EMLSAG00000000005, EMLSAG00000000005-682771 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000005
Unique NameEMLSAG00000000005-682771
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:GOT2 "Aspartate aminotransferase, mitochondrial" species:9601 "Pongo abelii" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS] [GO:0005739 "mitochondrion" evidence=ISS] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006536 "glutamate metabolic process" evidence=ISS] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0005739 GO:GO:0005886 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0045471 GO:GO:0005759 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 KO:K14455 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 HOVERGEN:HBG000951 OrthoDB:EOG74J980 GO:GO:0006533 CTD:2806 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:CR857622 EMBL:CR860094 RefSeq:NP_001124888.1 UniGene:Pab.145 ProteinModelPortal:Q5REB0 SMR:Q5REB0 PRIDE:Q5REB0 Ensembl:ENSPPYT00000008718 Ensembl:ENSPPYT00000008719 GeneID:100171753 KEGG:pon:100171753 InParanoid:Q5REB0 Uniprot:Q5REB0)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 272/399 (68.17%), Postives = 330/399 (82.71%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++I + S+Y+TKDGRISVAG++SSNVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:Got2 "Aspartate aminotransferase, mitochondrial" species:10116 "Rattus norvegicus" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS] [GO:0005739 "mitochondrion" evidence=ISS] [GO:0005759 "mitochondrial matrix" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006536 "glutamate metabolic process" evidence=ISS] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 RGD:2722 GO:GO:0005886 GO:GO:0043234 GO:GO:0042803 GO:GO:0009986 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0005759 GO:GO:0043204 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 HOVERGEN:HBG000951 OrthoDB:EOG74J980 CTD:2806 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:M18467 EMBL:BC061792 EMBL:U21158 EMBL:M12709 PIR:A28005 PIR:I55427 RefSeq:NP_037309.1 UniGene:Rn.98650 ProteinModelPortal:P00507 SMR:P00507 IntAct:P00507 ChEMBL:CHEMBL2351 PhosphoSite:P00507 PaxDb:P00507 PRIDE:P00507 Ensembl:ENSRNOT00000015956 GeneID:25721 KEGG:rno:25721 UCSC:RGD:2722 InParanoid:P00507 BioCyc:MetaCyc:MONOMER-15069 BRENDA:2.6.1.1 SABIO-RK:P00507 NextBio:607817 PRO:PR:P00507 Genevestigator:P00507 GO:GO:0016597 GO:GO:0019899 GO:GO:0005543 Uniprot:P00507)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 327/399 (81.95%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALR+GA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++ ++K++NL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HIT+QIGMFCFTG+KPEQV ++  + SVY+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGKNLDKEYLPIGGLADFCKASAELALGENSEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEMAAVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial" species:10116 "Rattus norvegicus" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISO;ISS;IMP;IDA] [GO:0005543 "phospholipid binding" evidence=IDA] [GO:0005739 "mitochondrion" evidence=ISO;ISS;IDA] [GO:0005743 "mitochondrial inner membrane" evidence=ISO;IDA] [GO:0005759 "mitochondrial matrix" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA;ISO] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006107 "oxaloacetate metabolic process" evidence=ISO] [GO:0006520 "cellular amino acid metabolic process" evidence=IDA;TAS] [GO:0006531 "aspartate metabolic process" evidence=ISS;IMP] [GO:0006532 "aspartate biosynthetic process" evidence=ISO] [GO:0006533 "aspartate catabolic process" evidence=ISO] [GO:0006536 "glutamate metabolic process" evidence=ISS] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0009986 "cell surface" evidence=IDA] [GO:0015908 "fatty acid transport" evidence=ISO;TAS] [GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA] [GO:0016597 "amino acid binding" evidence=IDA] [GO:0019550 "glutamate catabolic process to aspartate" evidence=ISO] [GO:0019551 "glutamate catabolic process to 2-oxoglutarate" evidence=ISO] [GO:0019899 "enzyme binding" evidence=IDA] [GO:0030170 "pyridoxal phosphate binding" evidence=IMP;IDA] [GO:0031406 "carboxylic acid binding" evidence=IDA] [GO:0042803 "protein homodimerization activity" evidence=IMP] [GO:0043204 "perikaryon" evidence=IDA] [GO:0043234 "protein complex" evidence=IDA] [GO:0043648 "dicarboxylic acid metabolic process" evidence=IDA] [GO:0044822 "poly(A) RNA binding" evidence=ISO] [GO:0045471 "response to ethanol" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 RGD:2722 GO:GO:0005886 GO:GO:0043234 GO:GO:0042803 GO:GO:0009986 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0005759 GO:GO:0043204 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 HOVERGEN:HBG000951 OrthoDB:EOG74J980 CTD:2806 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:M18467 EMBL:BC061792 EMBL:U21158 EMBL:M12709 PIR:A28005 PIR:I55427 RefSeq:NP_037309.1 UniGene:Rn.98650 ProteinModelPortal:P00507 SMR:P00507 IntAct:P00507 ChEMBL:CHEMBL2351 PhosphoSite:P00507 PaxDb:P00507 PRIDE:P00507 Ensembl:ENSRNOT00000015956 GeneID:25721 KEGG:rno:25721 UCSC:RGD:2722 InParanoid:P00507 BioCyc:MetaCyc:MONOMER-15069 BRENDA:2.6.1.1 SABIO-RK:P00507 NextBio:607817 PRO:PR:P00507 Genevestigator:P00507 GO:GO:0016597 GO:GO:0019899 GO:GO:0005543 Uniprot:P00507)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 327/399 (81.95%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALR+GA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++ ++K++NL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HIT+QIGMFCFTG+KPEQV ++  + SVY+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGKNLDKEYLPIGGLADFCKASAELALGENSEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEMAAVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:got-2.2 "Aspartate aminotransferase" species:6239 "Caenorhabditis elegans" [GO:0003824 "catalytic activity" evidence=IEA] [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=IEA] [GO:0006520 "cellular amino acid metabolic process" evidence=IEA] [GO:0008483 "transaminase activity" evidence=IEA] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA] [GO:0030170 "pyridoxal phosphate binding" evidence=IEA] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 GO:GO:0006520 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 OMA:RVGAFTM EMBL:FO080544 PIR:T15494 RefSeq:NP_741810.1 UniGene:Cel.5778 ProteinModelPortal:Q17994 SMR:Q17994 DIP:DIP-24489N MINT:MINT-1103336 STRING:6239.C14F11.1a PaxDb:Q17994 PRIDE:Q17994 EnsemblMetazoa:C14F11.1a.1 EnsemblMetazoa:C14F11.1a.2 GeneID:180897 KEGG:cel:CELE_C14F11.1 UCSC:C14F11.1b.1 CTD:180897 WormBase:C14F11.1a InParanoid:Q17994 NextBio:911462 PRO:PR:Q17994 ArrayExpress:Q17994 Uniprot:Q17994)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 276/406 (67.98%), Postives = 330/406 (81.28%), Query Frame = 0
Query:   22 SSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            ++VR  SWW+ VEMGPPDAILGVTE FK DSNPKK+NLGVGAYRDD+GKPF+LPSV++AE ++  AN++ EY+ IVG   F KLSA+LA G  S+ +   R  TTQ+ISGTGALRIG+ +LSK +   K +Y P P+WGNH PIFK  G++V  YRYYD +TCGFD  G   DI +IPE S ILLHACAHNPTGVDP   QWK++S ++K+RNL+VFFDMAYQGFASG+VD DAFAVR F+  GHNI LSQS+AKNMGLYGER+GAFSVV +D +EAARVASQ+KILIRP+YSNPP+HGAR+ S IL+DP L ++WL DVK MADRII MR  LK+ L KEGS+ NW HIT QIGMFCFTG+ P+QV K+I +HSVYLTKDGRISVAGISS+NV +LA A+H VTK
Sbjct:   10 TAVRGKSWWSHVEMGPPDAILGVTEAFKADSNPKKINLGVGAYRDDQGKPFVLPSVKEAERQVIAANLDKEYAGIVGLPEFTKLSAQLALGENSDVIKNKRIFTTQSISGTGALRIGSEFLSK-YAKTKVIYQPTPTWGNHVPIFKFAGVDVKQYRYYDKSTCGFDETGALADIAQIPEGSTILLHACAHNPTGVDPSRDQWKKISDIVKKRNLFVFFDMAYQGFASGDVDNDAFAVRYFVEQGHNIVLSQSFAKNMGLYGERVGAFSVVTSDADEAARVASQVKILIRPLYSNPPVHGARIASRILADPALNKQWLGDVKLMADRIITMRTTLKDLLAKEGSTRNWEHITNQIGMFCFTGINPQQVEKLIKEHSVYLTKDGRISVAGISSNNVAYLAHALHQVTK 414          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" species:10090 "Mus musculus" [GO:0003824 "catalytic activity" evidence=IEA] [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISO;IDA] [GO:0005543 "phospholipid binding" evidence=ISO] [GO:0005739 "mitochondrion" evidence=ISO;IDA] [GO:0005743 "mitochondrial inner membrane" evidence=ISO;IDA] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0006107 "oxaloacetate metabolic process" evidence=IDA] [GO:0006520 "cellular amino acid metabolic process" evidence=ISO] [GO:0006531 "aspartate metabolic process" evidence=ISO] [GO:0006532 "aspartate biosynthetic process" evidence=IDA] [GO:0006533 "aspartate catabolic process" evidence=ISO] [GO:0006810 "transport" evidence=IEA] [GO:0006869 "lipid transport" evidence=IEA] [GO:0008483 "transaminase activity" evidence=IEA] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0009986 "cell surface" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA] [GO:0016597 "amino acid binding" evidence=ISO] [GO:0016740 "transferase activity" evidence=IEA] [GO:0019550 "glutamate catabolic process to aspartate" evidence=IDA] [GO:0019551 "glutamate catabolic process to 2-oxoglutarate" evidence=IDA] [GO:0019899 "enzyme binding" evidence=ISO] [GO:0030170 "pyridoxal phosphate binding" evidence=ISO] [GO:0031406 "carboxylic acid binding" evidence=ISO] [GO:0042803 "protein homodimerization activity" evidence=ISO] [GO:0043204 "perikaryon" evidence=ISO] [GO:0043234 "protein complex" evidence=ISO] [GO:0043648 "dicarboxylic acid metabolic process" evidence=ISO] [GO:0044822 "poly(A) RNA binding" evidence=ISO] [GO:0045471 "response to ethanol" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 MGI:MGI:95792 GO:GO:0005886 GO:GO:0004069 GO:GO:0030170 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0045471 GO:GO:0005759 GO:GO:0016212 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 HOVERGEN:HBG000951 OrthoDB:EOG74J980 GO:GO:0006532 GO:GO:0006533 GO:GO:0019551 GO:GO:0019550 GO:GO:0006107 CTD:2806 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:J02622 EMBL:X06917 EMBL:X06918 EMBL:X06919 EMBL:X06920 EMBL:X06921 EMBL:X06922 EMBL:X06923 EMBL:X06924 EMBL:X06925 EMBL:X06926 EMBL:M37259 EMBL:M37250 EMBL:M37251 EMBL:M37252 EMBL:M37253 EMBL:M37254 EMBL:M37255 EMBL:M37256 EMBL:M37258 EMBL:U82470 EMBL:AK136556 EMBL:AK147953 EMBL:AK149886 EMBL:AK149926 EMBL:AK150194 EMBL:AK152921 EMBL:AK155075 EMBL:AK167767 EMBL:BC089015 EMBL:BC089341 PIR:S01174 RefSeq:NP_034455.1 UniGene:Mm.230169 PDB:3HLM PDB:3PD6 PDB:3PDB PDBsum:3HLM PDBsum:3PD6 PDBsum:3PDB ProteinModelPortal:P05202 SMR:P05202 IntAct:P05202 MINT:MINT-1859771 ChEMBL:CHEMBL3647 PhosphoSite:P05202 PaxDb:P05202 PRIDE:P05202 Ensembl:ENSMUST00000034097 GeneID:14719 KEGG:mmu:14719 UCSC:uc009mzi.1 InParanoid:P05202 EvolutionaryTrace:P05202 NextBio:286731 PRO:PR:P05202 Bgee:P05202 Genevestigator:P05202 Uniprot:P05202)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 269/399 (67.42%), Postives = 328/399 (82.21%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  +E +  GR +T Q ISGTGALR+GA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE+++++K++NL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HIT+QIGMFCFTG+KPEQV ++  + SVY+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:got2a "glutamic-oxaloacetic transaminase 2a, mitochondrial (aspartate aminotransferase 2)" species:7955 "Danio rerio" [GO:0030170 "pyridoxal phosphate binding" evidence=IEA] [GO:0006520 "cellular amino acid metabolic process" evidence=IEA] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0003824 "catalytic activity" evidence=IEA] [GO:0008483 "transaminase activity" evidence=IEA] [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=IEA] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 ZFIN:ZDB-GENE-040426-2703 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 GO:GO:0006520 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 HOVERGEN:HBG000951 OrthoDB:EOG74J980 OMA:RVGAFTM TreeFam:TF300641 EMBL:BX571884 EMBL:BC054684 EMBL:BC165803 RefSeq:NP_998544.1 UniGene:Dr.17618 STRING:7955.ENSDARP00000060165 Ensembl:ENSDART00000060166 GeneID:406688 KEGG:dre:406688 CTD:406688 InParanoid:Q7SYK7 NextBio:20818215 Uniprot:Q7SYK7)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 272/423 (64.30%), Postives = 340/423 (80.38%), Query Frame = 0
Query:    5 SLRHLSSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            S + LSS   Q   L +  +RA SWWT V+MGPPD ILGVTE FK+D+NPKKMNLGVGAYRDD+GKPF+L SVRKAE +I    ++ EY  I G A F+K   +LA G  +E +  GR IT Q ISGTG+LRIGA ++S++    + VYLPKPSWGNHTP+F+  GM++ +Y YY+P TCGF+ +G  +DI +IPEKSVILLHACAHNPTGVDP+P QWKE++ LIK+RNL VFFDMAYQGFASG++D DA+AVR F+  GHNI LSQS+AKNMGLYGER+G F+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P L +EWL +VKGMADRII+MR  L   L+KEGS+HNW H+T+QIGMFCFTG+KPEQV ++I++ S+Y+TKDGRISVAG++S+NV +LA A+HAVTK
