVLGEKELKKLGMGALLGVAQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKPAANMEDMKGDMGGAAAVTGLMRALAGRKAKVNAIGVIGLVENMPDGNAQRPGDIVTSMSGQTIEVINTDAEGRLVLADALHYTNDRFKPRFIINLATLTGAVMVALGQYHAGLFSNDDELADQLYDAGQSTGEKLWRLPLGTE-YDKMIDSKFADMKNSAGRYGG--SITAAQFLKRFVGET---PWAHLDVAGTAMGSPANEYNQSWASGFGVRLLDRLVRDQFES 497          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: gb|EFA07320.1| (putative aminopeptidase NPEPL1-like Protein [Tribolium castaneum])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 313/496 (63.10%), Postives = 390/496 (78.63%), Query Frame = 0
Query:    8 VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTK-KLVNVEFILAN------DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            +TKT PQQ    +  +IIG + +L +LKF DI  K+   ++ED +   + +L+P+PTD+ SL LN   +AALP KCSRHNTPS AH+IT+++Q+   G  ES  I I+CE+++ +ASGCAVARA+P YSRKTG+  T+   V+VEF++        D   +S +E + ++ A  GI+ AARIVDTPCNEM+V+ F++E++ +   L I P II+G+EL ERG GGIYGVGKAA  PPAL VLS+TP+ A   +AWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFY+AVK  F QNLHA+FCLAEN+VGPNAT+PDDIH LYSG+TVEINNTDAEGRLV+SDGV +AQKDLKA++I+D+ TLTG+QGVATG  HAA LTNN +WE+  + AG +SGDL FP+ +CPE+HFSEF+S VADMKNSVADRSNA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGVALL TLFG +    LLK+
Sbjct:   11 LTKTDPQQ----TPVLIIGQVKHLTQLKFQDIKSKLEPRVSEDVFKVAVSSLHPSPTDSCSLYLNLATVAALPVKCSRHNTPSRAHAITRLVQSCTVGLDES--IVIICERNDVYASGCAVARAFPLYSRKTGSNTTEYSTVSVEFVIVPSNSDEIDGTELSAEELKILDDAATGIRLAARIVDTPCNEMNVDHFLQEIREVGDALKIQPTIIRGEELAERGFGGIYGVGKAANVPPALAVLSYTPQGAHSTIAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYAAVKANFTQNLHAVFCLAENAVGPNATKPDDIHTLYSGRTVEINNTDAEGRLVLSDGVAFAQKDLKANVILDMATLTGAQGVATGKYHAAVLTNNEDWENMAMEAGLTSGDLVFPIPFCPELHFSEFSSAVADMKNSVADRSNAQSSCAGLFIAAHLGFDYPGVWVHVDMATPVHCGERATGYGVALLTTLFGKYCKQPLLKS 500          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: AAF54874.4 (granny smith, isoform F [Drosophila melanogaster])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 299/512 (58.40%), Postives = 377/512 (73.63%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVT------------------KKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENY 509
            +IIG L +LN LKFS +  K+   +TE+ +   +  L+PAPTD +SL L+   +AALP K SRHNT S AH+IT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG  +                   + +VNVEF+L N     +  P++ DE   +      I+  ARIVD PCNEM+V+ FI+EV+++ ++L ITP +I+G+EL E+G GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIK KT MPGMKRDCGGAA ILG FY+AV+ GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WE+K+L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGV+LL TLFG H ++ LL++  ++ +E  ++ +
Sbjct:  144 LIIGQLRHLNLLKFSHLESKLSPRVTEETFLNAVACLHPAPTDKVSLYLDVATVAALPLKASRHNTASRAHAITRLVKNHVLNVSEE---SVVLVCERENLFASACAVVRAFPLYSRKTGNLLASSQPKLNLGCGDGNANSGRNVVNVEFVLINKDGCIESEPLTDDELNCLNETTRAIRMTARIVDMPCNEMNVDHFIQEVEDVGRELCITPKVIRGEELLEQGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGKYHGAILTNSETWEAKSLQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFIAAHLGFDYPGIWMHVDMATPVHCGERATGYGVSLLLTLFGGHTDSKLLQSIASTDEEPPSKRW 652          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: AAF54873.1 (granny smith, isoform B [Drosophila melanogaster])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 299/506 (59.09%), Postives = 374/506 (73.91%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVT------------------KKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKE 503
            +IIG L +LN LKFS +  K+   +TE+ +   +  L+PAPTD +SL L+   +AALP K SRHNT S AH+IT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG  +                   + +VNVEF+L N     +  P++ DE   +      I+  ARIVD PCNEM+V+ FI+EV+++ ++L ITP +I+G+EL E+G GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIK KT MPGMKRDCGGAA ILG FY+AV+ GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WE+K+L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGV+LL TLFG H ++ LL++  ++ +E
Sbjct:   47 LIIGQLRHLNLLKFSHLESKLSPRVTEETFLNAVACLHPAPTDKVSLYLDVATVAALPLKASRHNTASRAHAITRLVKNHVLNVSEE---SVVLVCERENLFASACAVVRAFPLYSRKTGNLLASSQPKLNLGCGDGNANSGRNVVNVEFVLINKDGCIESEPLTDDELNCLNETTRAIRMTARIVDMPCNEMNVDHFIQEVEDVGRELCITPKVIRGEELLEQGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKAKTGMPGMKRDCGGAAAILGTFYAAVQCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGKYHGAILTNSETWEAKSLQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFIAAHLGFDYPGIWMHVDMATPVHCGERATGYGVSLLLTLFGGHTDSKLLQSIASTDEE 549          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: EFX74288.1 (hypothetical protein DAPPUDRAFT_307351 [Daphnia pulex])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 303/524 (57.82%), Postives = 382/524 (72.90%), Query Frame = 0
Query:    4 KIKVVTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKT------GTQVTKKL---VNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKI 518
            K K  +  +P   + N   +IIG   NL K+ ++D+S K G  +TED +   + ++  +P D   L LN   ++ LP KCSRHN PS +H+ITK +++     +++  I I+C K + F S  AVARAYP YSRKT      G    +K+   V+VE+ L ++  P++ DE   +E A   ++ +ARIVDTPCNEM+ + F+EE+  +AK+LGI P II+ KELE +G GGIYGVGKAA NPPALVVLSH PK AT  +AWVGKGI+YDTGGLSIKGKTAMPGMKRDCGGA+GILGAF  AV  GF +NLHA+FCLAENSVGP +TRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKAD+I+D+ TLTG Q VATG  HAA LTNN  WE+  + AG  SGDLTFP+ +CPE HFSEFNS VADMKNSVADRSNA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGVALL +LFG + ++ LL+N    L+E   +  ++  + K++
Sbjct:    5 KFKFSSILSPSDPITNPV-VIIGTPKNLAKISYNDMSTKFGGRVTEDVFSSALNSVQSSP-DVCPLYLNSATISPLPGKCSRHNAPSRSHAITKCVRSAATSGKDNF-IVIICGKQDVFPSATAVARAYPLYSRKTNLSSKLGATSAEKVPITVSVEYFLLDNAIPLTEDECEMLEIAAESVRLSARIVDTPCNEMNTDHFLEEIGIVAKELGIEPFIIRDKELERQGFGGIYGVGKAAPNPPALVVLSHLPKGATKTIAWVGKGIMYDTGGLSIKGKTAMPGMKRDCGGASGILGAFRLAVLTGFKENLHAVFCLAENSVGPLSTRPDDIHTLYSGRTVEINNTDAEGRLVLADGVFYAHKDLKADVILDMATLTGGQSVATGKQHAAVLTNNEHWENALVDAGLVSGDLTFPIPFCPEFHFSEFNSAVADMKNSVADRSNALSSCAGLFILAHLGFDYPGVWMHVDMAAPVHCGERATGYGVALLVSLFGQYSSSALLQNIGPVLEESADDGNENERKKKRL 525          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: EAA12333.4 (AGAP007809-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 295/481 (61.33%), Postives = 364/481 (75.68%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKT--GTQV-TKKLVNVEFILANDRNP----ISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            +I+G L +L +L F  IS K+   +  + +   +  L+PAPTDT SL L+   +AALP K SRHNT S AHSITK++Q+   G  ES  I I+CEK +  AS CAVARA+P YSRKT  G  V     V++EF+L    +P    I+ ++   + +   GI+  ARIVD PCNEM+V+ F+ EV+ IA +LG+   II+G+EL+++G GGIYGVGKAA +PPAL VLSH PK AT  VAWVGKGIV+DTGGLSIKGKTAMPGMKRDCGGAA ILG FY+AVK+GF QNLHA+FCLAENSVGP ATRPDDIH LYSG TVEINNTDAEGRLV++DGVVYA +DLKA++I+D+ TLTG+QG+ATG  H A LTN+ EWE K +  GR +GD+  P+ YCPE+HFSEFNS VADMKNSV DR NA  SCAGLFI AHLGF++ G+W+HVDMA+P + GERATGYGVALL  LFG+H  A +L++
Sbjct:   21 LIVGQLRHLTELPFERISSKLEPRVERETFAKAVSCLHPAPTDTCSLYLDLARVAALPLKSSRHNTASRAHSITKLIQSNTTGVSES--IVIVCEKQDLLASACAVARAFPLYSRKTSKGANVDPPPTVHIEFVLVGGNSPTDTEITEEDVLVLANVTVGIRLTARIVDAPCNEMNVSGFLSEVEAIALELGLKSKIIRGEELQQKGFGGIYGVGKAALDPPALAVLSHEPKGATETVAWVGKGIVFDTGGLSIKGKTAMPGMKRDCGGAAAILGGFYAAVKSGFRQNLHAVFCLAENSVGPLATRPDDIHRLYSGCTVEINNTDAEGRLVLADGVVYADRDLKANVILDMATLTGAQGIATGKYHGAILTNSDEWEEKAMEIGRRTGDMLCPVPYCPELHFSEFNSAVADMKNSVMDRGNAQVSCAGLFIGAHLGFDYGGSWMHVDMAAPVHNGERATGYGVALLAGLFGEHSKAAILRD 499          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: gb|EEC19779.1| (leucine aminopeptidase, putative [Ixodes scapularis])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 282/513 (54.97%), Postives = 358/513 (69.79%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKL------VNVEFILANDR--NPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIE----EVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSA-VKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLK--NSVTSLKEFDAENYQDTIQPKKIKL 520
            +IIG   NL+K+ F D+  K+   + E+ +   + +L+P+PTD+ S+ LN   LAALPTKCSRHNTPSHAHS+TK++++L+ G  E   + I+CE+ + FASGCAVARA+P +SRK+G Q  +        V VEF+L +     P+   + R +     GIQ  A+IVDTPC +M+   FI+    E++++   LG+ P II+G+EL  RG GG+Y VG+AA +PPALVVLSHTP+ +   +AWVGKGIVYDTGGL IK KTAM GM+    GAAG  G   S     GF+ NLHA+FCLAEN+VGPNA RPDDI  +YSGKTVEINNTDAEGRLVV DGV YA KDLKA+IIVD+ TLTG+QG+ATG  HAA +TN+ EWE   + +G  SGDL   + + PE+HFSEF S +ADMKNSVADR+NA  SCAGLFI +HLGF FPG W+H+DMA P + GERATGYGVALL TLFG      LLK  +S  S+   D E+       KKI+L
Sbjct:   23 LIIGQPRNLSKISFDDVKSKLDPRVGEEVFKAAVASLHPSPTDSCSMYLNLATLAALPTKCSRHNTPSHAHSLTKLVKSLSAGVDE--YVVIVCERQDVFASGCAVARAFPVFSRKSGLQQQQGSSQQPHTVTVEFLLVDSGGGRPLGDSDLRCLSATAEGIQLTAKIVDTPCQDMNTEAFIKACGSEIEHVGNALGLKPTIIKGEELNSRGFGGMYSVGRAATHPPALVVLSHTPEGSQDTIAWVGKGIVYDTGGLCIKTKTAMCGMRETAVGAAGFWGLLRSCQAWAGFSDNLHAIFCLAENAVGPNAIRPDDIITMYSGKTVEINNTDAEGRLVVGDGVAYAHKDLKANIIVDMATLTGAQGIATGKYHAAVVTNSSEWEELCVRSGIVSGDLIHAMPFAPELHFSEFASALADMKNSVADRNNAQPSCAGLFICSHLGFEFPGIWMHIDMAYPVHCGERATGYGVALLLTLFGHCSKNPLLKELSSCCSINGTDVESAT-----KKIRL 528          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: gb|KFM63195.1| (hypothetical protein X975_23745, partial [Stegodyphus mimosarum])

