EMLSAG00000000006, EMLSAG00000000006-682772 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000006
Unique NameEMLSAG00000000006-682772
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:Fit2 "Fermitin 2" species:7227 "Drosophila melanogaster" [GO:0048738 "cardiac muscle tissue development" evidence=IGI] Pfam:PF00169 InterPro:IPR001849 EMBL:AE014296 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 GO:GO:0048738 eggNOG:NOG238024 OrthoDB:EOG7T7GSC GeneTree:ENSGT00390000013444 EMBL:AY061360 RefSeq:NP_648947.1 UniGene:Dm.3625 SMR:Q9VVD2 MINT:MINT-948506 STRING:7227.FBpp0075035 EnsemblMetazoa:FBtr0075275 GeneID:39907 KEGG:dme:Dmel_CG7729 UCSC:CG7729-RA CTD:39907 FlyBase:FBgn0036688 InParanoid:Q9VVD2 OMA:LKRNFAQ GenomeRNAi:39907 NextBio:816036 PRO:PR:Q9VVD2 Uniprot:Q9VVD2)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 352/753 (46.75%), Postives = 501/753 (66.53%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNH-GTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXAN-VPQ---------PSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGM----SDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + SW L + +TDL +EK +RV+GD H+GG+M++LV+  +   DWSDHALWWP RN WL +T+ TLDQ  + AD+ ++FTPMHK +R+QLPDLRY+D  +DYS                     LSLCKPL  +HLK N+     +    +R+ +         + P GT              + L P+       DTN+F+  ST+  G   ST S +  S+            + HR +S   + S   GT K++       + + S+L    E +LA SPP P  + +   +RPK+LVE+AR+NV WLDSSLS+MEQG++++DTL LR+K+++FFDLNPK D VRIN +YEQ KW++LNE +DCTEEE ++FAALQ QV+   +  PQ          S ++ D++D++D+AL +LQI+LEG  +        + +I  IP LSD+LRY++P+RFTL+G+K +YF  ++L L  +KN EDS     + S+NLKGCEV+P+VN+S+ +Y I+L + S DG     S++++RC +E QY+KWMAACRLAAKG+++A +SY+SEV SIL+ L MQ PA    +N    +V+  +Y++ + +RK+  +K   RILEAH+NV++LN +++K+ Y++A++SLPD+GVSLF+++F G +K+ELLGVA NR+MRM+L +GD IKTWRYNT+KAWN+NW  K MMIQ  D +NV+F C SADCKVVHEFIGGYIF+SMR+KD NQ ++EE FHKLTGGW
Sbjct:    6 ENSWNLRIFITDLALEKTMRVRGDQHIGGIMLQLVDPEN-PKDWSDHALWWPARNVWLSRTKLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDSRVDYSVKTFSAVVNLCKQLDIRYPEELSLCKPLEAEHLKRNFAQVPHQ----KRVPI---------AEPDGT--------------TYLQPAA------DTNSFVPISTSFHGEGGSTGSLDKPSAPGSFFCAPLSPHN-HRARSPVRTVSPFPGTWKQSQLGYATYDSSSSSLGDFQE-NLASSPPTPCADVRALQLRPKSLVEKARLNVGWLDSSLSIMEQGIREYDTLCLRFKYFTFFDLNPKCDQVRINQLYEQAKWSVLNEELDCTEEESLMFAALQFQVNHHVDHTPQGAAVDSGIETSSQENDNEDEIDSALKELQITLEGPDYGG-----DSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRDLHLHLFKNAEDSRRVAPAISINLKGCEVTPDVNLSQGKYAIRLEV-SPDGGHGINSEVWVRCENEQQYAKWMAACRLAAKGRSLADSSYESEVDSILSLLQMQRPAHGVHVNIDPRSVEAVDYLSPKIIRKL-SNKAVQRILEAHANVRELNALDSKLKYIQAWRSLPDFGVSLFIIKFDGHRKEELLGVAHNRIMRMDLSSGDHIKTWRYNTMKAWNVNWNIKCMMIQFED-ENVVFSCHSADCKVVHEFIGGYIFMSMRSKDTNQTLNEELFHKLTGGW 714          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:Fit1 "Fermitin 1" species:7227 "Drosophila melanogaster" [GO:0050829 "defense response to Gram-negative bacterium" evidence=IMP] [GO:0048738 "cardiac muscle tissue development" evidence=IGI] Pfam:PF00169 InterPro:IPR001849 GO:GO:0005737 EMBL:AE014296 GO:GO:0050829 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00661 GO:GO:0048738 GO:GO:0007160 GO:GO:0050839 eggNOG:NOG238024 OrthoDB:EOG7T7GSC GeneTree:ENSGT00390000013444 KO:K17083 OMA:MTPTYDS EMBL:AY060853 EMBL:AY118556 RefSeq:NP_647858.2 RefSeq:NP_728936.1 UniGene:Dm.3822 UniGene:Dm.38612 ProteinModelPortal:Q9VZI3 SMR:Q9VZI3 BioGrid:63968 IntAct:Q9VZI3 MINT:MINT-746691 