Sbjct:    6 SSKILSSVGSQTPVLAVLQLRASSWWTEVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSSVRKAEAQIAAKKLDKEYLPIGGLADFSKACVQLALGPDNEVLKSGRSITVQTISGTGSLRIGANFVSRFHNASRDVYLPKPSWGNHTPVFRDAGMQLKAYTYYEPKTCGFNLKGALDDISKIPEKSVILLHACAHNPTGVDPRPEQWKEMAALIKKRNLLVFFDMAYQGFASGDIDRDAWAVRYFIEQGHNILLSQSFAKNMGLYGERVGGFTVVCKDAEEAKRVESQLKILIRPIYSNPPMNGARIAATILNTPELYKEWLQEVKGMADRIIRMREMLVSNLKKEGSTHNWQHVTDQIGMFCFTGLKPEQVERLINEFSIYMTKDGRISVAGVTSANVEYLAHAIHAVTK 428          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:GOT2 "Aspartate aminotransferase, mitochondrial" species:9541 "Macaca fascicularis" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS] [GO:0005739 "mitochondrion" evidence=ISS] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006536 "glutamate metabolic process" evidence=ISS] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0005739 GO:GO:0005886 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005759 GO:GO:0006869 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 KO:K14455 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 HOVERGEN:HBG000951 GO:GO:0097052 EMBL:AB169685 RefSeq:NP_001270119.1 UniGene:Mfa.8379 ProteinModelPortal:Q4R559 SMR:Q4R559 PRIDE:Q4R559 GeneID:101867025 Uniprot:Q4R559)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 328/399 (82.21%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:GOT2 "Aspartate aminotransferase, mitochondrial" species:9606 "Homo sapiens" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=EXP;ISS;IDA] [GO:0005739 "mitochondrion" evidence=ISS;IDA] [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0005759 "mitochondrial matrix" evidence=TAS] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0005975 "carbohydrate metabolic process" evidence=TAS] [GO:0006006 "glucose metabolic process" evidence=TAS] [GO:0006094 "gluconeogenesis" evidence=TAS] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006107 "oxaloacetate metabolic process" evidence=IEA] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006532 "aspartate biosynthetic process" evidence=IEA] [GO:0006533 "aspartate catabolic process" evidence=IDA] [GO:0006536 "glutamate metabolic process" evidence=ISS] [GO:0008652 "cellular amino acid biosynthetic process" evidence=TAS] [GO:0015908 "fatty acid transport" evidence=IEP] [GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA] [GO:0019470 "4-hydroxyproline catabolic process" evidence=TAS] [GO:0019550 "glutamate catabolic process to aspartate" evidence=IEA] [GO:0019551 "glutamate catabolic process to 2-oxoglutarate" evidence=IEA] [GO:0030170 "pyridoxal phosphate binding" evidence=IEA] [GO:0034641 "cellular nitrogen compound metabolic process" evidence=TAS] [GO:0044281 "small molecule metabolic process" evidence=TAS] [GO:0044822 "poly(A) RNA binding" evidence=IDA] [GO:0045471 "response to ethanol" evidence=IDA] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] Reactome:REACT_111217 InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0005886 GO:GO:0070062 GO:GO:0004069 GO:GO:0030170 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0045471 GO:GO:0005759 GO:GO:0034641 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 DrugBank:DB00142 DrugBank:DB00114 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 PANTHER:PTHR11879 HOVERGEN:HBG000951 OrthoDB:EOG74J980 GO:GO:0006532 GO:GO:0006533 GO:GO:0019551 GO:GO:0019550 GO:GO:0006107 GO:GO:0008652 GO:GO:0006094 DrugBank:DB00128 CTD:2806 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:M22632 EMBL:AK223271 EMBL:BC000525 PIR:A31873 RefSeq:NP_001273149.1 RefSeq:NP_002071.2 UniGene:Hs.599470 ProteinModelPortal:P00505 SMR:P00505 BioGrid:109068 IntAct:P00505 MINT:MINT-1406848 STRING:9606.ENSP00000245206 PhosphoSite:P00505 DMDM:308153643 UCD-2DPAGE:P00505 PaxDb:P00505 PRIDE:P00505 DNASU:2806 Ensembl:ENST00000245206 GeneID:2806 KEGG:hsa:2806 UCSC:uc002eof.1 GeneCards:GC16M058741 H-InvDB:HIX0013095 HGNC:HGNC:4433 HPA:HPA018139 MIM:138150 neXtProt:NX_P00505 PharmGKB:PA28818 InParanoid:P00505 PhylomeDB:P00505 ChiTaRS:Got2 GeneWiki:GOT2 GenomeRNAi:2806 NextBio:11061 PRO:PR:P00505 ArrayExpress:P00505 Bgee:P00505 CleanEx:HS_GOT2 Genevestigator:P00505 GO:GO:0019470 Uniprot:P00505)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 329/399 (82.46%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKP+WGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VK MADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++I + S+Y+TKDGRISVAG++SSNVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:GOT2 "Aspartate aminotransferase, mitochondrial" species:9986 "Oryctolagus cuniculus" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS] [GO:0005739 "mitochondrion" evidence=ISS] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006457 "protein folding" evidence=TAS] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006536 "glutamate metabolic process" evidence=ISS] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0005739 GO:GO:0005886 GO:GO:0006457 GO:GO:0004069 GO:GO:0030170 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0045471 GO:GO:0005759 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 eggNOG:COG1448 HOGENOM:HOG000185898 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 GeneTree:ENSGT00390000014081 OrthoDB:EOG74J980 GO:GO:0006532 GO:GO:0006533 GO:GO:0019551 GO:GO:0019550 GO:GO:0006107 OMA:RVGAFTM TreeFam:TF300641 GO:GO:0015908 GO:GO:0097052 EMBL:AAGW02052878 PIR:B27103 RefSeq:XP_002711597.1 UniGene:Ocu.5296 ProteinModelPortal:P12345 STRING:9986.ENSOCUP00000003357 Ensembl:ENSOCUT00000003872 GeneID:100348732 Uniprot:P12345)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 268/395 (67.85%), Postives = 325/395 (82.28%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            VEMGPPD ILGVTE +K+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I    ++ EY  I G A F + SAELA G  SE V  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++ SYRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+V+C D +EA RV SQ+KILIRPMYSNPPIHGAR+ S IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+H+W HIT+QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   36 VEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEVVKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVICKDADEAKRVESQLKILIRPMYSNPPIHGARIASTILTSPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHSWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. GO
Match: - (symbol:GOT2 "Aspartate aminotransferase, mitochondrial" species:9823 "Sus scrofa" [GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISS] [GO:0005739 "mitochondrion" evidence=ISS] [GO:0005743 "mitochondrial inner membrane" evidence=ISS] [GO:0005759 "mitochondrial matrix" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA] [GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS] [GO:0006531 "aspartate metabolic process" evidence=ISS] [GO:0006536 "glutamate metabolic process" evidence=ISS] [GO:0006869 "lipid transport" evidence=IEA] [GO:0009058 "biosynthetic process" evidence=IEA] [GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA] [GO:0030170 "pyridoxal phosphate binding" evidence=IEA] [GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA] InterPro:IPR000796 InterPro:IPR004838 InterPro:IPR004839 InterPro:IPR015421 Pfam:PF00155 PRINTS:PR00799 PROSITE:PS00105 GO:GO:0005886 GO:GO:0004069 GO:GO:0030170 GO:GO:0009058 Gene3D:3.40.640.10 InterPro:IPR015424 SUPFAM:SSF53383 GO:GO:0005743 GO:GO:0005759 GO:GO:0006869 GO:GO:0016212 GO:GO:0006103 GO:GO:0006536 eggNOG:COG1448 HOGENOM:HOG000185898 KO:K14455 GO:GO:0080130 GO:GO:0006531 PANTHER:PTHR11879 HOVERGEN:HBG000951 CTD:2806 GO:GO:0097052 EMBL:M11732 EMBL:F14822 PIR:A25165 RefSeq:NP_999093.1 UniGene:Ssc.3588 ProteinModelPortal:P00506 SMR:P00506 STRING:9823.ENSSSCP00000003017 PaxDb:P00506 PRIDE:P00506 GeneID:396968 KEGG:ssc:396968 Uniprot:P00506)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 270/395 (68.35%), Postives = 323/395 (81.77%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  +E +  GR++T Q ISGTGALRIGA +L ++F   + V+LPKPSWGNHTPIF+  GM++ SYRYYDP TCGFDF G  EDI +IP +SVILLHACAHNPTGVDP+P QWKE++TL+K+ NL+ FFDMAYQGFASG+ + DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRPMYSNPP++GAR+ S IL+ P LRQ+WL +VKGMADRII MR QL   L+KEGSSHNW HI +QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   36 VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHSYRYYDPKTCGFDFTGALEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATLVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRQQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHIVDQIGMFCFTGIKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592785874|gb|GAXK01168694.1| (TSA: Calanus finmarchicus comp332_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 290/418 (69.38%), Postives = 343/418 (82.06%), Query Frame = 0
Query:   10 SSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            +SS+ +  A  +S+VR  S+W+GVEMGPPDAILGV+E FKKDSNPKKMNLGVGAYRDD G+PF+LPSV KAE+ I  A +N EY+ I G+  F K +A+LAFG  S  V EGR++T Q ISGTG+LRIGA Y++KW+PG KT+YLPKPSWGNHTPIFK  GM VA Y YYDP TCG +F G   DI  IPE SVILLHACAHNPTGVDP P QWKE+S +IK R L  FFDMAYQGFASG+VD DAFA+RQF++DGH++ L+QS+AKNMGLYGER GAF+VVC DKEEA+RV SQ+KI++RP+YSNPP HGAR+ +E++++P LR EWL DVK MADRII MR QLK+GL   GS+ NW HIT+QIGMFCFTGM  EQVA I  D+SVYLTKDGRIS+AGISS NVG+LA+AMHAVTK
Sbjct:   47 TSSLQRTAAPCLSAVRNASFWSGVEMGPPDAILGVSEAFKKDSNPKKMNLGVGAYRDDAGQPFVLPSVLKAEQNIMAAKLNKEYAPIGGEPEFCKEAAKLAFGDSSNVVTEGRNVTLQGISGTGSLRIGAEYVAKWWPGNKTIYLPKPSWGNHTPIFKFAGMNVAGYTYYDPATCGLNFSGAMADISAIPEGSVILLHACAHNPTGVDPTPEQWKEMSAVIKARKLLPFFDMAYQGFASGDVDKDAFALRQFIDDGHDVLLAQSFAKNMGLYGERAGAFTVVCADKEEASRVESQVKIIVRPLYSNPPRHGARIAAEVMTNPELRAEWLVDVKTMADRIITMRTQLKDGLTSNGSTRNWQHITDQIGMFCFTGMTQEQVAAITKDYSVYLTKDGRISMAGISSKNVGYLAEAMHAVTK 1300          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776149|gb|GAXK01178419.1| (TSA: Calanus finmarchicus comp14230_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 360.918 bits (925), Expect = 7.325e-120
Identity = 177/395 (44.81%), Postives = 252/395 (63.80%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            +   PP  +  +   F  DSNP K++LGVGAYR ++GKP+ILP V+KAE    E+I    +NHEY  ++G  +F   +  +  G  S  + E R    Q +SGTGALR GA +L +   G   VY   P+WGNH  IFK+ G  E+  YRY+DP+     +EG  ED+   P KS+I+LHACAHNPTGVD    QW++++ +  E++L+ FFD AYQGFASG +D DA+AVR F++ G  +  SQS++KN GLY ER G  ++V  D+       SQ+ ++IR MYSNPP HGAR+V  +LS+P L QEW   +K M+ RII MR  L++ +E  G+  +W+HIT QIGMF +TG+  E    +  + S+Y+ K GRIS+ G++  N+ ++A+A+
Sbjct:   34 ITAAPPIEVFQLGRDFAADSNPDKVSLGVGAYRTEQGKPWILPVVKKAEKILAERIEKEEINHEYLPVLGLESFATAATAMLLGDDSPALGESRAFGVQCLSGTGALRNGAEFLKR-ICGSNIVYYSDPTWGNHGLIFKNAGFTELRKYRYWDPSAKSLAWEGMMEDLNNAPAKSIIILHACAHNPTGVDCTKEQWEKIADICHEKDLFPFFDCAYQGFASGCLDTDAWAVRYFVSRGFELFCSQSFSKNFGLYNERAGNLTIVMKDQANMVNFKSQLTLIIRAMYSNPPAHGARIVDTVLSNPELYQEWRECIKIMSSRIIDMRSGLRKRIEDLGTPGSWSHITTQIGMFSYTGLTEEMCLFLQKEKSLYMLKSGRISMCGVTPGNIDYVAKAI 1215          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776150|gb|GAXK01178418.1| (TSA: Calanus finmarchicus comp14230_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 363.229 bits (931), Expect = 1.037e-119
Identity = 181/401 (45.14%), Postives = 257/401 (64.09%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVTK 425
            +   PP  +  +   F  DSNP K++LGVGAYR ++GKP+ILP V+KAE    E+I    +NHEY  ++G  +F   +  +  G  S  + E R    Q +SGTGALR GA +L +   G   VY   P+WGNH  IFK+ G  E+  YRY+DP+     +EG  ED+   P KS+I+LHACAHNPTGVD    QW++++ +  E++L+ FFD AYQGFASG +D DA+AVR F++ G  +  SQS++KN GLY ER G  ++V  D+       SQ+ ++IR MYSNPP HGAR+V  +LS+P L QEW   +K M+ RII MR  L++ +E  G+  +W+HIT QIGMF +TG+  E    +  + S+Y+ K GRIS+ G++  N+ ++A+A++ AVTK
Sbjct:   34 ITAAPPIEVFQLGRDFAADSNPDKVSLGVGAYRTEQGKPWILPVVKKAEKILAERIEKEEINHEYLPVLGLESFATAATAMLLGDDSPALGESRAFGVQCLSGTGALRNGAEFLKR-ICGSNIVYYSDPTWGNHGLIFKNAGFTELRKYRYWDPSAKSLAWEGMMEDLNNAPAKSIIILHACAHNPTGVDCTKEQWEKIADICHEKDLFPFFDCAYQGFASGCLDTDAWAVRYFVSRGFELFCSQSFSKNFGLYNERAGNLTIVMKDQANMVNFKSQLTLIIRAMYSNPPAHGARIVDTVLSNPELYQEWRECIKIMSSRIIDMRSGLRKRIEDLGTPGSWSHITTQIGMFSYTGLTEEMCLFLQKEKSLYMLKSGRISMCGVTPGNIDYVAKAINEAVTK 1233          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776151|gb|GAXK01178417.1| (TSA: Calanus finmarchicus comp14230_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 343.199 bits (879), Expect = 3.000e-109
Identity = 164/351 (46.72%), Postives = 233/351 (66.38%), Query Frame = 0
Query:   78 RKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVA--EGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVT 424
            +K  ++I    +NHEY  ++G  TF+  +  +  G    A  EGR    QA+SGTGALR GA +L++   G +  Y   P+WGNH  IFK+ G  ++  YRY+D      DF+G  ED++  P K+VI+LHACAHNPTGVDP   QWK+++ +I+ +NL+ FFD AYQGFASG++D DA++VR F+  G  +  +QS++KN GLY ER G  +VV N+ +  A   SQ+ ++IR MYSNPP HG+R+V  +L DP + QEW   +K MADRII MR  L+E LEK G+  NWNHIT+QIGMF +TG+ P Q   ++ +  +YL K GRIS+ G++  N+ ++A +++ AVT
Sbjct:    1 KKLADQIEAEAINHEYLPVLGLETFSSAATSMLLGENCAAIKEGRAFGAQALSGTGALRNGAEFLAR-ISGLRCAYYSDPTWGNHGLIFKNAGFTDIRKYRYWDAQRKCLDFDGFIEDLENAPAKAVIILHACAHNPTGVDPTKDQWKKIAEVIERKNLFPFFDCAYQGFASGSLDTDAWSVRYFVEKGFELYCAQSFSKNFGLYNERAGNLTVVMNNSKMVANFKSQLTLIIRAMYSNPPAHGSRIVDTVLKDPAMYQEWRDCIKIMADRIINMRSGLRERLEKLGTPGNWNHITDQIGMFSYTGLSPAQSEFLVKEKHIYLLKSGRISMCGVTPGNIDYVAASIYEAVT 1050          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592894259|gb|GAXK01064116.1| (TSA: Calanus finmarchicus comp183121_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 334.339 bits (856), Expect = 3.498e-108
Identity = 170/404 (42.08%), Postives = 247/404 (61.14%), Query Frame = 0
Query:   30 WTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVA--EGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGME-VASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVTK 425
            ++ V + PP  +  +   F  D +  K++LG+GAYR +EG P++LP V+KAE    EKI    ++HEY   +G   +   +  L  G +  A  EGR    Q++SGTGA++I A +L     G +TVY   PSW NH  IF   G E    YRY++  T   D+ G  ED+   P KSVI+L ACAHNPTG+D    QW++++ + +ER L+  FD AYQGFASG +D DA+AVR F++ G  +  +QS++KN GLY ER G  +VV  DK       SQ+  ++R MY NPP HGA +V  +LS+P L +EW   +K M+ RII +R +L++ +E  G+  +W+HIT QIGMF +TG+  E    +     +YL K GRIS+ G++S N+ +LA A++ A+T+
Sbjct:  102 FSNVHLAPPVELFQLGRDFLADDDKDKISLGIGAYRTEEGTPWVLPVVKKAERILAEKIEKEVLDHEYVPFLGMNNYTSAATALLLGDQCPALTEGRAFGVQSVSGTGAIKIAAEFLKNAL-GFRTVYYSDPSWPNHEHIFYGSGWEDRRQYRYWEKKTKALDWSGMMEDLSSAPHKSVIVLQACAHNPTGLDLNKAQWEKVADVCQERQLFPLFDCAYQGFASGCLDTDAWAVRYFVSRGFELFCAQSFSKNFGLYNERAGNLTVVMKDKRNFDNFVSQMNPIVRGMYVNPPCHGAMIVQTVLSNPELFEEWKKSIKVMSARIIDIRARLRKRIEDLGTPGDWSHITSQIGMFSYTGLTEEMCLFLQKKKHIYLMKSGRISLCGVNSRNIDYLANAIYEAITR 1310          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776156|gb|GAXK01178412.1| (TSA: Calanus finmarchicus comp14230_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 295.819 bits (756), Expect = 2.593e-94
Identity = 142/299 (47.49%), Postives = 199/299 (66.56%), Query Frame = 0
Query:  129 GTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVTK 425
            GTGALR GA +L +   G   VY   P+WGNH  IFK+ G  E+  YRY+DP+     +EG  ED+   P KS+I+LHACAHNPTGVD    QW++++ +  E++L+ FFD AYQGFASG +D DA+AVR F+  G  +  SQS++KN GLY ER G  ++V  D+       SQ+ ++IR MYSNPP HGAR+V  +LS+P L QEW   +K M+ RII MR  L++ +E  G+  +W+HIT QIGMF +TG+  E    +  + S+Y+ K GRIS+ G++  N+ ++A+A++ AVTK
Sbjct:  363 GTGALRNGAEFLKR-ICGSNIVYYSDPTWGNHGLIFKNAGFTELRKYRYWDPSAKSLAWEGMMEDLNNAPAKSIIILHACAHNPTGVDCTKEQWEKIADICHEKDLFPFFDCAYQGFASGCLDTDAWAVRYFVTRGFELFCSQSFSKNFGLYNERAGNLTIVMKDQANMVNFKSQLTLIIRAMYSNPPAHGARIVDTVLSNPELYQEWRECIKIMSSRIIDMRSGLRKRIEDLGTPGSWSHITTQIGMFSYTGLTEEMCLFLQKEKSLYMLKSGRISMCGVTPGNIDYVAKAINEAVTK 1256          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592858459|gb|GAXK01099103.1| (TSA: Calanus finmarchicus comp238428_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 296.59 bits (758), Expect = 2.532e-93
Identity = 155/401 (38.65%), Postives = 235/401 (58.60%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIF-NANMNHEYSTIVGDATFNKLSAELAFGS-EFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            S ++ V  GPP  +L +   + +D +  K+NL VG Y+DD G P++LP VR+ E  I  + + NHEY   +G    NK + +L  G      EGR    Q++ GTG +R+GA +L +   G +      P+W NH  IF   G  +V SY Y++  T   DF+   E ++  P  +V LLHA A NPTGVDP   QW+++  ++K RNL  FFD AYQG+ASG++D DA+AVR F  +G  + +SQS+ KN+GLYG+RIG  + V  D  +   + SQ+ +++RPMY NP    AR++ EIL +   R EW + +  M +RI  +R  L+  LE+     +W+ IT Q+GMF ++G+   Q  K+   H   +  +GR+S+ GI+S N+ + A+ +  VT+
Sbjct:   65 SLFSCVSPGPPIEVLHMKSRYDQDPSSVKINLTVGGYKDDTGNPWVLPVVRETEFAILSDPSTNHEYLPALGSEAANKAAVDLLLGDCAATREGRAFGVQSLGGTGPIRVGAEFLQQ-HVGCRVGRYSDPTWINHRDIFVKSGFTDVTSYPYWNSVTRAPDFQSLFECLESSPPYTVFLLHAQAQNPTGVDPTRDQWRKICQIMKRRNLIPFFDCAYQGWASGDMDEDAWAVRHFEENGLEMLVSQSFGKNLGLYGDRIGFLTFVVKDHTKIEAMKSQLTLILRPMYGNPCRPAARLIEEILLNKKRRAEWSTQLMSMVNRIQGVRKDLRAMLEQLEPGKDWSSITTQVGMFWYSGLTRAQGMKLAEQHVYMMPGNGRMSLCGINSGNIRYFAETVARVTR 1264          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776147|gb|GAXK01178421.1| (TSA: Calanus finmarchicus comp14230_c1_seq5 transcribed RNA sequence)