HSP 1 Score: 434.876 bits (1117), Expect = 4.128e-150
Identity = 201/310 (64.84%), Postives = 244/310 (78.71%), Query Frame = 0
Query:  186 PCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLK 495
            PC+EM+ + F++E+  +   LGI P +I+G++L +RG GGIY VG+AAE+PPAL +LSHT   A   +AWVGKGIVYDTGGL IK KT+M GMKRDCGGAA ILGAFY AVK GF +NLHA+FCLAEN+VGP A RPDDI  +YSG+TVEINNTDAEGRLV+ DGV YA+KDL A  I+D+ TLTG+QG ATG  HAA LTN+ EWE   + AG+ SGDL  P+ Y PE+HF+EF S +ADMKNSVADRSNA  SCAGLF+ A +GF++ G W+HVDMASP + G+RATGYGVALL TLFG   +  LL+
Sbjct:    2 PCSEMNTDAFLQEIHKVGDALGIKPEVIRGQDLAKRGFGGIYSVGQAAEHPPALAILSHTDPDAEETIAWVGKGIVYDTGGLCIKSKTSMAGMKRDCGGAAAILGAFYVAVKLGFQENLHAIFCLAENAVGPKAVRPDDIITMYSGRTVEINNTDAEGRLVLGDGVAYAEKDLNATTILDMATLTGAQGTATGRYHAALLTNSEEWEKAAVKAGQISGDLVHPVPYTPEIHFNEFASNIADMKNSVADRSNAQPSCAGLFVGAQIGFDYEGYWMHVDMASPVHCGDRATGYGVALLTTLFGHASDNSLLQ 311          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: XP_016772258.1 (PREDICTED: cytosol aminopeptidase-like [Apis mellifera])

HSP 1 Score: 151.754 bits (382), Expect = 2.564e-39
Identity = 107/309 (34.63%), Postives = 153/309 (49.51%), Query Frame = 0
Query:  162 SGDEARSIEHAIFGIQTAAR-IVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD--LTFPLVYCPEVHFS-EFNSMV--ADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMA 464
             G+E   I +     Q  AR + DTP N M    F  EV  I  KLGIT  I   +  E++ MG    V   +  PP  + + +     +  V ++GKG+ +D GG+S+K    M  M+ D  GAA ++ A  +A +     N+  L  L EN     AT+P DI +  +GK++ ++NTDAEGRL+++D + YAQ +     I+D+ TLTG+  +A G       TNN     K   AG  SGD    FPL      HF+ E    V  AD++N VA      S  A  F+   +  N P  WLH+D+A
Sbjct:  178 EGEEQWRIGNIKAQAQNWARHLADTPANLMTPTIFSTEVHTILTKLGITVQIHNEEWAEQKKMGSFLSVSHGSCEPPKFIEIHYKNADNSQPVVFIGKGVTFDAGGISLKPSADMDEMRADMSGAACVVAAIRAAAELKLKLNIVGLIPLTENLPSGTATKPGDIVIAMNGKSIIVDNTDAEGRLILADALCYAQ-EFNPSFILDIATLTGAMRIALGGAATGVFTNNSTLFEKLKNAGTLSGDRVWRFPLWQ----HFTDEMTKKVKSADVRN-VAKIKGGGSCTAAAFLREFVSNNTP--WLHLDIA 478          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: EEB18340.1 (Cytosol aminopeptidase, putative [Pediculus humanus corporis])

HSP 1 Score: 139.428 bits (350), Expect = 3.840e-35
Identity = 98/288 (34.03%), Postives = 143/288 (49.65%), Query Frame = 0
Query:  179 AARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKE-LEERGMGGIYGVGKAAENPPALVVLSHTPKSATLN-VAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMA 464
            A R  D P N M    F E  K + + +    + +  K+ +E + M     V K +  PP  + + +T KSA  + +  VGKGI +DTGG+++K  + M  M+ D GGAA +L   Y   K     N+  L  L EN  G  A +P DI    +GKTV I+NTDAEGRL+++D + YA   LK + IVDV TLTG+  +A G       TN+     +   AGR +GD  + L           +S + D+ N +   S   +  A  F+     F  P  W+H+D+A
Sbjct:  145 ARRFADAPANLMTPTIFSENAKKLFEGVKSVNVTVHDKKWIESQKMNTFLSVSKGSGEPPTFLEIKYTGKSAESSPIVLVGKGITFDTGGVNLKTASGMLDMRGDKGGAASVLATTYGIAKLNLPINVTTLIPLCENMPGSIANKPGDIIKAMNGKTVRIDNTDAEGRLILADALHYAST-LKPEFIVDVATLTGAMMIALGGEATGVFTNSNSLWKQLEEAGRYTGDRVWRLPLWKSYGKQLKSSHMVDLTN-IGKSSAGGACSAAAFLKE---FVPPVDWMHLDIA 427          
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Match: EFX68021.1 (hypothetical protein DAPPUDRAFT_260731 [Daphnia pulex])