HSP 1 Score: 235.728 bits (600), Expect = 4.100e-73
Identity = 120/259 (46.33%), Postives = 164/259 (63.32%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIG 284
            +   PP  +  +   F  DSNP K++LGVGAYR ++GKP+ILP V+KAE    E+I    +NHEY  ++G  +F   +  +  G  S  + E R    Q +SGTGALR GA +L +   G   VY   P+WGNH  IFK+ G  E+  YRY+DP+     +EG  ED+   P KS+I+LHACAHNPTGVD    QW++++ +  E++L+ FFD AYQGFASG +D DA+AVR F++ G  +  SQS++KN GLY ER G
Sbjct:   34 ITAAPPIEVFQLGRDFAADSNPDKVSLGVGAYRTEQGKPWILPVVKKAEKILAERIEKEEINHEYLPVLGLESFATAATAMLLGDDSPALGESRAFGVQCLSGTGALRNGAEFLKR-ICGSNIVYYSDPTWGNHGLIFKNAGFTELRKYRYWDPSAKSLAWEGMMEDLNNAPAKSIIILHACAHNPTGVDCTKEQWEKIADICHEKDLFPFFDCAYQGFASGCLDTDAWAVRYFVSRGFELFCSQSFSKNFGLYNERAG 807          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776155|gb|GAXK01178413.1| (TSA: Calanus finmarchicus comp14230_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 238.424 bits (607), Expect = 2.012e-72
Identity = 116/246 (47.15%), Postives = 164/246 (66.67%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNA----NMNHEYSTIVGDATFNKLSAELAFGSEFVA--EGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNI 266
            SW++ V+  PP  +  ++  F+ D NPKK++LGVGAYR DEGKP+ILP V+KAE+K+ +      +NHEY  ++G  TF+  +  +  G    A  EGR    QA+SGTGALR GA +L++   G +  Y   P+WGNH  IFK+ G  ++  YRY+D      DF+G  ED++  P K+VI+LHACAHNPTGVDP   QWK+++ +I+ +NL+ FFD AYQGFASG++D DA++VR F+  G  +
Sbjct:    7 SWFSNVDAAPPIEVFQLSRDFQADPNPKKVSLGVGAYRTDEGKPWILPCVKKAEKKLADQIEAEAINHEYLPVLGLETFSSAATSMLLGENCAAIKEGRAFGAQALSGTGALRNGAEFLAR-ISGLRCAYYSDPTWGNHGLIFKNAGFTDIRKYRYWDAQRKCLDFDGFIEDLENAPAKAVIILHACAHNPTGVDPTKDQWKKIAEVIERKNLFPFFDCAYQGFASGSLDTDAWSVRYFVEKGFEL 741          
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Match: gi|592776157|gb|GAXK01178411.1| (TSA: Calanus finmarchicus comp14230_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 168.703 bits (426), Expect = 1.856e-45
Identity = 77/157 (49.04%), Postives = 109/157 (69.43%), Query Frame = 0
Query:  269 SQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVT 424
            +QS++KN GLY ER G  +VV N+ +  A   SQ+ ++IR MYSNPP HG+R+V  +L DP + QEW   +K MADRII MR  L+E LEK G+  NWNHIT+QIGMF +TG+ P Q   ++ +  +YL K GRIS+ G++  N+ ++A +++ AVT
Sbjct: 1114 AQSFSKNFGLYNERAGNLTVVMNNSKMVANFKSQLTLIIRAMYSNPPAHGSRIVDTVLKDPAMYQEWRDCIKIMADRIINMRSGLRERLEKLGTPGNWNHITDQIGMFSYTGLSPAQSEFLVKEKHIYLLKSGRISMCGVTPGNIDYVAASIYEAVT 1584          
BLAST of EMLSAG00000000005 vs. L. salmonis peptides
Match: EMLSAP00000000005 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:17229:19252:-1 gene:EMLSAG00000000005 transcript:EMLSAT00000000005 description:"maker-LSalAtl2s1003-augustus-gene-0.18")

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 425/425 (100.00%), Postives = 425/425 (100.00%), Query Frame = 0
Query:    1 MAXPSLRHLSSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            MAXPSLRHLSSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK
Sbjct:    1 MAXPSLRHLSSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425          
BLAST of EMLSAG00000000005 vs. L. salmonis peptides
Match: EMLSAP00000006278 (pep:novel supercontig:LSalAtl2s:LSalAtl2s341:710471:754291:-1 gene:EMLSAG00000006278 transcript:EMLSAT00000006278 description:"maker-LSalAtl2s341-augustus-gene-7.35")

HSP 1 Score: 378.252 bits (970), Expect = 2.652e-123
Identity = 188/400 (47.00%), Postives = 266/400 (66.50%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEK----IFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTV-YLPKPSWGNHTPIFKHCG-MEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLND-GHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVTK 425
             PP  +  ++  F++D   KK++LGVGAYRDDEGKP++LP V+K E+K    I   ++NHEY  I+G   F+  + ++  G  S+ + EGR    Q++SGTGALR GA + +K    K+TV Y+  P+WGNH  IF   G +E   YRY++  + GFDFEG  ED+K  PE +VI+LHA AHNPTG+DP   QWK ++ +++ER L+ FFD AYQGFASG++D DA+AVR F +D G  +  +QS++KN GLY ER G  S V    +    + SQ+ ++IR  YSNPP HG R+V  +L+D  L  EW   +K M+ RI+ MR  L+E LEK  +   WNHIT+QIGMF FTGM P+ V+ ++ +  +YL  +GRISVAG++ SN+ ++A++M+ AV K
Sbjct:  354 APPIEVFKLSRDFREDPCDKKVSLGVGAYRDDEGKPWVLPVVKKMEKKLHEDIDKNSINHEYLPILGLEPFSTAATKMLLGTNSKAIQEGRAFGVQSLSGTGALRNGAEFCNKML--KQTVFYVSTPTWGNHNSIFLKSGFLEARKYRYWNNESKGFDFEGMMEDLKNAPENAVIILHAVAHNPTGIDPTQEQWKAIADIMQERKLFPFFDCAYQGFASGDLDKDAWAVRYFADDRGFELFCAQSFSKNFGLYNERCGNLSFVLKSSDNIVNINSQLTVIIRGAYSNPPAHGCRIVEGVLNDSNLYNEWKESIKIMSGRIMSMRQGLRERLEKLNTPGKWNHITDQIGMFSFTGMNPDMVSYLVKEKHIYLLSNGRISVAGLNPSNIDYVAESMNEAVNK 751          
BLAST of EMLSAG00000000005 vs. L. salmonis peptides
Match: EMLSAP00000001461 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1248:99805:101474:-1 gene:EMLSAG00000001461 transcript:EMLSAT00000001461 description:"maker-LSalAtl2s1248-augustus-gene-0.14")