HSP 1 Score: 131.339 bits (329), Expect = 1.342e-32
Identity = 92/298 (30.87%), Postives = 148/298 (49.66%), Query Frame = 0
Query:  175 GIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEE-----RGMGGIYGVGKAAENPPALVVLSHTP-KSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHF-SEFNSMVADMKNSVADRSNATSSC-AGLFINAHLGFNFPGTWLHVDMA 464
            G   A  +++ P N M    F     ++  + G   + I+ +  +E     +GM     V + +  PP  + +++    S    +  VGKGI +DTGG+SIK    M  M+ D GGAA  L    +A       +L  L  LAEN  G  A +P D+    +GKT++I+NTDAEGRL+++D + YAQ+  + ++++D+ TLTG+  VA G+  A   TN+         +  ++GD  + +      HF S   S +AD+ N    ++ A  SC A  F+     F     W+H+D+A
Sbjct:   82 GQNLARWLMEMPANHMTPTIFARHAVDLLGRAGGDGISIKVEAHDEAWASNQGMNSFLAVAQGSSEPPVFLEITYNNLPSKEKPIVIVGKGITFDTGGISIKPSANMDKMRGDMGGAACTLATILTAANLRLPLHLKGLIPLAENMPGGKAIKPGDVVKAMNGKTIQIDNTDAEGRLILADALAYAQQTYQPNLVLDIATLTGAINVALGSSAAGVFTNSNALWHLVHQSSFTTGDRVWRMPLWK--HFQSALESQLADLNN--VGKTGAGGSCSAAAFLKE---FTDAPHWMHLDIA 372          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|91094127|ref|XP_968492.1| (PREDICTED: probable aminopeptidase NPEPL1 [Tribolium castaneum] >gi|270010872|gb|EFA07320.1| putative aminopeptidase NPEPL1-like Protein [Tribolium castaneum])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 313/496 (63.10%), Postives = 390/496 (78.63%), Query Frame = 0
Query:    8 VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTK-KLVNVEFILAN------DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            +TKT PQQ    +  +IIG + +L +LKF DI  K+   ++ED +   + +L+P+PTD+ SL LN   +AALP KCSRHNTPS AH+IT+++Q+   G  ES  I I+CE+++ +ASGCAVARA+P YSRKTG+  T+   V+VEF++        D   +S +E + ++ A  GI+ AARIVDTPCNEM+V+ F++E++ +   L I P II+G+EL ERG GGIYGVGKAA  PPAL VLS+TP+ A   +AWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFY+AVK  F QNLHA+FCLAEN+VGPNAT+PDDIH LYSG+TVEINNTDAEGRLV+SDGV +AQKDLKA++I+D+ TLTG+QGVATG  HAA LTNN +WE+  + AG +SGDL FP+ +CPE+HFSEF+S VADMKNSVADRSNA SSCAGLFI AHLGF++PG W+HVDMA+P + GERATGYGVALL TLFG +    LLK+
Sbjct:   11 LTKTDPQQ----TPVLIIGQVKHLTQLKFQDIKSKLEPRVSEDVFKVAVSSLHPSPTDSCSLYLNLATVAALPVKCSRHNTPSRAHAITRLVQSCTVGLDES--IVIICERNDVYASGCAVARAFPLYSRKTGSNTTEYSTVSVEFVIVPSNSDEIDGTELSAEELKILDDAATGIRLAARIVDTPCNEMNVDHFLQEIREVGDALKIQPTIIRGEELAERGFGGIYGVGKAANVPPALAVLSYTPQGAHSTIAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYAAVKANFTQNLHAVFCLAENAVGPNATKPDDIHTLYSGRTVEINNTDAEGRLVLSDGVAFAQKDLKANVILDMATLTGAQGVATGKYHAAVLTNNEDWENMAMEAGLTSGDLVFPIPFCPELHFSEFSSAVADMKNSVADRSNAQSSCAGLFIAAHLGFDYPGVWVHVDMATPVHCGERATGYGVALLTTLFGKYCKQPLLKS 500          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|1059380516|ref|XP_017780863.1| (PREDICTED: probable aminopeptidase NPEPL1 [Nicrophorus vespilloides] >gi|1059380518|ref|XP_017780872.1| PREDICTED: probable aminopeptidase NPEPL1 [Nicrophorus vespilloides])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 311/504 (61.71%), Postives = 389/504 (77.18%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKLVNVEFILA------NDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKKIKL 520
            +I+G + +LN+LKFSD+  K+   +TE+ +   I +L P+PTD+ SL LN   +AALP KCSRHNTPS +H++T+++Q+   G  ES  I I+CEK + +ASGCAVARA+P+YSRKT    +   V +EFI+       +D   ++ ++ R ++ A +GI+ AA IVD PCNEM+V+ F++EV+ +  +L I P II+G+EL E+G GGIYGVGKAA  PPAL VLSHTP  A   VAWVGKGIVYDTGGLSIKGKT+MPGMKRDCGGAAGILGAFY+AVK+ F+QNLHA+FCLAENSVGP+ATRPDDIH LYSG+TVEINNTDAEGRLV+SDGVVYA++DL A+IIVD+ TLTG+QG+ATG  HAA LTNN +WE  T+TAG+ SGDL FP+ YCPE+H +EF+S +ADMKNSVADR NA  SCAGLFI +HLGF++PG WLHVDMA+PAY GERATGYGVALL TLFG      LLK+   +L +   EN       KKIK+
Sbjct:   24 LIVGQVKHLNQLKFSDVKLKLEPRVTEEVFKNAIASLQPSPTDSCSLYLNLATVAALPVKCSRHNTPSRSHTLTRLVQSYVVGVNES--IVIVCEKKDVYASGCAVARAFPTYSRKTTISNSNNNVTIEFIVIPNQESNDDSLDVTPEDLRVLDAAAYGIRLAAFIVDAPCNEMNVDHFVQEVEKVGNELNIKPTIIRGEELREKGFGGIYGVGKAATCPPALAVLSHTPPGARNTVAWVGKGIVYDTGGLSIKGKTSMPGMKRDCGGAAGILGAFYAAVKSNFSQNLHAVFCLAENSVGPDATRPDDIHTLYSGRTVEINNTDAEGRLVLSDGVVYAKRDLNANIIVDMATLTGAQGIATGKYHAAVLTNNGDWEDTTMTAGKLSGDLVFPVPYCPELHVTEFSSAIADMKNSVADRGNAQPSCAGLFIASHLGFDYPGVWLHVDMAAPAYYGERATGYGVALLTTLFGSFCELPLLKSIGPNLDDSMTENCA-----KKIKM 520          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|195395172|ref|XP_002056210.1| (uncharacterized protein Dvir_GJ10808, isoform A [Drosophila virilis] >gi|194142919|gb|EDW59322.1| uncharacterized protein Dvir_GJ10808, isoform A [Drosophila virilis])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 314/520 (60.38%), Postives = 382/520 (73.46%), Query Frame = 0
Query:    1 MDTKIKV---VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--------------QVTKKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            M T IK    +T+T PQQ+      +IIG L +LN LKF  ++ K+   ++E+ +   I  L+PAPTD  SL L+   +AALP K SRHNT S AHSIT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG               Q ++ +VNVEF++ +        P+S DE + +     GI+ AARIVDTPCNEM+V+ FI+ V   AK+L + P +I+G+EL+ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV +A KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WESK L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLF+ AHLGF++PG W+HVDMA+P   GERATGYGVALL TLFG H +  LL++
Sbjct:   27 MATDIKFNASLTRTDPQQQPV----LIIGQLRHLNLLKFGQLASKLEPRVSEETFKNAIACLHPAPTDKCSLYLDVATVAALPLKASRHNTASRAHSITRLVKNHVLNVNEE---SVVLVCERENIFASACAVVRAFPLYSRKTGNGNGARSPAIDGGDGQSSRSVVNVEFVVIDKDGCVQEEPLSQDELKCLHETARGIRLAARIVDTPCNEMNVDHFIQNVNEFAKELSLQPQVIRGEELQERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCFANKDLKANIILDMATLTGAQGVATGKYHGAILTNSEPWESKALQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFVAAHLGFDYPGVWMHVDMATPVNCGERATGYGVALLLTLFGSHTSCALLQS 539          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|968098318|ref|XP_015026061.1| (uncharacterized protein Dvir_GJ10808, isoform B [Drosophila virilis] >gi|946559797|gb|KRF78794.1| uncharacterized protein Dvir_GJ10808, isoform B [Drosophila virilis])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 314/520 (60.38%), Postives = 382/520 (73.46%), Query Frame = 0
Query:    1 MDTKIKV---VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--------------QVTKKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            M T IK    +T+T PQQ+      +IIG L +LN LKF  ++ K+   ++E+ +   I  L+PAPTD  SL L+   +AALP K SRHNT S AHSIT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG               Q ++ +VNVEF++ +        P+S DE + +     GI+ AARIVDTPCNEM+V+ FI+ V   AK+L + P +I+G+EL+ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV +A KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WESK L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLF+ AHLGF++PG W+HVDMA+P   GERATGYGVALL TLFG H +  LL++
Sbjct:   48 MATDIKFNASLTRTDPQQQPV----LIIGQLRHLNLLKFGQLASKLEPRVSEETFKNAIACLHPAPTDKCSLYLDVATVAALPLKASRHNTASRAHSITRLVKNHVLNVNEES---VVLVCERENIFASACAVVRAFPLYSRKTGNGNGARSPAIDGGDGQSSRSVVNVEFVVIDKDGCVQEEPLSQDELKCLHETARGIRLAARIVDTPCNEMNVDHFIQNVNEFAKELSLQPQVIRGEELQERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFRDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCFANKDLKANIILDMATLTGAQGVATGKYHGAILTNSEPWESKALQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFVAAHLGFDYPGVWMHVDMATPVNCGERATGYGVALLLTLFGSHTSCALLQS 560          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|195446347|ref|XP_002070738.1| (uncharacterized protein Dwil_GK10859 [Drosophila willistoni] >gi|194166823|gb|EDW81724.1| uncharacterized protein Dwil_GK10859 [Drosophila willistoni])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 303/509 (59.53%), Postives = 380/509 (74.66%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTG---------------------TQVTKKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKE 503
            +IIG L +LN LKF  ++ K+   +TE+ +   +  L+PAPTD +SL L+   +AALP K SRHNT S AH+IT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG                      Q  + +VNVEF++ +     + +P++ DE + ++    GI+  ARIVD PCNEM+V+ FI+ ++ +AK+L + P II+G+EL+ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QG+ATG  H A LTN+  WESK+L AGR SGDL  P++YCPE+ FSEF S +ADMKNSVADR NA SSCAGLF+ AHLGF++PG W+HVDMA+P + GERATGYGVALL TLFG+H N+ LL++   +L+E
Sbjct:   48 LIIGQLRHLNLLKFDQLASKLQPRVTEETFRSALACLHPAPTDKVSLYLDVATMAALPLKASRHNTSSRAHAITRLVKNHVLNVSEE---SVVLVCERENLFASACAVVRAFPLYSRKTGGNGQQFQKAASPEAGDSVDNAEQNARNVVNVEFVVIDKDGCIETDPLTDDELKCLKETTRGIRLTARIVDMPCNEMNVDHFIQNIEELAKELSLQPQIIRGEELQERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFKDNLHAIFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGIATGKYHGAVLTNSETWESKSLQAGRKSGDLLAPIIYCPELQFSEFASAIADMKNSVADRQNAQSSCAGLFVAAHLGFDYPGVWIHVDMATPVHCGERATGYGVALLLTLFGNHTNSTLLQSIAPTLEE 553          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|755893796|ref|XP_011295256.1| (PREDICTED: probable aminopeptidase NPEPL1 isoform X2 [Musca domestica])