HSP 1 Score: 265.003 bits (676), Expect = 1.353e-83
Identity = 144/400 (36.00%), Postives = 227/400 (56.75%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIK-RIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVY-LTKDGRISVAGISSSNVGHLAQAMHAVT 424
            S+++ + MG    +  +   ++ D NP K NL +G Y  ++G  +    V KAE ++  +  NH Y    G    N    +LAFG    A       Q+I GTG LR+GA +L +     KT Y   P+W NH  IF+  G  +V  Y Y++ +T   DFE  C  +K    EKSVI+LHA  HNPTG++    QWK +  +++ER L+ F  +AY GF  G ++ D+F +R F +      +SQS+ KN+GLYGERIG  S   ND+    ++ SQ+  + RPMYSNP  +GA +++++L DP+    W+ ++K + +R+  +R Q+K  L+K     NW+ IT+Q GMF F+ ++ +Q  ++  D  VY L   GRI++ GI+S+N+ ++ Q++  + 
Sbjct:   17 SFFSTIPMGASVEVTEMCREYQLDKNPLKANLSIGGYYGEDGDIYKFRVVTKAERELIQSP-NHSYLPPNGIPELNHAVFKLAFGESEEAWKHGFCVQSIGGTGPLRLGAEFLREHL-DLKTAYYSDPTWINHKHIFERAGFTQVEPYPYWNYDTYEIDFEKLCHFLKFEAKEKSVIILHASVHNPTGMNLSKEQWKIVRDIVRERALFPFLYLAYHGFGDGGLNEDSFPLRLFKSSNIEFFVSQSFGKNLGLYGERIGFLSGSINDENSIPKIYSQMINVSRPMYSNPARYGAAILAKVLLDPSNFASWVQELKEVRERLRLIRKQMKNNLDKLAPHVNWSGITQQTGMFYFSNLEKKQGLQLKEDFHVYILPSSGRINLGGINSNNIDYVCQSLAKIV 414          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|75042478|sp|Q5REB0.1|AATM_PONAB (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 272/399 (68.17%), Postives = 330/399 (82.71%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++I + S+Y+TKDGRISVAG++SSNVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|112987|sp|P00507.2|AATM_RAT (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 327/399 (81.95%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALR+GA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++ ++K++NL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HIT+QIGMFCFTG+KPEQV ++  + SVY+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGKNLDKEYLPIGGLADFCKASAELALGENSEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEMAAVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|112984|sp|P05202.1|AATM_MOUSE (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 269/399 (67.42%), Postives = 328/399 (82.21%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  +E +  GR +T Q ISGTGALR+GA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE+++++K++NL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRP+YSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HIT+QIGMFCFTG+KPEQV ++  + SVY+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|75075926|sp|Q4R559.1|AATM_MACFA (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 328/399 (82.21%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|308153643|sp|P00505.3|AATM_HUMAN (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 270/399 (67.67%), Postives = 329/399 (82.46%), Query Frame = 0
Query:   29 WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            WWT VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR +T Q ISGTGALRIGA++L ++F   + V+LPKP+WGNHTPIF+  GM++  YRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR++WL +VK MADRII MR QL   L+KEGS+HNW HIT+QIGMFCFTG+KPEQV ++I + S+Y+TKDGRISVAG++SSNVG+LA A+H VTK
Sbjct:   32 WWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|544584721|sp|P12345.2|AATM_RABIT (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 268/395 (67.85%), Postives = 325/395 (82.28%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            VEMGPPD ILGVTE +K+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I    ++ EY  I G A F + SAELA G  SE V  GR +T Q ISGTGALRIGA++L ++F   + V+LPKPSWGNHTPIF+  GM++ SYRYYDP TCGFDF G  EDI +IPE+SV+LLHACAHNPTGVDP+P QWKE++T++K+RNL+ FFDMAYQGFASG+ D DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+V+C D +EA RV SQ+KILIRPMYSNPPIHGAR+ S IL+ P LR++WL +VKGMADRII MR QL   L+KEGS+H+W HIT+QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   36 VEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEVVKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVICKDADEAKRVESQLKILIRPMYSNPPIHGARIASTILTSPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHSWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|112985|sp|P00506.2|AATM_PIG (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 270/395 (68.35%), Postives = 323/395 (81.77%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  +E +  GR++T Q ISGTGALRIGA +L ++F   + V+LPKPSWGNHTPIF+  GM++ SYRYYDP TCGFDF G  EDI +IP +SVILLHACAHNPTGVDP+P QWKE++TL+K+ NL+ FFDMAYQGFASG+ + DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRPMYSNPP++GAR+ S IL+ P LRQ+WL +VKGMADRII MR QL   L+KEGSSHNW HI +QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:   36 VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHSYRYYDPKTCGFDFTGALEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATLVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRQQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHIVDQIGMFCFTGIKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|112982|sp|P08907.1|AATM_HORSE (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 264/400 (66.00%), Postives = 327/400 (81.75%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            SWW  VEMGPPD ILGVTE +K+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  SE +  GR++T Q+ISGTGALRIGA +L ++F   + V+LPKPSWGNHTPIF+  G+++ +YRYYDP TCGFD  G  EDI +IP++S+ILLHACAHNPTGVDP+P QWKE++TL+K+ NL+ FFDMAYQGFASG+ + DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF++VC D +EA RV SQ+KILIRP+YSNPP++GAR+ S IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSH+W HI +QIGMFCFTG+KPEQV ++  + S+Y+TKDGRISVAG++S NVG+LA A+H VTK
Sbjct:    2 SWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEALKSGRYVTVQSISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGLQLHAYRYYDPKTCGFDVTGALEDISKIPQQSIILLHACAHNPTGVDPRPEQWKEIATLVKKNNLFAFFDMAYQGFASGDGNKDAWAVRYFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPLYSNPPLNGARIASTILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHSWQHIADQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 401          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|1168261|sp|P12344.2|AATM_BOVIN (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Fatty acid-binding protein; Short=FABP-1; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Plasma membrane-associated fatty acid-binding protein; Short=FABPpm; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 266/395 (67.34%), Postives = 323/395 (81.77%), Query Frame = 0
Query:   33 VEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++LPSVRKAE +I   N++ EY  I G A F K SAELA G  +E +  GR++T Q ISGTGALRIGA++L ++F   + V+LPKP+WGNHTPIF+  GM++ SYRYYDP TCGFDF G  EDI +IP +SVILLHACAHNPTGVDP+P QWKE++T++K+ NL+ FFDMAYQGFASG+ + DA+AVR F+  G N+CL QSYAKNMGLYGER+GAF+VVC D EEA RV SQ+KILIRPMYSNPPI+GAR+ S IL+ P LR++WL +VKGMADRII MR QL   L+KEGSSHNW HI +QIGMFC+TG+KPEQV ++  + S+Y+TKDGRISVAG++S NV +LA A+H VTK
Sbjct:   36 VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGAIEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLHEVKGMADRIISMRTQLVSNLKKEGSSHNWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVAYLAHAIHQVTK 430          
BLAST of EMLSAG00000000005 vs. SwissProt
Match: gi|123892845|sp|Q28F67.1|AATM_XENTR (RecName: Full=Aspartate aminotransferase, mitochondrial; Short=mAspAT; AltName: Full=Glutamate oxaloacetate transaminase 2; AltName: Full=Kynurenine aminotransferase 4; AltName: Full=Kynurenine aminotransferase IV; AltName: Full=Kynurenine--oxoglutarate transaminase 4; AltName: Full=Kynurenine--oxoglutarate transaminase IV; AltName: Full=Transaminase A; Flags: Precursor)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 264/403 (65.51%), Postives = 326/403 (80.89%), Query Frame = 0
Query:   25 RAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGS--EFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            RA SWW+ VEMGPPD ILGVTE FK+D+N KKMNLGVGAYRDD GKP++L SVRKAE ++ + N++ EY  I G A F + SA+LA G   + +  GR IT Q ISGTG+LR+GA +L +++   + VYLPKPSWGNHTPIF+  G+EV  YRYYDP TCGFDF G  +DI +IPE+S+IL HACAHNPTGVDPK  QWKEL+ LIK R L+ FFDMAYQGFASG+ + DA+AVR F+ +G N+ LSQSYAKNMGLYGER+GAF+VVC+D EEA RV SQ+KILIRPMYSNPP++GAR+ + IL+ P LR+EWL +VKGMA+RII MR QL   L+KEGS HNW HI++QIGMFCFTG++PEQV ++I + S+Y+TKDGRISVAG++S+N G+LA A+H VTK
Sbjct:   25 RASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSSVRKAEAQLASKNLDKEYLPIGGLAEFARASAQLALGENCDAIQSGRFITVQTISGTGSLRVGANFLQRFYKYSRDVYLPKPSWGNHTPIFRDAGLEVKGYRYYDPKTCGFDFTGALDDISKIPEQSIILFHACAHNPTGVDPKQEQWKELAALIKSRRLFPFFDMAYQGFASGDTNRDAWAVRHFIQEGINVVLSQSYAKNMGLYGERVGAFTVVCSDAEEAKRVESQLKILIRPMYSNPPLNGARIAAAILTQPDLRKEWLQEVKGMANRIISMREQLVSNLKKEGSIHNWQHISDQIGMFCFTGLRPEQVERLIKEFSIYMTKDGRISVAGVTSANNGYLAHAIHQVTK 427          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: EAA14551.4 (AGAP009685-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 285/430 (66.28%), Postives = 343/430 (79.77%), Query Frame = 0
Query:    1 MAXPSLRHLSSSIMQRNAL---GISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            MA       SS+++ RN L   G  +VRA SWW+GV+MGPPD ILGVTE +K+D+NPKK+NLGVGAYRDD GKPF+LPSV+KAE+++    ++HEYS I G A F K S  LA G  SE VA G + T Q ISGTGALRIG A+L+ +FPG K +YLP PSWGNH PIF+H G+ V +YRYYDP+TCGFDF G  ED+ +IPEKS++LLHACAHNPTGVDPKP QW E+S LIK+RNL+ FFDMAYQGFASG+VD DA AVR+FL DGH I L+QS+AKNMGLYGER GAFS+V   K+EA R  SQIKILIRPMYSNPPIHGAR+V+EIL D +LRQEWL DVK MADRII +R  L+  L++ GSS NW+HIT+QIGMFCFTGM  +Q  ++  + SVYLTKDGRIS+AG++S NVG+LA+A+HAVTK
Sbjct:    1 MACSKALQRSSAVLLRNVLPAQGQLAVRASSWWSGVQMGPPDVILGVTEAYKRDTNPKKINLGVGAYRDDSGKPFVLPSVKKAEQRLAQKQLDHEYSPIGGTAEFCKHSILLALGESSEHVANGLNATVQGISGTGALRIGGAFLASFFPGPKDIYLPTPSWGNHGPIFRHSGLNVKAYRYYDPSTCGFDFAGALEDLSKIPEKSIVLLHACAHNPTGVDPKPEQWAEMSALIKKRNLFPFFDMAYQGFASGDVDKDALAVREFLRDGHQIALAQSFAKNMGLYGERAGAFSLVTGSKDEADRTMSQIKILIRPMYSNPPIHGARLVAEILGDKSLRQEWLGDVKLMADRIISVRSSLRNNLKELGSSRNWSHITDQIGMFCFTGMNQQQCERLSKEFSVYLTKDGRISMAGVTSKNVGYLAEAIHAVTK 430          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: gb|EFA03109.1| (Aspartate aminotransferase, mitochondrial-like Protein [Tribolium castaneum])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 272/415 (65.54%), Postives = 338/415 (81.45%), Query Frame = 0
Query:   13 IMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            ++++N  G+   R+ SWW+ V MGPPDAILGVTE FK+D+NP K+NLGVGAYRDD GKP++LPSVRKAEEK+   N++ EY+ I G A F K + ELA G  SE V+ G + T Q ISGTG+LR+GAA+ S ++PG KTVYLPKP+WGNHTPIFKH GM+V SY +YDP TCG DF+G  +DI +IPE+S+ILLHACAHNPTGVDP   QW ELS+LIK+RNL+ FFDMAYQGFASG++D DA AVR F+ +GH I L+QS+AKNMGLYGER GAF+V    +EE ARV SQ+KILIR +YSNPPI+GAR+V+EIL+DP LR +WL +VKGMADRII +R +L++ L+KEGS+ NW HIT+QIGMFC+TGM P+QV KI  +HSV+LTKDGRIS+AG++S NV +LA AMH VTK
Sbjct:   11 VIRKN--GVIKQRSSSWWSQVAMGPPDAILGVTEAFKRDTNPNKINLGVGAYRDDNGKPYVLPSVRKAEEKLRAKNLDKEYAPISGIAEFCKAAIELALGANSEIVSNGLNATVQGISGTGSLRVGAAFFSNFYPGIKTVYLPKPTWGNHTPIFKHAGMDVQSYTFYDPKTCGLDFKGALDDINKIPERSIILLHACAHNPTGVDPNLDQWAELSSLIKQRNLFPFFDMAYQGFASGDIDRDAQAVRLFIKEGHKIVLAQSFAKNMGLYGERAGAFTVTTESQEETARVMSQLKILIRALYSNPPINGARIVAEILTDPALRADWLKEVKGMADRIISVRTKLRDNLKKEGSTKNWQHITDQIGMFCYTGMTPDQVEKITKEHSVFLTKDGRISMAGVTSKNVEYLAHAMHTVTK 423          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: EFX69044.1 (hypothetical protein DAPPUDRAFT_114061 [Daphnia pulex])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 264/393 (67.18%), Postives = 310/393 (78.88%), Query Frame = 0
Query:   35 MGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            MGPPD ILGVTE FK+D+NPKKMNLGVGAYRDD GKPFILPSV+ AEE+I   NM+ EYS I G   F K +  LA G  +E+   G + T Q ISGTG+LRIG ++LS +FPG K +Y+P P+WGNH P+ KH G+ V  YRYYDP TCGFDF G  +DI +IPE+S+ILLHACAHNPTGVDPKP QW E+S +IKE+ L+ FFDMAYQGFASG++D DA  VR FL DGH I LSQSYAKNMGLYGER GAFS++C+ KEEAA   SQ+KI+IRPMYSNPP+ GAR+ +EIL+ P++R +WL DVKGMADRII MR  L+  L KEGSS +W HIT+QIGMFCFTGM P QV K+  D SVYLTKDGRISVAGI+S NV +LA AMH VTK
Sbjct:    1 MGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDNGKPFILPSVKLAEEEIQKKNMDKEYSPISGSPEFCKATINLALGEDNEWTKNGLNATVQGISGTGSLRIGTSFLSAFFPGNKDLYMPTPTWGNHVPLAKHAGLGVKQYRYYDPKTCGFDFHGALQDIAKIPERSMILLHACAHNPTGVDPKPEQWAEMSKVIKEKKLFPFFDMAYQGFASGDIDKDATPVRMFLKDGHQIALSQSYAKNMGLYGERAGAFSLICSSKEEAAATMSQLKIIIRPMYSNPPVTGARIATEILTTPSIRSQWLKDVKGMADRIISMRQLLRSNLAKEGSSRDWAHITDQIGMFCFTGMAPAQVEKLTKDFSVYLTKDGRISVAGITSKNVEYLAHAMHQVTK 393          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: EEB15916.1 (aspartate aminotransferase, putative [Pediculus humanus corporis])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 256/399 (64.16%), Postives = 320/399 (80.20%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSE-FVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            +WW+ VEMGPPDAILG+TE FKKD+NP K+NLGVGAYRDD GKPF+LPSV +AE ++    ++ EYS I G   F KLS  LA  +E  +  G + T Q ISGTG+LRIG A+L  +FPG K +YLP P+WGNH PIFKHCG+ V  YRYYDP TCG DF+   +DI ++P  S+ILLHACAHNPTGVDPKP QW+ELS +IKE+ L+ FFDMAYQGFASG+V  DAFAVR+F+ DGH I L+QS+AKNMGLYGER+GAFS++   K+E  R+ SQ+KI+IRPMYSNPPIHG+R+V+EILSD  L+ +WL DVK MADRII +R QL + L+KEGSS +W+HIT+QIGMFC+TG+KPEQV ++  D S+YLTKDGRIS+AG++S NV +LA+++H VTK
Sbjct:    7 TWWSKVEMGPPDAILGITEAFKKDNNPNKINLGVGAYRDDNGKPFVLPSVLEAENRLKAKQLDKEYSPISGVPEFCKLSINLALDNEEILNNGLNATVQGISGTGSLRIGGAFLVNFFPGSKEIYLPTPTWGNHIPIFKHCGLNVKHYRYYDPKTCGLDFKSALDDISKMPSNSIILLHACAHNPTGVDPKPEQWRELSKVIKEKKLFPFFDMAYQGFASGDVAKDAFAVREFIKDGHEIALAQSFAKNMGLYGERVGAFSLITTSKDEMERLLSQLKIIIRPMYSNPPIHGSRIVTEILSDCELKSQWLKDVKLMADRIIGVRSQLHDCLKKEGSSKDWSHITDQIGMFCYTGLKPEQVERLTKDFSIYLTKDGRISMAGVTSKNVEYLAKSIHEVTK 405          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: AAN10437.1 (glutamate oxaloacetate transaminase 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 253/403 (62.78%), Postives = 327/403 (81.14%), Query Frame = 0
Query:   25 RAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            R  +W++ V+MGPPDAILGVTE FKKD+NPKK+NLG GAYRDD  +PF+LPSVR+AE+++ + +++ EY+TI+G   F   + ELA G  S+ +A   ++T Q+ISGTGALRIGAA+L+K++ G + +Y+P PSWGNH  IF+H G+ V  YRYYD +TC  DF G  ED+K+IPEKS++LLHACAHNPTGVDP   QW+E+S L+K+RNLY F DMAYQGFA+G++D DA AVR F  DGH+ CL+QS+AKNMGLYGER GAF+V+C+D+EEAARV SQ+KILIR +YSNPP+HGAR+ +EIL++  LR +WL DVK MADRII +R +LK+ L K GSS NW+HI  QIGMFCFTG+KPEQV K+I DHSVYLT DGR+S+AG++S NV +LA+++H VTK
Sbjct:   29 RVSTWFSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVSRSLDKEYATIIGIPEFYNKAIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKFWQGNREIYIPSPSWGNHVAIFEHAGLPVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWREISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTKLKDNLIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYLAESIHKVTK 431          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: AAF51320.1 (glutamate oxaloacetate transaminase 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 256/416 (61.54%), Postives = 334/416 (80.29%), Query Frame = 0
Query:   13 IMQRNALGISSVRAGS-WWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            ++  N L  +++R  S W++ V+MGPPDAILGVTE FKKD+NPKK+NLG GAYRDD  +PF+LPSVR+AE+++ + +++ EY+TI+G   F   + ELA G  S+ +A   ++T Q+ISGTGALRIGAA+L+K++ G + +Y+P PSWGNH  IF+H G+ V  YRYYD +TC  DF G  ED+K+IPEKS++LLHACAHNPTGVDP   QW+E+S L+K+RNLY F DMAYQGFA+G++D DA AVR F  DGH+ CL+QS+AKNMGLYGER GAF+V+C+D+EEAARV SQ+KILIR +YSNPP+HGAR+ +EIL++  LR +WL DVK MADRII +R +LK+ L K GSS NW+HI  QIGMFCFTG+KPEQV K+I DHSVYLT DGR+S+AG++S NV +LA+++H VTK
Sbjct:    9 LLISNRLAPAALRCKSTWFSEVQMGPPDAILGVTEAFKKDTNPKKINLGAGAYRDDNTQPFVLPSVREAEKRVVSRSLDKEYATIIGIPEFYNKAIELALGKGSKRLAAKHNVTAQSISGTGALRIGAAFLAKFWQGNREIYIPSPSWGNHVAIFEHAGLPVNRYRYYDKDTCALDFGGLIEDLKKIPEKSIVLLHACAHNPTGVDPTLEQWREISALVKKRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVLCSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDVRTKLKDNLIKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGVTSKNVEYLAESIHKVTK 424          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: XP_396131.3 (PREDICTED: aspartate aminotransferase, mitochondrial [Apis mellifera])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 252/420 (60.00%), Postives = 325/420 (77.38%), Query Frame = 0
Query:    9 LSSSIMQRNALGISSVRA-GSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
             S ++  +N + +  +R+ G+WW  V+MGPPDAILG+TE +KKD NP K+NLGVGAYRDD GKPF+LPSVRKAEEKI   NM+ EY+ I G + F K S +LA G  S+ V  G + T Q +SGTG+L IG+ +LS++F   K +Y+PKP+WGNH+ IF+  G+ +  YRYYDP TCG DF G  ED+ +IP KS++L HACAHNPTGVDP   QWKEL+  +K RNL+ FFDMAYQGFASG+++ DAFAVR F+ +G +I L+QSYAKNMGLYGER+GA S++ ++KEEA RV SQ+KI+IRP YSNPPI+GAR+V+EIL D  LR++WL DVK MADRII MR  L + L K GS+ +W+HIT QIGMFCFTG+K  +  K+I D+S+YLTKDGRISVAG+++ NV ++A+AMH VTK
Sbjct:   10 FSYNLFNKNKVALYGIRSMGTWWPHVKMGPPDAILGLTEAYKKDQNPNKVNLGVGAYRDDNGKPFVLPSVRKAEEKIKTKNMDKEYAPIAGSSDFCKQSIKLALGDNSDVVKNGLNATVQGVSGTGSLYIGSLFLSQFFSSNKEIYVPKPTWGNHSQIFRLAGLPMKFYRYYDPKTCGLDFNGALEDLSKIPGKSIVLFHACAHNPTGVDPNQDQWKELAETVKRRNLFPFFDMAYQGFASGSLENDAFAVRYFVKNGIDIMLAQSYAKNMGLYGERVGALSIITSNKEEADRVLSQLKIIIRPAYSNPPINGARIVNEILEDSDLRKQWLIDVKTMADRIISMRQTLTDNLRKCGSTRDWSHITNQIGMFCFTGLKSSEAEKLIRDYSIYLTKDGRISVAGVTTKNVEYVAEAMHNVTK 429          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: gb|EEC12678.1| (GOT2 aspartate aminotransferase, putative [Ixodes scapularis])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 249/384 (64.84%), Postives = 296/384 (77.08%), Query Frame = 0
Query:   35 MGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHL 416
            MGPPDAILGVTE FKKD+NPKKMNLGVGAYRDD GKP++LPSVRKAEE + +   + EY  I G   F   +A+LAFG  S  +    + T Q ISGTG+L IGA +L ++F G + +Y+P P+WGNH P+FK  G+ V  YRYYDP TCGFDF G  +DI +IPE S+ILLHACAHNPTGVDPK  QWKE+S +IK R L+ F DMAYQGFA+G++D DA AVR F  +GH   ++QS+AKNMGLYGER GAF++VC  KEEA R  SQIKI++RP YSNPP+HGAR+   IL+D  LRQ+WL DVKGMADRII MR +L++GL +EGSS NW HIT+QIGMFCFTGM  EQVAK+  D SVYLTKDGRISVAGISS NV  L
Sbjct:    1 MGPPDAILGVTEAFKKDTNPKKMNLGVGAYRDDTGKPYVLPSVRKAEEILMSRKQDKEYLPIGGLGDFCTAAAQLAFGEDSPVLKNKLNTTVQGISGTGSLMIGAFFLGQFFKGNREIYMPTPTWGNHIPLFKRAGLTVKQYRYYDPKTCGFDFSGALQDIAKIPEGSIILLHACAHNPTGVDPKFEQWKEISRIIKSRRLFPFLDMAYQGFATGDIDRDAAAVRLFAEEGHGFAMAQSFAKNMGLYGERTGAFTLVCGSKEEADRCLSQIKIIVRPTYSNPPLHGARIAHLILTDQELRQQWLKDVKGMADRIIGMRTRLRDGLTREGSSRNWQHITDQIGMFCFTGMTQEQVAKLTKDFSVYLTKDGRISVAGISSGNVTTL 384          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: gb|KPM10192.1| (aspartate aminotransferase, mitochondrial-like protein [Sarcoptes scabiei])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 244/393 (62.09%), Postives = 307/393 (78.12%), Query Frame = 0
Query:   35 MGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            MGPPDAILG+TE +K+D NP+K+NLGVGAYR+D+GKP +LPSV KAE+K+   N++ EY  I G A F   +A+LAFG  S  ++E  + T Q ISGTG+L IGA +L  +  G K +Y+P P+WGNH P+F   G  V  YRYYDP  CGFDF G  +DI +IPEKSVILLHACAHNPTGVDPK  QWKE+S LIK+R L+ FFDMAYQGFA+G++D DA A+R F+ DGH +CLSQS+AKNMGLYGER+GAF+VV +  EEA+R+ SQIKI+IRPMYSNPP+HGAR+ S IL+D  LR +WL DVK MA RII MR +L+  +E EGS+ NW+HIT+QIGMFCFTGM   QV ++  + S+YLT DGRISVAG+SS+NV ++ +++HAVTK
Sbjct:    1 MGPPDAILGITEAYKRDDNPRKVNLGVGAYRNDQGKPHVLPSVIKAEDKLNELNLDKEYLPISGLADFTSAAAKLAFGDKSRVISEKLNATVQGISGTGSLTIGAYFLRDFHQGPKDIYMPAPTWGNHIPLFTRAGFNVKQYRYYDPKNCGFDFAGALQDIAKIPEKSVILLHACAHNPTGVDPKLEQWKEISKLIKQRKLFPFFDMAYQGFATGDIDRDASALRFFIEDGHQVCLSQSFAKNMGLYGERVGAFTVVASSAEEASRLMSQIKIIIRPMYSNPPLHGARIASLILNDAALRTQWLKDVKEMAHRIISMRTKLRSVIENEGSTKNWSHITDQIGMFCFTGMNKSQVERLTKEFSIYLTMDGRISVAGLSSTNVEYVGKSIHAVTK 393          
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Match: EFX71867.1 (hypothetical protein DAPPUDRAFT_308666 [Daphnia pulex])

HSP 1 Score: 387.882 bits (995), Expect = 5.892e-132
Identity = 191/404 (47.28%), Postives = 266/404 (65.84%), Query Frame = 0
Query:   26 AGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIF-NANMNHEYSTIVGDATFNKLSAELAFGSEF--VAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTV-YLPKPSWGNHTPIFKHCGMEV-ASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVT 424
            A S +  VE  PP  +  + + +  D+ P+K+NLGVGAYR DEGKP++LP VR+ E+++  +  +N EY  ++G       +  +  GS+   + EGR    Q +SGTGALR+GA +L+    GK TV Y   P+WGNH+ +F   G     SYRY+D      DF+G  ED++  P  SVILLHACAHNPTGVDP   QWK+++ LI+ER L+ FFD AYQGFASG++D DA+AVR F + G  +  +QS+AKN GLY ER+G  + V  D+     V SQI +L+R  YSNPP HGAR+V  +L++P L ++W   +K MADRII MRH L+E LEK  +   WNHIT+QIGMF FTG+ P  V K+I++H +YL K GRI++ G+++ N+ ++A+ +H V 
Sbjct:    2 ATSKFAFVESAPPIEVFALNKAYLDDTFPQKVNLGVGAYRTDEGKPWVLPVVRQMEQQLAADETLNKEYLPVLGFEPLASAATRMLLGSDSPSLKEGRATGIQCLSGTGALRVGAEFLAHI--GKHTVVYSSNPTWGNHSLVFLSAGFSTYKSYRYWDAAKKALDFDGLMEDLRNAPANSVILLHACAHNPTGVDPTQDQWKQIADLIEERGLFPFFDSAYQGFASGDLDRDAWAVRYFDSRGFEMVCAQSFAKNFGLYNERVGNLTFVAKDRAVIEPVRSQITLLVRANYSNPPNHGARIVGTVLNNPALTEQWKGHIKTMADRIISMRHGLRERLEKMETPGTWNHITDQIGMFSFTGLGPLAVDKLIAEHHIYLLKGGRINMCGLNTGNIDYVAKCIHEVV 403          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|225708774|gb|ACO10233.1| (Aspartate aminotransferase, mitochondrial precursor [Caligus rogercresseyi])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 370/412 (89.81%), Postives = 391/412 (94.90%), Query Frame = 0
Query:   14 MQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            + + A+G+SSVRAGSWW GVEMGPPDAILGVTE FKKD+NPKKMNLGVGAYRDDEGKPFI+PSVRKAEEKIFNA+MNHEYSTIVGDATFNKLSAELAFGSE V+EGRH+TTQAISGTGALRIGAAYLSKWFPG KTVYLPKPSWGNHTPIFKHCGMEV  YRYYDP TCGFDFEGTCEDIK IPEKSVILLHACAHNPTGVDPKP QWKELS LIK++NLYVFFDMAYQGFASGNVDGDAFAVRQFL DGH+ICL+QSYAKNMGLYGERIGAF+VVC DKEEA+RVASQIKILIRPMYSNPPIHGARVVS+ILSD +LR+EWL DVKGMADRIIKMRHQLKEGLE+EGSSHNWNHITEQIGMFCFTGM PEQVAKI+ DHSVYLTKDGRISVAGISS NV +LA AMHAVTK
Sbjct:   15 INKPAMGMSSVRAGSWWKGVEMGPPDAILGVTEAFKKDANPKKMNLGVGAYRDDEGKPFIVPSVRKAEEKIFNADMNHEYSTIVGDATFNKLSAELAFGSEVVSEGRHVTTQAISGTGALRIGAAYLSKWFPGNKTVYLPKPSWGNHTPIFKHCGMEVGGYRYYDPKTCGFDFEGTCEDIKAIPEKSVILLHACAHNPTGVDPKPEQWKELSALIKKKNLYVFFDMAYQGFASGNVDGDAFAVRQFLKDGHDICLAQSYAKNMGLYGERIGAFTVVCQDKEEASRVASQIKILIRPMYSNPPIHGARVVSQILSDASLREEWLKDVKGMADRIIKMRHQLKEGLEREGSSHNWNHITEQIGMFCFTGMTPEQVAKIMGDHSVYLTKDGRISVAGISSGNVEYLAHAMHAVTK 426          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|225709408|gb|ACO10550.1| (Aspartate aminotransferase, mitochondrial precursor [Caligus rogercresseyi])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 368/410 (89.76%), Postives = 388/410 (94.63%), Query Frame = 0
Query:   16 RNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            + A+G+SSVRAGSWW GVEMGPPDAILGVTE FKKD+NPKKMNLGVGAYRDDEGKPFI+PSVRKAEEKIFNA+MNHEYSTIVGDATFNKLSAELAFGSE V+EGRH+ TQAISGTGALRIGAAYLSKWFPG KTVYLPKPSWGNHTPIFKHCGMEV  YRYYDP TCGFDFEGTCEDIK IPEKSVILLHACAHNPTGVDPKP QWKELS LIK++NLYVFFDMAYQGFASGNVDGDAFAVRQFL DGHNICL+QSYAKNMGLYGERIGAF+VVC DKEEA+RVASQIKILIRPMYSNPPIHGARVVS+ILSD +LR+EWL DVKGMA RIIKMRHQLKEGLE+EGSSHNWNHITEQIGMFCFTGM PEQVAKI+ DHSVYLTKDGR+SVAGISS NV +LA AMHAVTK
Sbjct:   17 KPAMGMSSVRAGSWWKGVEMGPPDAILGVTEAFKKDTNPKKMNLGVGAYRDDEGKPFIVPSVRKAEEKIFNADMNHEYSTIVGDATFNKLSAELAFGSEVVSEGRHVATQAISGTGALRIGAAYLSKWFPGNKTVYLPKPSWGNHTPIFKHCGMEVGGYRYYDPKTCGFDFEGTCEDIKAIPEKSVILLHACAHNPTGVDPKPEQWKELSALIKKKNLYVFFDMAYQGFASGNVDGDAFAVRQFLKDGHNICLAQSYAKNMGLYGERIGAFTVVCQDKEEASRVASQIKILIRPMYSNPPIHGARVVSQILSDASLREEWLKDVKGMAGRIIKMRHQLKEGLEREGSSHNWNHITEQIGMFCFTGMTPEQVAKIMGDHSVYLTKDGRVSVAGISSGNVEYLAHAMHAVTK 426          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|961375918|gb|ALS04703.1| (mitochondrial aspartate aminotransferase precursor [Pseudodiaptomus poplesia])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 300/415 (72.29%), Postives = 345/415 (83.13%), Query Frame = 0
Query:   15 QRNALGI--SSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGSE--FVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            QR A  I  S++R  S+W+GVEMGPPDAILGVTE FKKDSNPKKMNLGVGAYRDD+G+PF+LPSV+KAE KI   N+N EY+ I G+A F +LSA LAFG++   V EG+++T Q ISGTG+LR+GAA+LSKW PG K VYLPKPSWGNHTPI KH G++V SYRYYDP TCG DF G  EDIK IPE S+ILLHACAHNPTGVDP P QWKELS +IK +  + FFDMAYQGFASG++D DAFA+RQF+ DGH + L+QSYAKNMGLYGER GA ++VC DKEEAARV SQ+KILIRP+YSNPP HGAR+V+E+L+DP L  +WL DVK MADRII MR +L+EGL +EGSSHNW HIT QIGMFCFTGMKPEQV KI  D SVYLTKDGRISVAGISSSNV +LA AMH VTK
Sbjct:   16 QRTAAPILSSAIRNSSFWSGVEMGPPDAILGVTEAFKKDSNPKKMNLGVGAYRDDKGQPFVLPSVKKAESKILQQNLNKEYAPIGGEAEFCRLSAVLAFGADSPVVTEGKNVTVQGISGTGSLRVGAAFLSKWLPGNKVVYLPKPSWGNHTPIMKHSGLDVGSYRYYDPATCGMDFAGAVEDIKNIPEGSIILLHACAHNPTGVDPSPEQWKELSAVIKAKKHFPFFDMAYQGFASGDIDADAFAIRQFIADGHMVLLTQSYAKNMGLYGERAGALTIVCQDKEEAARVESQVKILIRPLYSNPPRHGARLVTEVLTDPELHAQWLVDVKTMADRIITMRSKLREGLAREGSSHNWEHITNQIGMFCFTGMKPEQVEKITKDFSVYLTKDGRISVAGISSSNVDYLAHAMHMVTK 430          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191586|gb|AEI84595.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191588|gb|AEI84596.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 295/387 (76.23%), Postives = 333/387 (86.05%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F KLSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP+TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S LIK+RNL+ FFDMAYQGFASG+VDGDAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI  D SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGKLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPSTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLIKKRNLFAFFDMAYQGFASGDVDGDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITKDFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191582|gb|AEI84593.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191584|gb|AEI84594.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 294/387 (75.97%), Postives = 332/387 (85.79%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLPKPSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VDGDAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI  D SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPKPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDGDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITKDFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191578|gb|AEI84591.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191580|gb|AEI84592.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191590|gb|AEI84597.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 293/387 (75.71%), Postives = 332/387 (85.79%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VDGDAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI  D SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDGDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITKDFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191592|gb|AEI84598.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191594|gb|AEI84599.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 292/387 (75.45%), Postives = 331/387 (85.53%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VD DAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI  D SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDEDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITKDFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191600|gb|AEI84602.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191602|gb|AEI84603.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191604|gb|AEI84604.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191606|gb|AEI84605.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191608|gb|AEI84606.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191610|gb|AEI84607.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 291/387 (75.19%), Postives = 332/387 (85.79%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VD DAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI ++ SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDINRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDRDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITTEFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191596|gb|AEI84600.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191598|gb|AEI84601.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 289/387 (74.68%), Postives = 330/387 (85.27%), Query Frame = 0
Query:   36 GPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            GPPD ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VD DAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++  L ++WL DVKGMADRII MR +LK+GL  EGSS NW HI +QIGMFCFTGM PEQV KI ++ SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDRDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTALNKQWLEDVKGMADRIITMRQELKDGLANEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITTEFSVYMTKDGRISVAGISSSNVGYLAKAM 387          
BLAST of EMLSAG00000000005 vs. nr
Match: gi|338191574|gb|AEI84589.1| (mitochondrial aspartate transaminase, partial [Tigriopus californicus] >gi|338191576|gb|AEI84590.1| mitochondrial aspartate transaminase, partial [Tigriopus californicus])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 289/382 (75.65%), Postives = 328/382 (85.86%), Query Frame = 0
Query:   41 ILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAM 420
            ILGV+E FKKD+NP KMNLGVGAYRDD+GKPF+LPSVR+AE  I    +N EY+ I G+  F +LSA LAFG  +E V+ GR+++ Q ISGTGALR+GA YL+KWFPG KTVYLP+PSWGNHTPIFK  GM V  YRYYDP TCGFDF G  EDI RIPEKSVI+LHACAHNPTGVDPK  QWKE+S L+K+RNL+ FFDMAYQGFASG+VDGDAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DKEEAARV SQIKILIRPMYSNPP++G+R+VSEIL++ TL ++WL DVKGMADRII MR +LK+GL KEGSS NW HI +QIGMFCFTGM PEQV KI  D SVY+TKDGRISVAGISSSNVG+LA+AM
Sbjct:    1 ILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEYAPIGGEPEFGRLSANLAFGQGNEIVSSGRNVSVQTISGTGALRVGATYLAKWFPGNKTVYLPRPSWGNHTPIFKQSGMNVDGYRYYDPTTCGFDFNGAMEDISRIPEKSVIMLHACAHNPTGVDPKDEQWKEMSQLVKKRNLFAFFDMAYQGFASGDVDGDAFAVRQFLEDGHNICLSQSYAKNMGLYGERVGAFTVVCKDKEEAARVNSQIKILIRPMYSNPPVNGSRIVSEILTNTTLNKQWLEDVKGMADRIITMRQELKDGLAKEGSSKNWEHIVDQIGMFCFTGMTPEQVEKITKDFSVYMTKDGRISVAGISSSNVGYLAKAM 382          
BLAST of EMLSAG00000000005 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold380_size190731-snap-gene-0.33 (protein:Tk02437 transcript:maker-scaffold380_size190731-snap-gene-0.33-mRNA-1 annotation:"mitochondrial aspartate transaminase")