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 309/505 (61.19%), Postives = 375/505 (74.26%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTK-------------------KLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKE 503
            +IIG L +LN LKFSD++ K+   +TED ++  +  L+P+PTD ISL L+   +AA+P KCSRHNTPS AH+IT++++N N  +     I I+CEK + FAS CAV RA+  YSRKT   V+                     +V++EF++          P+   E   +E A  G+Q AARIVDTPCNEM+V+ F++E + I  +L I PL+I+G+EL ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF +NLHA+FC+AENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV+SDGV YA KDLKA+II+D+ TLTG+QG+ATG  H A LTN+ EWE K+L AGR SGDL  PLVYCPE+HFSEF S VADMKNSVADRSNA SSCAGLF+ A+LGF++PG W+HVDMA+P + GERATGYGVALL  LFG H N  +L++   S  E
Sbjct:   32 LIIGQLKHLNLLKFSDVACKLEPRVTEDTFNKAVSCLHPSPTDKISLYLDVATVAAVPLKCSRHNTPSRAHAITRLVKN-NVLNVSEESIVIVCEKADLFASACAVVRAFSLYSRKTTNNVSSPSYNRAVDQDVPMKNAGDNSVVSIEFVIIEKDGSVSETPLDASELCCLEVAAKGVQLAARIVDTPCNEMNVDHFVQEAEIIGYELNIKPLVIRGEELRERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFKENLHAVFCMAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLSDGVAYAHKDLKANIILDMATLTGAQGIATGKYHGAILTNSEEWEIKSLEAGRKSGDLLAPLVYCPELHFSEFASAVADMKNSVADRSNAQSSCAGLFVGANLGFDYPGIWMHVDMATPVHCGERATGYGVALLLALFGSHTNCKMLQSIACSDSE 535          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|557781298|ref|XP_005190268.1| (PREDICTED: probable aminopeptidase NPEPL1 isoform X1 [Musca domestica])

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 309/505 (61.19%), Postives = 375/505 (74.26%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTK-------------------KLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKE 503
            +IIG L +LN LKFSD++ K+   +TED ++  +  L+P+PTD ISL L+   +AA+P KCSRHNTPS AH+IT++++N N  +     I I+CEK + FAS CAV RA+  YSRKT   V+                     +V++EF++          P+   E   +E A  G+Q AARIVDTPCNEM+V+ F++E + I  +L I PL+I+G+EL ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF +NLHA+FC+AENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV+SDGV YA KDLKA+II+D+ TLTG+QG+ATG  H A LTN+ EWE K+L AGR SGDL  PLVYCPE+HFSEF S VADMKNSVADRSNA SSCAGLF+ A+LGF++PG W+HVDMA+P + GERATGYGVALL  LFG H N  +L++   S  E
Sbjct:   89 LIIGQLKHLNLLKFSDVACKLEPRVTEDTFNKAVSCLHPSPTDKISLYLDVATVAAVPLKCSRHNTPSRAHAITRLVKN-NVLNVSEESIVIVCEKADLFASACAVVRAFSLYSRKTTNNVSSPSYNRAVDQDVPMKNAGDNSVVSIEFVIIEKDGSVSETPLDASELCCLEVAAKGVQLAARIVDTPCNEMNVDHFVQEAEIIGYELNIKPLVIRGEELRERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFKENLHAVFCMAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLSDGVAYAHKDLKANIILDMATLTGAQGIATGKYHGAILTNSEEWEIKSLEAGRKSGDLLAPLVYCPELHFSEFASAVADMKNSVADRSNAQSSCAGLFVGANLGFDYPGIWMHVDMATPVHCGERATGYGVALLLALFGSHTNCKMLQSIACSDSE 592          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|1062653204|ref|XP_017967234.1| (PREDICTED: probable aminopeptidase NPEPL1 isoform X1 [Drosophila navojoa])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 315/520 (60.58%), Postives = 381/520 (73.27%), Query Frame = 0
Query:    1 MDTKIKV---VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--------------QVTKKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            M T I+    +++T PQ +      +IIG L +LN LKFS ++ K+   + E+ +   I  L+PAPTD  SL L+   +AALP K SRHNT S AHSIT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG               Q ++ +VNVEF++ +     ++ P+S D+   +     GI+ AARIVDTPCNEM+V+ FIE V   AK+L I P +I+G+EL ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WESK L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLF+ AHLGF++PG W+HVDMA+P   GERATGYGVALL TLFG H N  LL++
Sbjct:   42 MATDIRFNASLSRTDPQVQPV----LIIGQLRHLNLLKFSQLADKLEPRVNEETFKNAIACLHPAPTDKCSLYLDVATVAALPLKASRHNTGSRAHSITRLVKNHVLNVNEE---SVVLVCERENLFASACAVVRAFPLYSRKTGNGNGGKSPSSEIGDGQPSRSVVNVEFVIIDKDGCVEQEPLSQDDINCLNETARGIRLAARIVDTPCNEMNVDHFIENVNEFAKELSIQPQVIRGEELRERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFKDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGKYHGAILTNSEPWESKALQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFVAAHLGFDYPGVWMHVDMATPVNCGERATGYGVALLLTLFGSHTNCGLLQS 554          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|1080044486|ref|XP_018563401.1| (PREDICTED: probable aminopeptidase NPEPL1 [Anoplophora glabripennis] >gi|1080044488|ref|XP_018563402.1| PREDICTED: probable aminopeptidase NPEPL1 [Anoplophora glabripennis] >gi|1080044490|ref|XP_018563403.1| PREDICTED: probable aminopeptidase NPEPL1 [Anoplophora glabripennis])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 319/522 (61.11%), Postives = 396/522 (75.86%), Query Frame = 0
Query:    8 VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKKL--VNVEFILANDRNPI------SGD----EARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKNSVTSLKEFDAENYQDTIQPKK 517
            +TK+ PQQ    +  +++G + +L +LKF  I  K+   +TE+ +   + +L+P+PTD+ SL LN   +AALP KCSRHNTPS AH+IT+++Q  + G  ES  I I+CE+++ +ASGCAVARA+P YS+KT      ++  V+VEF++    N        SGD    E  +++ A  GI+ AARIVD PCNEM+V+ F+EEV+++ + L ITP II+GKEL E+G GGIYGVGKAA  PPAL VLSHTP+SA   VAWVGKGIVYDTGGLS+KGKTAMPGMKRDCGGAAGILGAFY+AVK  F+ NLHA+FCLAEN+VGP+AT+PDDIH LYSG+TVEINNTDAEGRLV++DGVVYAQ+DLKADII+D+ TLTG+QG+ATG  HAA LTNN EWE   L AG  SGDL FP+ YCPE+HFSEF+S VADMKNSVADRSNA SSCAGLFI AHLGF+FPG W+HVDMA+P ++GERATGYGVALL TLFG      LL++      E D  N     +P+K
Sbjct:   11 LTKSDPQQ----TPVLVLGQVKHLTQLKFQTIKSKLEPRVTEETFKVAVSSLHPSPTDSCSLYLNLATVAALPVKCSRHNTPSRAHAITRLIQVSSTGVDES--IVIVCERNDVYASGCAVARAFPLYSKKTSGSSDGEVTTVSVEFVIVGSNNGRENSLVESGDLSPLEINALDDAATGIRLAARIVDMPCNEMNVDHFLEEVQSVGRALNITPTIIRGKELAEKGFGGIYGVGKAAAVPPALAVLSHTPQSAQTTVAWVGKGIVYDTGGLSLKGKTAMPGMKRDCGGAAGILGAFYAAVKANFSHNLHAVFCLAENAVGPDATKPDDIHTLYSGRTVEINNTDAEGRLVLADGVVYAQRDLKADIILDMATLTGAQGIATGKYHAAVLTNNGEWEDLLLQAGLRSGDLVFPIPYCPELHFSEFSSAVADMKNSVADRSNAQSSCAGLFIAAHLGFDFPGNWIHVDMATPVHSGERATGYGVALLTTLFGSFCKQPLLQSIA---PELDNVNETAAKKPRK 523          
BLAST of EMLSAG00000000004 vs. nr
Match: gi|1062653207|ref|XP_017967235.1| (PREDICTED: probable aminopeptidase NPEPL1 isoform X2 [Drosophila navojoa])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 315/520 (60.58%), Postives = 381/520 (73.27%), Query Frame = 0
Query:    1 MDTKIKV---VTKTAPQQELANSSNIIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQN--LNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGT--------------QVTKKLVNVEFILAN-----DRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            M T I+    +++T PQ +      +IIG L +LN LKFS ++ K+   + E+ +   I  L+PAPTD  SL L+   +AALP K SRHNT S AHSIT++++N  LN   +    + ++CE+ N FAS CAV RA+P YSRKTG               Q ++ +VNVEF++ +     ++ P+S D+   +     GI+ AARIVDTPCNEM+V+ FIE V   AK+L I P +I+G+EL ERG GGIYGVGKAA  PPALVVLSH PK A   +A VGKGIVYDTGGLSIKGKTAMPGMKRDCGGAA ILGAFY+AVK GF  NLHA+FCLAENSVGPNATRPDDIH LYSG+TVEINNTDAEGRLV++DGV YA KDLKA+II+D+ TLTG+QGVATG  H A LTN+  WESK L AGR SGDL  P++YCPE+HFSEF S +ADMKNSVADR NA SSCAGLF+ AHLGF++PG W+HVDMA+P   GERATGYGVALL TLFG H N  LL++
Sbjct:   27 MATDIRFNASLSRTDPQVQPV----LIIGQLRHLNLLKFSQLADKLEPRVNEETFKNAIACLHPAPTDKCSLYLDVATVAALPLKASRHNTGSRAHSITRLVKNHVLNVNEE---SVVLVCERENLFASACAVVRAFPLYSRKTGNGNGGKSPSSEIGDGQPSRSVVNVEFVIIDKDGCVEQEPLSQDDINCLNETARGIRLAARIVDTPCNEMNVDHFIENVNEFAKELSIQPQVIRGEELRERGFGGIYGVGKAAAVPPALVVLSHEPKGAQETIALVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAAILGAFYAAVKCGFKDNLHAVFCLAENSVGPNATRPDDIHTLYSGRTVEINNTDAEGRLVLADGVCYANKDLKANIILDMATLTGAQGVATGKYHGAILTNSEPWESKALQAGRKSGDLLAPIIYCPELHFSEFASAIADMKNSVADRQNAQSSCAGLFVAAHLGFDYPGVWMHVDMATPVNCGERATGYGVALLLTLFGSHTNCGLLQS 539          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold675_size187964-snap-gene-0.33 (protein:Tk03277 transcript:maker-scaffold675_size187964-snap-gene-0.33-mRNA-1 annotation:"probable aminopeptidase npepl1")

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 307/476 (64.50%), Postives = 371/476 (77.94%), Query Frame = 0
Query:   23 IIIGHLNNLNKLKFSDISKKVGSLITEDAWDYGIKTLNPAPTDTISLNLNKVILAALPTKCSRHNTPSHAHSITKILQNLNFGHQESHQIFILCEKHNAFASGCAVARAYPSYSRKTGTQVTKK--LVNVEFILANDRNPISGDEARSIEHAIFGIQTAARIVDTPCNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGERATGYGVALLNTLFGDHMNALLLKN 496
            +++G  N+   L F  +S K GS+I E  W   ++TLNP+PTDT+ L LN   +AALP KCSRHNTPS AHSITK+++    G  E   I I+C+K + FASGCAVARA+P ++RKT  +  K    V VEF    D   +S  E   +EHA +GI  AA+IVDTPCNEMH + F++ ++++A+K G    +IQG+EL ERG GGIYGVGKAA + PAL VLS TPK AT  VAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGA+Y+AVK GF QNLHA+FCLAEN+VG  ATRPDDIH LYSGKTVEINNTDAEGRLVV+DGVVYAQKDL+A++I+D+CTLTG+QG++TG  HAA LTN   WE  T  AG++SGDL+FP+V+CPE+HFSEF+S VADMKNSV DRSNA SSCAGLFI +HLGF++PG WLHVDMA P  +G+RATGYGVALLNTLFG    + LL++
Sbjct:  172 LVVGQANDFQSLAFGTLSHKFGSIIDEKTWKKAVETLNPSPTDTVPLYLNLAAIAALPLKCSRHNTPSRAHSITKLVKAFTSGRNE--HIVIICDKADVFASGCAVARAFPQFTRKTNAKSEKDQGTVTVEF-HCRDGKKVSAKELTVLEHAAYGIHLAAQIVDTPCNEMHTDAFLDLIRDVAQKTGSKCTVIQGEELNERGFGGIYGVGKAAVHQPALAVLSFTPKGATETVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAYYTAVKEGFTQNLHAIFCLAENAVGDRATRPDDIHTLYSGKTVEINNTDAEGRLVVADGVVYAQKDLQANVIIDMCTLTGAQGISTGRHHAAHLTNREAWEGYTSMAGKASGDLSFPIVFCPELHFSEFSSAVADMKNSVGDRSNAQSSCAGLFIFSHLGFDYPGVWLHVDMAYPVSSGDRATGYGVALLNTLFGKFSASKLLQD 644          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold10764_size2135-processed-gene-0.0 (protein:Tk04308 transcript:snap_masked-scaffold10764_size2135-processed-gene-0.0-mRNA-1 annotation:"aminopeptidase a")

HSP 1 Score: 129.413 bits (324), Expect = 3.185e-34
Identity = 92/273 (33.70%), Postives = 135/273 (49.45%), Query Frame = 0
Query:  223 MGGIYGVGKAAENPPALVVLSHTPKSATLNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGER-------ATGYGVALLNTLFGDH 488
            MG +  VG+ + +P  +VV+           A VGKG+V+DTGG+S+K    M  M  D GGA  + G   +    G   N+  L  + EN     ATRP D+     G T+E+ NTDAEGRLV++D + Y Q+  K   I+++ TLTG+  VA G+ +A   +N+ +     + A    G+  + +   P  + +   S +ADMKN V  R  A S  A  F+   +  + P  W H+D+A  A            ATG+GV  LN L  D 
Sbjct:    1 MGSLLSVGQGSASPTKVVVMQWQGGGDEAPFAVVGKGVVFDTGGISLKPGAGMEEMTMDMGGAGVVAGVMKTLALRGAKANVVGLVGIVENMPSGTATRPGDVVTSMKGDTIEVINTDAEGRLVLADVLWYTQERFKPVGIINLATLTGAILVALGHENAGVFSNSDDLSGAFIKAAGLEGEGAWRMPLSP-AYDALIKSQIADMKN-VGGRM-AGSITAAQFLQRFVKDDMP--WCHLDIAGTASVKAETALAPAGATGWGVMALNRLIADR 268          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold2_size2283618-processed-gene-13.29 (protein:Tk00063 transcript:snap_masked-scaffold2_size2283618-processed-gene-13.29-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 133.65 bits (335), Expect = 5.059e-34
Identity = 90/301 (29.90%), Postives = 154/301 (51.16%), Query Frame = 0
Query:  175 GIQTAARIVDTPCNEMHVNTFIEEVKNIAKK-LGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLN-VAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPLVYCPEVHFSEFNSMVADMKNSVADRSN-----ATSSCAGLFINAHLGFNFPGTWLHVDMASPAY 468
            G+     + +T  N  +    + + +N+A+    +T  ++  K++ + GMG + GV + +   P +++  +   +A    +A VGKG+ +D+GG++IK    +  MK D  GAA + GA  +A   G   N+  +   AEN    ++ RP D+    SGKT+EI NTDAEGRL+++D + Y  K  K   ++D+ TLTG+  VA G+  +A + N+     +   AG+++GD        P      ++     +K+ VAD SN     A +  AG+F+     F     W H+D+A  A+
Sbjct:  179 GVDLCRELGNTAPNVCNPKWLVTQARNMARAHAKLTVSVLDEKQMAKLGMGAMMGVARGSAQLPRMIIFEYKGGAAKDKPLALVGKGVTFDSGGINIKPSPGLDEMKYDMCGAATVFGAVEAAAGMGLKCNIVGIVAAAENMPSSDSYRPGDVLTSLSGKTIEIKNTDAEGRLLLADALTYVGK-YKPHTVIDMATLTGACIVALGHEISAVMGNSDALCQELFVAGKTAGD--------PCWQMPLWDCYKPALKSDVADISNLGGKGAGTITAGIFLQE---FASDYRWAHLDIAGVAW 467          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold5950_size4214-processed-gene-0.1 (protein:Tk11947 transcript:snap_masked-scaffold5950_size4214-processed-gene-0.1-mRNA-1 annotation:"cytosol aminopeptidase")