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 304/427 (71.19%), Postives = 355/427 (83.14%), Query Frame = 0
Query:    1 MAXPSLRHLSSSIMQRNALGISSVRAGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIFNANMNHEYSTIVGDATFNKLSAELAFGS--EFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            +A P +   S+ +         +VR  SWW+GVEMGPPDAILGV+E FKKD+   KMNLGVGAYRDD G+PF+LPSVR+AE+ + + N+N EY+ I GD  F +L+A LAFG   + V +GR++T Q+ISGTGALRIGAA+LS+WFPG  TVYLPKPSWGNHTPIFKH G+ V  YRYYDP TCGFDF G  EDI+RIPE+S+I+LHACAHNPTGVDP+  QW+E+S +IK R LY FFDMAYQGFASG+VD DAFAVRQFL DGHNICLSQSYAKNMGLYGER+GAF+VVC DK EAARV SQIKILIRPMYSNPP++GAR+V+EIL++P L++ WL DVKGMADRII MR QLK+GL+KEGSS NW HIT+QIGMFCFTGM PEQV KI  + SVYLTKDGRISVAGISSSNV +LA+AMHAVTK
Sbjct:    8 IALPKMNQASALLRASGWTPAQTVRPSSWWSGVEMGPPDAILGVSEAFKKDTQAHKMNLGVGAYRDDNGQPFVLPSVRQAEQLLMSRNLNKEYAPIGGDPEFGRLTANLAFGDGHDIVTQGRNVTVQSISGTGALRIGAAFLSRWFPGSPTVYLPKPSWGNHTPIFKHSGLNVEGYRYYDPKTCGFDFPGAMEDIQRIPERSIIMLHACAHNPTGVDPQDEQWREMSQVIKARKLYAFFDMAYQGFASGDVDTDAFAVRQFLKDGHNICLSQSYAKNMGLYGERVGAFTVVCQDKAEAARVNSQIKILIRPMYSNPPVNGARIVTEILTNPDLKKVWLQDVKGMADRIITMRQQLKDGLKKEGSSRNWEHITDQIGMFCFTGMTPEQVEKITKEFSVYLTKDGRISVAGISSSNVEYLARAMHAVTK 434          
BLAST of EMLSAG00000000005 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold2551_size14539-processed-gene-0.1 (protein:Tk06576 transcript:snap_masked-scaffold2551_size14539-processed-gene-0.1-mRNA-1 annotation:"GOT1p1 partial")

HSP 1 Score: 385.956 bits (990), Expect = 2.052e-132
Identity = 195/407 (47.91%), Postives = 269/407 (66.09%), Query Frame = 0
Query:   28 SWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTV-YLPKPSWGNHTPIFKHCGMEVA-SYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMH-AVTK 425
            S ++ VE  PP  +  ++   + D+ P K+NLGVGAYR  EGKP+ILP V+KAE    + I    +NHEY  I+G  +F K +  +  G  S  + E R    QA+SGTGALR GA +L +    KKTV Y   P+WGNH  IFK+ G   A  YRY+D ++ GF+F+G  ED++  PE +VI+LHACAHNPTG+DP   QW +++ +++ + L+ FFD AYQGFASG++D DA+ VR F+  G  +  SQS++KN GLY ER G  +VV  DK     + SQI +++R MYSNPP HGAR+V  +L DP+L QEW   +K M+ RII+MR  L+E LEK  +   WNHITEQIGMF FTG+ PE    ++ D  VYL K+GR+S+ G++ +N+ +LA+A++ AV K
Sbjct:    2 STFSNVEAAPPIEVFKLSRDCQADTFPTKINLGVGAYRTPEGKPWILPVVKKAEAQLAQDIEAETINHEYLPILGLESFAKAATAMVLGQDSPALKEERAFGCQALSGTGALRNGAEFLFRQL--KKTVFYFSDPTWGNHGLIFKNAGFTDARKYRYWDKDSVGFNFDGMIEDLQNAPEGAVIILHACAHNPTGIDPSQEQWGKIADVMEAKKLFPFFDCAYQGFASGDLDKDAWTVRYFVERGFEMFCSQSFSKNFGLYNERAGNLTVVVKDKSVVENMKSQITLIVRAMYSNPPAHGARIVDLVLKDPSLYQEWCECIKTMSSRIIEMRAGLRERLEKLNTPGKWNHITEQIGMFSFTGLTPEMCEFLVKDKHVYLLKNGRVSMCGVTPTNLDYLAEAINEAVNK 406          
BLAST of EMLSAG00000000005 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold349_size200065-processed-gene-1.12 (protein:Tk10551 transcript:snap_masked-scaffold349_size200065-processed-gene-1.12-mRNA-1 annotation:"aspartate cytoplasmic")

HSP 1 Score: 301.212 bits (770), Expect = 3.258e-99
Identity = 157/404 (38.86%), Postives = 238/404 (58.91%), Query Frame = 0
Query:   26 AGSWWTGVEMGPPDAILGVTELFKKDSNPKKMNLGVGAYRDDEGKPFILPSVRKAEEKIF-NANMNHEYSTIVGDATFNKLSAELAFGSEF--VAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGM-EVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEKEGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVY-LTKDGRISVAGISSSNVGHLAQAMHAVT 424
            A S +  +  G P  ++ +T+ F +D +P K+NL VG YR+++G+     +VR+ E  +  +   +H Y T  GD + N+L+ EL  GS    + E R +  Q+I GT  LR+GA +L +     + +Y   P+W NH  IF   G   V +Y Y++  T   DF+G  + +K  PE +V++LH  AHNPTGVDP   QWKEL  +I+ + L+ FFD AYQGFA+G++D DA++VR F + G  + +SQS+ KNM LYGERIG    +    +    V  +   + R MYS P  HGA +V ++L +P     W S++K M DR+  MR ++++ LEK    HNW  +T Q+GMF ++ + PEQ   +++ H VY L   GRI++ G++  NV  +AQA+ AV 
Sbjct:    2 ASSAFDSLRPGEPIEVVEMTDRFAQDPHPDKINLSVGGYRNEDGEIHCFKAVREVELDMAQDPKWSHGYMTGTGDESINRLAFELLLGSNHTTIREDRCMAMQSIGGTAPLRVGAEFLHRELGFTRALY-SNPTWMNHRDIFVKAGFAHVEAYPYWNKQTECIDFQGWIQTLKEQPENTVVILHTSAHNPTGVDPTQDQWKELCAVIQAQKLFPFFDCAYQGFATGDLDDDAWSVRYFADQGLEMLISQSFGKNMSLYGERIGFLVGIVQKPQSIPIVKDKWLSISRSMYSYPAKHGAWIVGKVLQNPQKLHSWTSELKTMVDRVRGMRARMRDILEKLAPEHNWAGLTAQVGMFYYSKLTPEQGVALMAKHHVYILPSMGRINLGGVTERNVALVAQAIAAVV 404          
BLAST of EMLSAG00000000005 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold390_size186308-snap-gene-0.35 (protein:Tk06352 transcript:maker-scaffold390_size186308-snap-gene-0.35-mRNA-1 annotation:"GOT1Sr")