HSP 1 Score: 119.783 bits (299), Expect = 8.582e-30
Identity = 71/213 (33.33%), Postives = 117/213 (54.93%), Query Frame = 0
Query:  187 CNEMHVNTFIEEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPALVVLSHTPKSATLN-VAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTA 398
            CN   + T   ++     KL +T  ++  K++ + GMG + GV + +   P +++  +   +A    +A VGKG+ +D+GG++IK    +  MK D  GAA + GA  +A   G   N+  +   AEN    ++ RP D+    SGKT+EI NTDAEGRL+++D + Y  K  K   ++D+ TLTG+  VA G+  +A + N+ E   +  +A
Sbjct:  194 CNPKWLVTKARKMATAHAKLSVT--VLDEKQMAKLGMGALMGVARGSAQLPRMIIFEYKGGAAKDKPLALVGKGVTFDSGGINIKPSAGLDEMKYDMCGAATVFGAVEAAASMGLKCNIVGVVAAAENMPSADSYRPGDVLTSLSGKTIEIKNTDAEGRLLLADALTYVGK-YKPHTVIDMATLTGACIVALGHEISAVMGNDDELCQQLFSA 403          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold10258_size2233-processed-gene-0.0 (protein:Tk08151 transcript:snap_masked-scaffold10258_size2233-processed-gene-0.0-mRNA-1 annotation:"aminopeptidase a")

HSP 1 Score: 100.908 bits (250), Expect = 1.525e-24
Identity = 76/226 (33.63%), Postives = 110/226 (48.67%), Query Frame = 0
Query:  275 MPGMKRDCGGAAGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADIIVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGD--LTFPLVYCPEVHFSEFNSMVADMKNSVADRSNATSSCAGLFINAHLGFNFPGTWLHVDMASPAYTGER-------ATGYGVALLNTLFGDHMNA 491
            M  M  D GG+A + G   +    G   N+  L  + EN    NA+RP D+ V   G T+E  NTDAEGRLV+ D + YAQ+  K   ++D+ TLTG+   + G+ +A   +NN  + +  L A  + G+     PL    + +     S +ADMKN       A S  A  F+   +  + P  W+H+D+A  A            ATG+GVA LN L  D+  A
Sbjct:    1 MGDMTMDMGGSAVVAGVMRTLALRGAKANVVGLVGIVENMPSGNASRPGDVVVSMKGDTIENLNTDAEGRLVLCDVMWYAQEQFKPAAMIDLATLTGAIITSLGHENAGVFSNNTSFCNDFLKAAEAEGEGAWRMPL---GQAYDDLLKSRIADMKN--IGGPAAGSITAAQFLQRFVKEDCP--WIHLDIAGVASVKTETALAPVGATGWGVAALNRLISDNYEA 219          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold60_size442463-snap-gene-3.26 (protein:Tk12082 transcript:maker-scaffold60_size442463-snap-gene-3.26-mRNA-1 annotation:"aminopeptidase -like")

HSP 1 Score: 75.0998 bits (183), Expect = 1.348e-14
Identity = 66/224 (29.46%), Postives = 103/224 (45.98%), Query Frame = 0
Query:  197 EEVKNIAKKLGITPLIIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPKSAT-LNVAWVGKGIVYDTGGLSIKGKTAMPGMKRD-CGGA--AGILGAFYSAVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDLKADI---IVDVCTLTGSQGVATGNVHAAFLTNNYEWESKTLTAGRSSGDLTFPL 409
            E ++ +    G+   ++QG+   E+    +  V + A   P     ++ L++ P+      +  VGKGI YDTGGL IK    M GM RD CG A  AG+L A  S +K   N  + A   +  NS G N    D+I    +G  + + NTDAEGR+ + D + + ++    ++   ++ V TLTG   +A             + E    T  R S +   PL
Sbjct:  197 EYIRQVFDNSGVKIEVVQGQLTFEKEYPCLAAVNRCASTIPRHDGRVIWLTYEPEGPVEKTLMLVGKGITYDTGGLDIKAGGIMAGMSRDKCGAADVAGVLKAV-SLIKPK-NLKVVAALAMVRNSCGANGYVSDEIITSRAGVRIRVGNTDAEGRMAMVDVLCHMKEKALKEVNPHLMTVATLTGHAFLAYAPFGTVMDNGPAKKEGFAQTIQRVSDEFGDPL 418          
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold844_size89433-snap-gene-0.15 (protein:Tk06504 transcript:maker-scaffold844_size89433-snap-gene-0.15-mRNA-1 annotation:"aminopeptidase -like")

HSP 1 Score: 72.0182 bits (175), Expect = 1.712e-13
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 0
Query:  212 IIQGKELEERGMGGIYGVGKAAENPPA----LVVLSHTPKSAT-LNVAWVGKGIVYDTGGLSIKGKTAMPGMKRDCGGAAGILGAFYS-AVKNGFNQNLHALFCLAENSVGPNATRPDDIHVLYSGKTVEINNTDAEGRLVVSDGVVYAQKDL---KADIIVDVCTLTG 371
            +IQG+   E+    +  V + A   P     ++ L++ P+      +  VGKG+ YDTGGL IK    M GM RD  GAA + G   + ++    N  + A   +  NS G +    D+I    SG  + + NTDAEGR+ ++D + + ++     K   ++ + TLTG
Sbjct:  270 VIQGQATFEKEYPCLAAVNRCASTIPRHDGRVIWLTYEPEGPVERTLMLVGKGVTYDTGGLDIKSGGIMAGMSRDKCGAADVAGVMKAVSMLKPKNVKVVAAMTMVRNSCGSDGYVSDEIITARSGARLRVGNTDAEGRMAMADVLCHMKEKALSEKDPHLMTIATLTG 438          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000004 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+058.59symbol:grsm "granny smith" species:7227 "Drosophil... [more]
-0.000e+056.92symbol:npepl1 "aminopeptidase-like 1" species:7955... [more]
-0.000e+060.17symbol:NPEPL1 "Uncharacterized protein" species:90... [more]
-0.000e+059.88symbol:NPEPL1 "Probable aminopeptidase NPEPL1" spe... [more]
-0.000e+060.55symbol:NPEPL1 "Uncharacterized protein" species:99... [more]
-0.000e+059.04symbol:Npepl1 "aminopeptidase-like 1" species:1009... [more]
-0.000e+060.26symbol:NPEPL1 "Uncharacterized protein" species:98... [more]
-0.000e+057.40symbol:NPEPL1 "Uncharacterized protein" species:96... [more]
-0.000e+062.91symbol:Npepl1 "aminopeptidase-like 1" species:1011... [more]
-6.427e-14259.71symbol:NPEPL1 "Uncharacterized protein" species:96... [more]

Pages

back to top
BLAST of EMLSAG00000000004 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 22
Match NameE-valueIdentityDescription
gi|592778012|gb|GAXK01176556.1|0.000e+056.23TSA: Calanus finmarchicus comp3577_c0_seq1 transcr... [more]
gi|592762277|gb|GAXK01192136.1|6.817e-3430.07TSA: Calanus finmarchicus comp40429_c0_seq1 transc... [more]
gi|592775750|gb|GAXK01178818.1|5.465e-1630.49TSA: Calanus finmarchicus comp14149_c1_seq2 transc... [more]
gi|592775751|gb|GAXK01178817.1|5.939e-1630.49TSA: Calanus finmarchicus comp14149_c1_seq1 transc... [more]
gi|592775752|gb|GAXK01178816.1|3.024e-1530.08TSA: Calanus finmarchicus comp14149_c0_seq2 transc... [more]
gi|592775753|gb|GAXK01178815.1|3.244e-1530.08TSA: Calanus finmarchicus comp14149_c0_seq1 transc... [more]
gi|592775313|gb|GAXK01179255.1|1.229e-1329.82TSA: Calanus finmarchicus comp14545_c0_seq3 transc... [more]
gi|592775314|gb|GAXK01179254.1|1.278e-1329.82TSA: Calanus finmarchicus comp14545_c0_seq2 transc... [more]
gi|592775315|gb|GAXK01179253.1|1.287e-1329.82TSA: Calanus finmarchicus comp14545_c0_seq1 transc... [more]
gi|592903040|gb|GAXK01055335.1|5.473e-227.94TSA: Calanus finmarchicus comp85622_c2_seq8 transc... [more]

Pages

back to top
BLAST of EMLSAG00000000004 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 4
Match NameE-valueIdentityDescription
EMLSAP000000000040.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:1325... [more]
EMLSAP000000027331.766e-5769.92pep:novel supercontig:LSalAtl2s:LSalAtl2s157:29595... [more]
EMLSAP000000061134.935e-2834.74pep:novel supercontig:LSalAtl2s:LSalAtl2s332:45212... [more]
EMLSAP000000010935.566e-1626.24pep:novel supercontig:LSalAtl2s:LSalAtl2s117:78928... [more]
back to top
BLAST of EMLSAG00000000004 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|68565875|sp|Q5R7G6.2|PEPL1_PONAB0.000e+058.82RecName: Full=Probable aminopeptidase NPEPL1; AltN... [more]
gi|68847034|sp|Q8NDH3.3|PEPL1_HUMAN0.000e+059.88RecName: Full=Probable aminopeptidase NPEPL1; AltN... [more]
gi|68565890|sp|Q6NSR8.1|PEPL1_MOUSE0.000e+059.04RecName: Full=Probable aminopeptidase NPEPL1; AltN... [more]
gi|466102|sp|P34629.1|AMPL_CAEEL2.317e-12041.37RecName: Full=Leucine aminopeptidase 1[more]
gi|56404562|sp|Q7M8W6.1|AMPA_WOLSU8.470e-5033.24RecName: Full=Probable cytosol aminopeptidase; Alt... [more]
gi|56404525|sp|Q6NG90.1|AMPA_CORDI1.667e-4937.29RecName: Full=Probable cytosol aminopeptidase; Alt... [more]
gi|166215792|sp|A6X259.1|AMPA_OCHA42.415e-4935.38RecName: Full=Probable cytosol aminopeptidase; Alt... [more]
gi|166198340|sp|A5VPM3.1|AMPA_BRUO26.444e-4936.62RecName: Full=Probable cytosol aminopeptidase; Alt... [more]
gi|254802497|sp|B1V932.1|AMPA_PHYAS6.961e-4932.42RecName: Full=Probable cytosol aminopeptidase; Alt... [more]
gi|29336740|sp|Q8G1M4.1|AMPA_BRUSU7.664e-4936.62RecName: Full=Probable cytosol aminopeptidase; Alt... [more]

Pages

back to top
BLAST of EMLSAG00000000004 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EFA07320.1|0.000e+063.10putative aminopeptidase NPEPL1-like Protein [Tribo... [more]
AAF54874.40.000e+058.40granny smith, isoform F [Drosophila melanogaster][more]
AAF54873.10.000e+059.09granny smith, isoform B [Drosophila melanogaster][more]
EFX74288.10.000e+057.82hypothetical protein DAPPUDRAFT_307351 [Daphnia pu... [more]
EAA12333.40.000e+061.33AGAP007809-PA [Anopheles gambiae str. PEST][more]
gb|EEC19779.1|0.000e+054.97leucine aminopeptidase, putative [Ixodes scapulari... [more]
gb|KFM63195.1|4.128e-15064.84hypothetical protein X975_23745, partial [Stegodyp... [more]
XP_016772258.12.564e-3934.63PREDICTED: cytosol aminopeptidase-like [Apis melli... [more]
EEB18340.13.840e-3534.03Cytosol aminopeptidase, putative [Pediculus humanu... [more]
EFX68021.11.342e-3230.87hypothetical protein DAPPUDRAFT_260731 [Daphnia pu... [more]

Pages

back to top
BLAST of EMLSAG00000000004 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|91094127|ref|XP_968492.1|0.000e+063.10PREDICTED: probable aminopeptidase NPEPL1 [Triboli... [more]
gi|1059380516|ref|XP_017780863.1|0.000e+061.71PREDICTED: probable aminopeptidase NPEPL1 [Nicroph... [more]
gi|195395172|ref|XP_002056210.1|0.000e+060.38uncharacterized protein Dvir_GJ10808, isoform A [D... [more]
gi|968098318|ref|XP_015026061.1|0.000e+060.38uncharacterized protein Dvir_GJ10808, isoform B [D... [more]
gi|195446347|ref|XP_002070738.1|0.000e+059.53uncharacterized protein Dwil_GK10859 [Drosophila w... [more]
gi|755893796|ref|XP_011295256.1|0.000e+061.19PREDICTED: probable aminopeptidase NPEPL1 isoform ... [more]
gi|557781298|ref|XP_005190268.1|0.000e+061.19PREDICTED: probable aminopeptidase NPEPL1 isoform ... [more]
gi|1062653204|ref|XP_017967234.1|0.000e+060.58PREDICTED: probable aminopeptidase NPEPL1 isoform ... [more]
gi|1080044486|ref|XP_018563401.1|0.000e+061.11PREDICTED: probable aminopeptidase NPEPL1 [Anoplop... [more]
gi|1062653207|ref|XP_017967235.1|0.000e+060.58PREDICTED: probable aminopeptidase NPEPL1 isoform ... [more]