HSP 1 Score: 277.715 bits (709), Expect = 4.963e-90
Identity = 139/383 (36.29%), Postives = 221/383 (57.70%), Query Frame = 0
Query:   50 KDSNPKKMNLGVGAYRDDEGKPFILPSVRKAE----EKIFNANMNHEYSTIVGDATFNKLSAELAFG--SEFVAEGRHITTQAISGTGALRIGAAYLSKWFPGKKTVYLPKPSWGNHTPIFKHCGMEVASYRYYDPNTCGFDFEGTCEDIKRIPEKSVILLHACAHNPTGVDPKPTQWKELSTLIKERNLYVFFDMAYQGFASGNVDGDAFAVRQFLNDGHNICLSQSYAKNMGLYGERIGAFSVVCNDKEEAARVASQIKILIRPMYSNPPIHGARVVSEILSDPTLRQEWLSDVKGMADRIIKMRHQLKEGLEK-EGSSHNWNHITEQIGMFCFTGMKPEQVAKIISDHSVYLTKDGRISVAGISSSNVGHLAQAMHAVTK 425
            +D +P+K+NL +GAYRD+ G+P +LP V++ E    ++I +   +H+Y    G   F++L+A+LA G  S  + EGR +  Q  + +  +R+G   L +  P    V + KP+W  H PI +  G  V  YRY+DP     D  G  ED++  P  S+++L   AHNPTG+DP P QW  ++ +I+   L  FFD  YQGFASG+ D DA+ +R F   G  + ++QS++KN GLYGER+    ++  DK     + + +      +      +GA++V E+LS P L  EW   +K M DRI KMR +L   LE   G S +W HIT+Q GMF + G+ P+Q   ++ +  VY+   GR ++AG+   ++ ++AQ+++  ++
Sbjct:   24 RDDHPRKVNLLIGAYRDEVGEPVVLPVVKRVEHLLAQRIRDGTDHHDYCPPEGLPGFSRLAAQLALGQDSRALLEGRLVMIQPGANSAGVRVGCEVLKQVLPTTH-VLIGKPTWLTHGPIAEATGFIVGFYRYWDPIHKRLDLAGMLEDLEEAPTGSIVILQPAAHNPTGMDPSPKQWTAIADVIQSNKLLPFFDSCYQGFASGDPDVDAWPLRLFEARGMEMVIAQSFSKNFGLYGERVANLILIVKDKSIIPDLKATLAQANTALTGTGASYGAKIVREVLSKPDLEAEWRGSIKTMTDRIRKMREELCRRLEALSGESGSWEHITQQSGMFSYLGLSPKQSVWLVREKHVYIYHSGRANMAGLPDRDLDYVAQSIYEASQ 405          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000005 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+068.17symbol:GOT2 "Aspartate aminotransferase, mitochond... [more]
-0.000e+067.67symbol:Got2 "Aspartate aminotransferase, mitochond... [more]
-0.000e+067.67symbol:Got2 "glutamic-oxaloacetic transaminase 2, ... [more]
-0.000e+067.98symbol:got-2.2 "Aspartate aminotransferase" specie... [more]
-0.000e+067.42symbol:Got2 "glutamate oxaloacetate transaminase 2... [more]
-0.000e+064.30symbol:got2a "glutamic-oxaloacetic transaminase 2a... [more]
-0.000e+067.67symbol:GOT2 "Aspartate aminotransferase, mitochond... [more]
-0.000e+067.67symbol:GOT2 "Aspartate aminotransferase, mitochond... [more]
-0.000e+067.85symbol:GOT2 "Aspartate aminotransferase, mitochond... [more]
-0.000e+068.35symbol:GOT2 "Aspartate aminotransferase, mitochond... [more]

Pages

back to top
BLAST of EMLSAG00000000005 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 17
Match NameE-valueIdentityDescription
gi|592785874|gb|GAXK01168694.1|0.000e+069.38TSA: Calanus finmarchicus comp332_c0_seq1 transcri... [more]
gi|592776149|gb|GAXK01178419.1|7.325e-12044.81TSA: Calanus finmarchicus comp14230_c1_seq3 transc... [more]
gi|592776150|gb|GAXK01178418.1|1.037e-11945.14TSA: Calanus finmarchicus comp14230_c1_seq2 transc... [more]
gi|592776151|gb|GAXK01178417.1|3.000e-10946.72TSA: Calanus finmarchicus comp14230_c1_seq1 transc... [more]
gi|592894259|gb|GAXK01064116.1|3.498e-10842.08TSA: Calanus finmarchicus comp183121_c0_seq1 trans... [more]
gi|592776156|gb|GAXK01178412.1|2.593e-9447.49TSA: Calanus finmarchicus comp14230_c0_seq2 transc... [more]
gi|592858459|gb|GAXK01099103.1|2.532e-9338.65TSA: Calanus finmarchicus comp238428_c0_seq1 trans... [more]
gi|592776147|gb|GAXK01178421.1|4.100e-7346.33TSA: Calanus finmarchicus comp14230_c1_seq5 transc... [more]
gi|592776155|gb|GAXK01178413.1|2.012e-7247.15TSA: Calanus finmarchicus comp14230_c0_seq3 transc... [more]
gi|592776157|gb|GAXK01178411.1|1.856e-4549.04TSA: Calanus finmarchicus comp14230_c0_seq1 transc... [more]

Pages

back to top
BLAST of EMLSAG00000000005 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000000050.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:1722... [more]
EMLSAP000000062782.652e-12347.00pep:novel supercontig:LSalAtl2s:LSalAtl2s341:71047... [more]
EMLSAP000000014611.353e-8336.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1248:9980... [more]
back to top
BLAST of EMLSAG00000000005 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|75042478|sp|Q5REB0.1|AATM_PONAB0.000e+068.17RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|112987|sp|P00507.2|AATM_RAT0.000e+067.67RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|112984|sp|P05202.1|AATM_MOUSE0.000e+067.42RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|75075926|sp|Q4R559.1|AATM_MACFA0.000e+067.67RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|308153643|sp|P00505.3|AATM_HUMAN0.000e+067.67RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|544584721|sp|P12345.2|AATM_RABIT0.000e+067.85RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|112985|sp|P00506.2|AATM_PIG0.000e+068.35RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|112982|sp|P08907.1|AATM_HORSE0.000e+066.00RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|1168261|sp|P12344.2|AATM_BOVIN0.000e+067.34RecName: Full=Aspartate aminotransferase, mitochon... [more]
gi|123892845|sp|Q28F67.1|AATM_XENTR0.000e+065.51RecName: Full=Aspartate aminotransferase, mitochon... [more]

Pages

back to top
BLAST of EMLSAG00000000005 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EAA14551.40.000e+066.28AGAP009685-PA [Anopheles gambiae str. PEST][more]
gb|EFA03109.1|0.000e+065.54Aspartate aminotransferase, mitochondrial-like Pro... [more]
EFX69044.10.000e+067.18hypothetical protein DAPPUDRAFT_114061 [Daphnia pu... [more]
EEB15916.10.000e+064.16aspartate aminotransferase, putative [Pediculus hu... [more]
AAN10437.10.000e+062.78glutamate oxaloacetate transaminase 2, isoform B [... [more]
AAF51320.10.000e+061.54glutamate oxaloacetate transaminase 2, isoform A [... [more]
XP_396131.30.000e+060.00PREDICTED: aspartate aminotransferase, mitochondri... [more]
gb|EEC12678.1|0.000e+064.84GOT2 aspartate aminotransferase, putative [Ixodes ... [more]
gb|KPM10192.1|0.000e+062.09aspartate aminotransferase, mitochondrial-like pro... [more]
EFX71867.15.892e-13247.28hypothetical protein DAPPUDRAFT_308666 [Daphnia pu... [more]

Pages

back to top
BLAST of EMLSAG00000000005 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|225708774|gb|ACO10233.1|0.000e+089.81Aspartate aminotransferase, mitochondrial precurso... [more]
gi|225709408|gb|ACO10550.1|0.000e+089.76Aspartate aminotransferase, mitochondrial precurso... [more]
gi|961375918|gb|ALS04703.1|0.000e+072.29mitochondrial aspartate aminotransferase precursor... [more]
gi|338191586|gb|AEI84595.1|0.000e+076.23mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191582|gb|AEI84593.1|0.000e+075.97mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191578|gb|AEI84591.1|0.000e+075.71mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191592|gb|AEI84598.1|0.000e+075.45mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191600|gb|AEI84602.1|0.000e+075.19mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191596|gb|AEI84600.1|0.000e+074.68mitochondrial aspartate transaminase, partial [Tig... [more]
gi|338191574|gb|AEI84589.1|0.000e+075.65mitochondrial aspartate transaminase, partial [Tig... [more]

Pages

back to top
BLAST of EMLSAG00000000005 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 4
Match NameE-valueIdentityDescription
maker-scaffold380_size190731-snap-gene-0.330.000e+071.19protein:Tk02437 transcript:maker-scaffold380_size1... [more]
snap_masked-scaffold2551_size14539-processed-gene-0.12.052e-13247.91protein:Tk06576 transcript:snap_masked-scaffold255... [more]
snap_masked-scaffold349_size200065-processed-gene-1.123.258e-9938.86protein:Tk10551 transcript:snap_masked-scaffold349... [more]
maker-scaffold390_size186308-snap-gene-0.354.963e-9036.29protein:Tk06352 transcript:maker-scaffold390_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:17229..19252 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteAspartate aminotransferase, mitochondrial
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1003-augustus-gene-0.18
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000005 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000005EMLSAT00000000005-695852Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:17229..19252-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000005-682771 ID=EMLSAG00000000005-682771|Name=EMLSAG00000000005|organism=Lepeophtheirus salmonis|type=gene|length=2024bp|location=Sequence derived from alignment at LSalAtl2s1003:17229..19252- (Lepeophtheirus salmonis)
ATGGCTAMTCCATCTCTACGACATTTGAGCTCTTCCATAATGCAAAGAAA TGCTCTAGGAATATCTTCTGTTAGGGCTGGGTAAGGAAGTTGATGTAATA TGAATATTTTGGCTACACTTAATTAATAATTATAATTCAAGAAGGAAATA ATTAATTCATAAGGATTTCGTTTTGTATTATCATATTGTTGATTGATAGA TATCAGATATGATATTGAAATGGAAGTGTCGTTTTAAGGTCATGAGCTGA TGAAAGGAGATTTCTTGCCTCCATTTTGATTTTGTATTTGAATTAAAAGG AATCAGATGATTTTCTACTGAATTCTACTTCTCGTTTGTTGGTTTCATTT TTGGGCAAACAGTAATTCGTTTGACATTTAACAGCAATTTATCAAAAGAG AAATAGATCTGAATTTAGTAGATTTCCATATTCAATTTACACATGCTTTT ATAAAAAAATTATGTAACTATTTGTGGTCTGAAACAACCAATGTACAGCT ACGCTTTTAATAAAATATGACATAAATAGAGTAGACTTAATAAGTGTCTA CTAATATTTAGTCCACTTATGAACAAATACAATTATGTCACTATTAGGGA TTCAAATCATTTTTAACAAAAGTCATTTAAAAATTGAAGAAAGGAAGAAA TCGTTTTCACTCCCAATTCCAAGTCAATAATTTTCTTTATTCATCCTAGA TCTTGGTGGACAGGGGTTGAAATGGGCCCACCAGATGCAATTTTAGGAGT CACTGAATTGTTTAAAAAGGATTCAAATCCCAAAAAAATGAATTTGGGCG TGGGAGCTTATCGAGATGATGAAGGAAAGCCCTTTATTCTTCCATCCGTT CGCAAGGCCGAAGAAAAAATATTTAATGCCAATATGAACCATGAATACAG CACAATTGTTGGTGATGCTACATTTAACAAGCTTTCCGCTGAGCTTGCAT TTGGTTCTGAATTTGTCGCTGAGGGACGTCACATTACAACGCAGGCAATT TCTGGTACAGGTGCTCTCAGAATTGGAGCTGCATACCTCTCTAAATGGTT TCCCGGAAAAAAAACAGTGTACTTGCCAAAGCCATCTTGGGGAAATCATA CACCTATTTTTAAACATTGCGGGATGGAAGTAGCCAGTTACAGATACTAT GATCCAAATACATGTGGTTTTGATTTCGAGGGTACATGTGAGGATATTAA GGTAATTGAAATGAATTGCTTTTGTATTGTCTTACTTTCGGACTATTAAT ATTCTTATTATTAGAGAATCCCGGAAAAAAGTGTGATCCTTCTTCATGCA TGTGCCCACAATCCAACCGGTGTAGATCCTAAACCCACCCAATGGAAAGA ACTCTCGACTTTGATTAAAGAAAGGAATTTGTATGTTTTCTTTGATATGG CTTATCAAGGCTTTGCATCAGGAAACGTTGATGGTGACGCATTTGCTGTC AGGCAATTTTTGAATGATGGACATAATATTTGTCTATCACAATCTTATGC CAAAAATATGGGCCTATACGGTGAACGTATAGGAGCCTTTAGTGTGGTTT GTAATGACAAAGAAGAAGCAGCACGAGTAGCATCCCAAATCAAGATCCTA ATTAGACCCATGTATTCTAATCCTCCCATCCACGGAGCAAGAGTAGTGTC TGAAATTCTTTCTGATCCTACTCTAAGACAAGAGTGGTGATTACTAAAAA GAGTTCATAGTTATTCGAATAAATTTTAATTCTGTGGATATTAATTTTAG GTTAAGTGATGTCAAAGGAATGGCTGACAGAATCATCAAAATGAGACATC AACTCAAAGAGGGCTTAGAGAAAGAGGGTTCATCCCACAACTGGAATCAT ATTACAGAACAAATTGGTATGTTTTGTTTTACGGGAATGAAGCCTGAACA AGTAGCAAAAATTATAAGTGACCACAGTGTATATTTGACCAAAGATGGCC GTATTTCTGTTGCTGGTATTTCTTCTTCCAATGTCGGACACTTAGCTCAG GCCATGCATGCAGTTACCAAATAG
back to top
Add to Basket