Pages

back to top
BLAST of EMLSAG00000000004 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 7
Match NameE-valueIdentityDescription
maker-scaffold675_size187964-snap-gene-0.330.000e+064.50protein:Tk03277 transcript:maker-scaffold675_size1... [more]
snap_masked-scaffold10764_size2135-processed-gene-0.03.185e-3433.70protein:Tk04308 transcript:snap_masked-scaffold107... [more]
snap_masked-scaffold2_size2283618-processed-gene-13.295.059e-3429.90protein:Tk00063 transcript:snap_masked-scaffold2_s... [more]
snap_masked-scaffold5950_size4214-processed-gene-0.18.582e-3033.33protein:Tk11947 transcript:snap_masked-scaffold595... [more]
snap_masked-scaffold10258_size2233-processed-gene-0.01.525e-2433.63protein:Tk08151 transcript:snap_masked-scaffold102... [more]
maker-scaffold60_size442463-snap-gene-3.261.348e-1429.46protein:Tk12082 transcript:maker-scaffold60_size44... [more]
maker-scaffold844_size89433-snap-gene-0.151.712e-1330.77protein:Tk06504 transcript:maker-scaffold844_size8... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:13254..18935 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteProbable aminopeptidase NPEPL1
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s1003-processed-gene-0.9
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000004 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000004EMLSAT00000000004-695851Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:13254..18935+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000004-682770 ID=EMLSAG00000000004-682770|Name=EMLSAG00000000004|organism=Lepeophtheirus salmonis|type=gene|length=5682bp|location=Sequence derived from alignment at LSalAtl2s1003:13254..18935+ (Lepeophtheirus salmonis)
GAAAAGGTTGTATATGTTAATTTTTTCCTGGAATAACAAGGAAAACCTCT AAAAGTAGATATAGTAATTTTATTGTAGCGCCCTCTATGCTTGTAACCTC CCAACAAGTATGGATTGCTTGAGGGCGCTCAATTGTGTGTACCTGTGGCA GTCTGGCATATAATGACGGAGGKTCTGTGACGTTGAGAGTGTATTCAAGT GCTAAAAATAGGGGATGCATTTTTTCCCCCCCTTCCTTTCTCAATCCTAA CAATGAGCCGTGATCCACATGATCGAACACGTCAAGCACCAAGAGACGAG GAGGAAGAGGATCTTGTAGATCGTATGCTGAATAAGACAGGGTGTATGAA TCTTCATTATCAAGTTCAATTTTGTATGGCGGAAAAAAAGGATTGGAGGC TTTGTCAGAAGGAAGTCCAAGATTTTAAGTCCTGTATGAATCGTGATAAA AATGGTGGAAGTTCATCCTAATTTCCTCTCCGACTGGGTCTCTACGAGTT ACTTGATTGATGAAGAAGAAGATGAAAAAGATGATCAGTATATTCCAAAG TACATTCAAAAATAATATCATATGGAATTTAATTTTTCTTATTATATTAA ATAAATTAGTTAATAGTCGTCATTTAAAGTAGAGGATAATTATGTTTGAT TAATAAATACCACTTTTCTTCAAACAAACGGAGGTCCGTCCGTTATTTAT TGGCTCATTTTGTATAAAAAGATTAATAGATTATATTTAGTATATATTAA TTAATTAATCCATCATTTATGATAGTGAAGGCAAAAAAATCATAAGTATC GCCCTTATCAGCTTGGAAATTTATCTTAAATTAATATTGATTCCTTTTCA AATATGAACTGCTTGGGTTATTCCACATTTTTTGTTTCTATAGAAGAATT GATGAAATATTATTTGTTCAAATAAACCTTTTTAGAAATGAAATAATAGC CTATCCATGACTCCTTATTAATATTATGTCAATTATATTCCAATCTATTT TTTATAGGTGGTGGAAAAACCAACTTATGATCATGTTTGTGGGTATTCTC TGCGGAGTCTTTGTAAATGCATTCCTTCGAAGATCTGCCTCCTCATCCCT TTCTCAAAACTCGCGTCACTTTTTGAGTAACTTATTTAAAAGTACAAAAA TGGTGTTTTTAGTCCGTACGGACATAGGCATGGGAAAGGGGAAAATTGCT TCTCAAGTTGCACATGCTGCCATACTCTGCTATCAAGATGCTCAAAGGAA AAAATCCGACCATTTGAACAACTGGGAATACACGGGTCAAATGAAGGTTG TTTTAAAGTGTTCTGATGAAGCAGAGTTTGATAGATTATATACGGAAGCC AAAAATTTGGGCCTCATTACTAGTGTCGTAAAAGATGCTGGTAGAACGCA AATTCCTCATGGAACTAAAACTGTCGTTGGAATTGGACCTGGCCCATTGG AAGTGATAGATAAGATAACTGGGCATTTAAAATTATATTGAATCGTCAAA TATTGTTACGTGGAGTTACGCAATTATTTGATTTGTTCTCATCATTGCCT GAATATGCTTTGAATAAAAAAACATTTTCTTGAACTTTGGCCTTTGCTAT ATTTTCTTGTTTTTCCTATTCTCAAGAATTCAATTGAGGATTGTACAGTA CTCATATGAAAAATCTTCAATTTTTTTGTCTTCTCTTATTTACAAAAATA ATTATCCGTGTTCCACTTATTTTAAAGATAATGATAAGAAACAAATATAA CACGCCTTCATCTAAACATTTACAAAAAATATTAAGTAATTCATTTTACT CTATTGAAGGTCTGATATGGATACAAAAATCAAAGTTGTAACAAAAACAG CTCCCCAACAGGAGCTGGCAAACTCCTCGAATATCATCATAGGGCATCTA AATAATTTAAATAAACTTAAGTTTTCTGATATTTCAAAAAAGGTTGGAAG TCTTATTACAGAAGATGCTTGGGACTATGGTATCAAGACTCTCAATCCCG CTCCAACTGATACTATAAGTCTTAATTTAAATAAAGTGATTCTCGCTGCT CTACCTACCAAGTGTTCTCGTCACAATACTCCTTCTCATGCGCACTCAAT TACTAAAATTTTACAGAATTTGAATTTTGGTCATCAAGAGAGTCATCAAA TTTTTGTGAGTTTTTTTTTTTTTTACAAATATCAGTGATAAATTTTCTTT GATAAGAGATATATTACATTTTTAGATTTTGTGTGAAAAGCACAATGCAT TTGCTTCTGGATGTGCCGTGGCCAGAGCGTACCCCTCATATTCTCGAAAA ACTGGGACTCAAGTTACTAAGAAATTGGTGAATGTTGAATTTATTCTTGC TAATGATAGAAACCCCATTTCTGGAGATGAGGCCCGATCAATTGAGCATG CCATTTTTGGAATTCAAACTGCTGCAAGAATTGTTGATACTCCGTGCAAT GAGATGCATGTCAATACATTTATTGAAGTGATTATTTTATTCAGATTTTT AATAGATAGTAATTAACACATATTTATTATATTTTTTAAGGAAGTAAAAA ATATTGCTAAGAAACTTGGAATCACACCCTTGATTATTCAAGGCAAAGAA CTTGAAGAAAGAGGAATGGGAGGTATTTATGGTGTTGGAAAAGCTGCTGA GAATCCTCCTGCTCTTGTGGTCTTGAGCCATACGCCTAAATCTGCAACTT TAAATGTAGCTTGGGTTGGAAAAGGGATTGTGTATGATACTGGTGGTCTT TCCATCAAGGTTATTACTTAAATAATTGTTGCTGCTAGCGTTCTAGATTA CAAACTTTTTTCGTATAGGGTAAAACGGCCATGCCAGGAATGAAGAGAGA TTGCGGAGGAGCTGCAGGAATTCTTGGAGCATTTTATTCTGCAGTAAAAA ATGGATTTAATCAGAACCTTCATGCTCTTTTTTGTTTGGCTGAAAATTCA GTCGGACCTAACGCAACGAGACCGGACGATATTCATGTATTGTACTCTGG TAAAACGGTAGAGATAAACAATACAGATGCCGAGGGAAGACTTGTAGTAT CTGATGGCGTGGTTTACGCTCAGAAGGACTTAAAAGCTGATATTATTGTG GATGTGTGTACACTGACTGGGTCACAAGGAGTTGCTACCGGCAATGTACA TGCTGCTTTTTTAACCAATAATTATGAATGGGAATCAAAAACTTTAACTG CGGGACGTAGTTCTGGAGACTTGACTTTTCCACTCGTCTATTGTCCTGAA GTTCATTTTTCAGAATTTAATTCTATGGTTGCTGATATGAAGAATTCTGT TGCCGTGAGTTGAAGCTTTTTTCATTTACTCGCATGATTAACTTATTTTT TACATCTCTTAGGATCGAAGTAATGCTACGTCCTCTTGTGCAGGACTTTT TATAAATGCCCACTTGGGATTCAACTTTCCTGGTACATGGCTTCATGTGG ACATGGCATCTCCCGCATACACGGGTGAAAGAGCAACAGGTTATGGAGTT GCTCTATTAAATACATTGTTTGGAGACCATATGAATGCACTTTTGTTGAA AAACTCTGTGACTTCGTTAAAGGAATTCGATGCAGAAAATTATCAAGATA CTATTCAACCCAAGAAAATAAAACTAAGCGTTTAGATTTTAAAACATATA AATGTAGTTTTGAATATATTCAATTTTTCCTCTTTTTTTTGTATGGTGTA AGGAATAATTTTTGCTACTATGGTAATACCCATTAATTATTAGTTAGTTT TGCTTCACTGTTTCCAACAAGTAGTTACATTTAATTCTAAATTCTAATGC TTATTGTGTGTTCAATACATATCTTAATGAATTTAGGGTAACCACATAGG CTTGCTTTTTTTATTTAAAATTTGATTGACGAATATATTTTTTTTATTAA TAAATAAATGAAAGTAAACTATTCAAGTCTCAATTATCCATTTATATCTT ATCAATATACAATGACTACTAATATCTATTTGGTAACTGCATGCATGGCC TGAGCTAAGTGTCCGACATTGGAAGAAGAAATACCAGCAACAGAAATACG GCCATCTTTGGTCAAATATACACTGTGGTCACTTATAATTTTTGCTACTT GTTCAGGCTTCATTCCCGTAAAACAAAACATACCAATTTGTTCTGTAATA TGATTCCAGTTGTGGGATGAACCCTCTTTCTCTAAGCCCTCTTTGAGTTG ATGTCTCATTTTGATGATTCTGTCAGCCATTCCTTTGACATCACTTAACC TAAAATTAATATCCACAGAATTAAAATTTATTCGAATAACTATGAACTCT TTTTAGTAATCACCACTCTTGTCTTAGAGTAGGATCAGAAAGAATTTCAG ACACTACTCTTGCTCCGTGGATGGGAGGATTAGAATACATGGGTCTAATT AGGATCTTGATTTGGGATGCTACTCGTGCTGCTTCTTCTTTGTCATTACA AACCACACTAAAGGCTCCTATACGTTCACCGTATAGGCCCATATTTTTGG CATAAGATTGTGATAGACAAATATTATGTCCATCATTCAAAAATTGCCTG ACAGCAAATGCGTCACCATCAACGTTTCCTGATGCAAAGCCTTGATAAGC CATATCAAAGAAAACATACAAATTCCTTTCTTTAATCAAAGTCGAGAGTT CTTTCCATTGGGTGGGTTTAGGATCTACACCGGTTGGATTGTGGGCACAT GCATGAAGAAGGATCACACTTTTTTCCGGGATTCTCTAATAATAAGAATA TTAATAGTCCGAAAGTAAGACAATACAAAAGCAATTCATTTCAATTACCT TAATATCCTCACATGTACCCTCGAAATCAAAACCACATGTATTTGGATCA TAGTATCTGTAACTGGCTACTTCCATCCCGCAATGTTTAAAAATAGGTGT ATGATTTCCCCAAGATGGCTTTGGCAAGTACACTGTTTTTTTTCCGGGAA ACCATTTAGAGAGGTATGCAGCTCCAATTCTGAGAGCACCTGTACCAGAA ATTGCCTGCGTTGTAATGTGACGTCCCTCAGCGACAAATTCAGAACCAAA TGCAAGCTCAGCGGAAAGCTTGTTAAATGTAGCATCACCAACAATTGTGC TGTATTCATGGTTCATATTGGCATTAAATATTTTTTCTTCGGCCTTGCGA ACGGATGGAAGAATAAAGGGCTTTCCTTCATCATCTCGATAAGCTCCCAC GCCCAAATTCATTTTTTTGGGATTTGAATCCTTTTTAAACAATTCAGTGA CTCCTAAAATTGCATCTGGTGGGCCCATTTCAACCCCTGTCCACCAAGAT CTAGGATGAATAAAGAAAATTATTGACTTGGAATTGGGAGTGAAAACGAT TTCTTCCTTTCTTCAATTTTTAAATGACTTTTGTTAAAAATGATTTGAAT CCCTAATAGTGACATAATTGTATTTGTTCATAAGTGGACTAAATATTAGT AGACACTTATTAAGTCTACTCTATTTATGTCATATTTTATTAAAAGCGTA GCTGTACATTGGTTGTTTCAGACCACAAATAGTTACATAATTTTTTTATA AAAGCATGTGTAAATTGAATATGGAAATCTACTAAATTCAGATCTATTTC TCTTTTGATAAATTGCTGTTAAATGTCAAACGAATTACTGTTTGCCCAAA AATGAAACCAACAAACGAGAAGTAGAATTCAG
back to top
Add to Basket