PaxDb:Q9VZI3 PRIDE:Q9VZI3 EnsemblMetazoa:FBtr0073209 EnsemblMetazoa:FBtr0073210 GeneID:38488 KEGG:dme:Dmel_CG14991 CTD:38488 FlyBase:FBgn0035498 InParanoid:Q9VZI3 PhylomeDB:Q9VZI3 GenomeRNAi:38488 NextBio:808900 PRO:PR:Q9VZI3 Bgee:Q9VZI3 Uniprot:Q9VZI3)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 339/749 (45.26%), Postives = 489/749 (65.29%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQP--------SEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSA---DGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + +W L +L+TDLQVEK LRVKGD H+GGVM+ LV+  ++  DWSDHALWWP +N WL +TR TLDQ  + +D+ ++FTPMHK +R+Q+PDLRY+D  +++S                     LS CKPL  +HLK N+    Q   +K  +   N +     +  + +F            T   + S   +DR      +    +   R+ +T      SS         GT          H+ + + +   N SF  L            + +LAMSP  PS + +  L+RPK+ VE+AR+NV WLDSSLS+MEQGV+++DTL LR+K+++FFDLNPK D VRIN +YEQ KW+ILNE ++ TEEE ++FAALQ QV+   ++  P        S ++   +DD+D+AL++LQI+LEG             +I  IP LSD+L++++P+RFTLKG+K ++F  ++L L  YK++++S     + S+NLKGCEV+P+VN+++ ++ I+L +PS       S++++RC +E+QY+KWMAACRLAAKG+++A +SYDSEV SI + L MQ PA    +  +  +V+  +Y++ + +RK+  SK   RILEAH+NV+ L+L++AKM Y++A+QSLPD+GV+LF+++F G KK+ELLGVA+NR+MRM+L TGD IKTWRYNT+KAWN+NW  K MMIQL D +N++F   SADCKVVHEFIGGYIF+SMR+K+ NQ ++EE FHKLTGGW
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQ---RKIPVAEANGIAYVQPALDTNSF---------VPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISS-------PTGTWK--------HNSTGYASYDSNSSFGDL------------QENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGEDDIDSALNELQITLEGPG-----GGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPLTVNPRSVEPMDYLSPKMMRKL-SSKAVQRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQD-ENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGW 707          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:PLEKHC1 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0001725 "stress fiber" evidence=IEA] [GO:0005547 "phosphatidylinositol-3,4,5-trisphosphate binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007179 "transforming growth factor beta receptor signaling pathway" evidence=IEA] [GO:0007229 "integrin-mediated signaling pathway" evidence=IEA] [GO:0016055 "Wnt signaling pathway" evidence=IEA] [GO:0031234 "extrinsic component of cytoplasmic side of plasma membrane" evidence=IEA] [GO:0031941 "filamentous actin" evidence=IEA] [GO:0033622 "integrin activation" evidence=IEA] [GO:0034446 "substrate adhesion-dependent cell spreading" evidence=IEA] [GO:0048041 "focal adhesion assembly" evidence=IEA] [GO:0072657 "protein localization to membrane" evidence=IEA] Pfam:PF00169 InterPro:IPR001849 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR018979 Pfam:PF00373 Pfam:PF09379 SMART:SM00295 SUPFAM:SSF47031 OrthoDB:EOG7T7GSC TreeFam:TF314677 GeneTree:ENSGT00390000013444 EMBL:AADN03004744 Ensembl:ENSGALT00000020309 NextBio:20826042 PRO:PR:E1C0T6 Uniprot:E1C0T6)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 312/729 (42.80%), Postives = 453/729 (62.14%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEG----KKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSE--EDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDV--EEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G   DG+WEL++ VTDL  +  LRV G+ H+GGVM++LV +LD+  DWSDHALWW  +  WL KT WTLD+Y I AD  + FTP HK +R+QLP+++YV   +++S  + K ++     FN    R  E     +K R   K      +       F  +G   + +  + ++  S  +  +  T T+ A+  + L   + T++W G S+                                              L  G+   LA+S P  S E+   + +P+ L+++A++N  WLDSS SLMEQ VK+ + LLLR+K+YSFFDLNPK D +RIN +YEQ KW IL E ++CTEEEMM+FAALQ  ++  + +   +     + D D+VDAALSDL+I+LEG         T+  DI +IP L+D+++  +PK+ TLKG+K ++   K+ ++  YK++E++ N   +  +NL+GCEV+P+VNIS +++ IKL IP A+GM++++LRC +E QY+ WMAACRLA+KGKTMA +SY  EV++IL+FL MQH    P + P  +  D+  E  V+ R+L+K    +L  RILEAH NV  ++LIEAKM +++A+QSLP++G++ F+ RF G KK+EL+G+A NRL+RM+  TGD IKTWR++ +K WN+NWE K + ++  D   V F C   DCKVVHEFIGGYIFLS R KD N+ +DEE F+KLT GW
Sbjct:   33 GCYADGTWELSVHVTDLGRDVTLRVTGEIHIGGVMLRLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFN---IRHPEELSLLRKPRDPSKKKKKKLDDQCDDEAFELEG--PLITPGSGNIYSSPGLYSKTMTPTYDAHDGSPL---SPTSAWFGDSA----------------------------------------------LSEGNPGILAVSQPVTSPESLAKMYKPQALLDKAKINQGWLDSSRSLMEQEVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQSKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSENHLNNSDKDVDEVDAALSDLEITLEGGK-----TSTILGDITSIPELADYIKVFKPKKLTLKGYKPYWCTFKDTSISCYKSKEEA-NGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNERQYASWMAACRLASKGKTMADSSYSMEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQLTARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADDVRVSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGW 701          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:unc-112 species:6239 "Caenorhabditis elegans" [GO:0040011 "locomotion" evidence=IMP] [GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP] [GO:0002119 "nematode larval development" evidence=IMP] [GO:0000003 "reproduction" evidence=IMP] [GO:0040039 "inductive cell migration" evidence=IMP] [GO:0006898 "receptor-mediated endocytosis" evidence=IMP] [GO:0071688 "striated muscle myosin thick filament assembly" evidence=IMP] [GO:0010171 "body morphogenesis" evidence=IMP] [GO:0030163 "protein catabolic process" evidence=IMP] Pfam:PF00169 InterPro:IPR001849 GO:GO:0005886 GO:GO:0031430 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 GO:GO:0005198 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR019747 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00660 GO:GO:0055120 GO:GO:0007517 GO:GO:0040011 GO:GO:0007160 GO:GO:0050839 GO:GO:0030055 EMBL:Z75530 eggNOG:NOG238024 HOGENOM:HOG000231715 GeneTree:ENSGT00390000013444 KO:K17083 EMBL:AF217185 PIR:T20016 RefSeq:NP_506628.1 UniGene:Cel.5462 ProteinModelPortal:Q18685 SMR:Q18685 IntAct:Q18685 STRING:6239.C47E8.7.2 PaxDb:Q18685 EnsemblMetazoa:C47E8.7.1 EnsemblMetazoa:C47E8.7.2 GeneID:179972 KEGG:cel:CELE_C47E8.7 UCSC:C47E8.7.1 CTD:179972 WormBase:C47E8.7 InParanoid:Q18685 OMA:KTWRYNS NextBio:907602 Uniprot:Q18685)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 306/739 (41.41%), Postives = 463/739 (62.65%), Query Frame = 0
Query:   13 LDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYG-DYRQEEGKKRRITLKN-SLNTSNSSSPSGTFR-RKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGS----SSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRF-TLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPA-------------STPVINPSTLNVDVEEYVASRFLRKM-PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            +DG W+L +LVTDL +++ + V G+ +VGG+M++LV+E D+  DWSDHALWWP++ +WL+ TR TLDQ  ITA+T + FTPMHK  RIQLPD++ +D  +D+S++  K  AT  L  + G  Y +E   KR I  ++    TS++ + +G    R G   +  ++    +P            F + S   + R+  + + + S    ++    +L R+GTL    R       + + T+++     P ++ ++       + +L  SP  +      + RP+N VE+A +N  WLDSS SLMEQG+ + D +LLR+KF +FFDLNPK D VRIN +YEQ KW+IL +  D TEEE  LFAALQLQ +L  + P+P   +E++ DDVD  L +L+ +L+  A    +N    +D+  +P L+D+L+YM+PK+    KGFK  +F  ++L L +Y       N       +LKGCEVS +V++ +++Y IKL +P+A+GM D  L+C SE QY++WMAACRLA++GK+MA +SY  EV+SI   L MQ                +  V  P+  NVD  EY++S+++R+   K +++ R+ +AH NV+ L   EAK+ Y++A+Q+LP++G+  F+VRF   +K EL+ VA NRL ++N+  G+ +KTWR+  +K W++NWE +H+ IQ  D +++ FK LSADCKVVHEFIGGYIFLSMR+K+ +Q +DEE FHKLTGGW
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFK--ATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAP-----------IFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLP---RGVSPSPGAYNDTMRRT-PIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEP---EENNKDDVDILLDELEQNLDAAA----LNR--RSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYL-SYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVD--EYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFED-EDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTGGW 719          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:unc-112 "Protein unc-112" species:6239 "Caenorhabditis elegans" [GO:0005198 "structural molecule activity" evidence=IMP] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005886 "plasma membrane" evidence=IEA;IDA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0007160 "cell-matrix adhesion" evidence=IMP;IDA] [GO:0007517 "muscle organ development" evidence=IDA] [GO:0016020 "membrane" evidence=IEA] [GO:0030055 "cell-substrate junction" evidence=IDA] [GO:0031430 "M band" evidence=IDA] [GO:0040011 "locomotion" evidence=IMP] [GO:0050839 "cell adhesion molecule binding" evidence=IDA] [GO:0055120 "striated muscle dense body" evidence=IDA] Pfam:PF00169 InterPro:IPR001849 GO:GO:0005886 GO:GO:0031430 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 GO:GO:0005198 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR019747 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00660 GO:GO:0055120 GO:GO:0007517 GO:GO:0040011 GO:GO:0007160 GO:GO:0050839 GO:GO:0030055 EMBL:Z75530 eggNOG:NOG238024 HOGENOM:HOG000231715 GeneTree:ENSGT00390000013444 KO:K17083 EMBL:AF217185 PIR:T20016 RefSeq:NP_506628.1 UniGene:Cel.5462 ProteinModelPortal:Q18685 SMR:Q18685 IntAct:Q18685 STRING:6239.C47E8.7.2 PaxDb:Q18685 EnsemblMetazoa:C47E8.7.1 EnsemblMetazoa:C47E8.7.2 GeneID:179972 KEGG:cel:CELE_C47E8.7 UCSC:C47E8.7.1 CTD:179972 WormBase:C47E8.7 InParanoid:Q18685 OMA:KTWRYNS NextBio:907602 Uniprot:Q18685)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 306/739 (41.41%), Postives = 463/739 (62.65%), Query Frame = 0
Query:   13 LDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYG-DYRQEEGKKRRITLKN-SLNTSNSSSPSGTFR-RKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGS----SSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRF-TLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPA-------------STPVINPSTLNVDVEEYVASRFLRKM-PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            +DG W+L +LVTDL +++ + V G+ +VGG+M++LV+E D+  DWSDHALWWP++ +WL+ TR TLDQ  ITA+T + FTPMHK  RIQLPD++ +D  +D+S++  K  AT  L  + G  Y +E   KR I  ++    TS++ + +G    R G   +  ++    +P            F + S   + R+  + + + S    ++    +L R+GTL    R       + + T+++     P ++ ++       + +L  SP  +      + RP+N VE+A +N  WLDSS SLMEQG+ + D +LLR+KF +FFDLNPK D VRIN +YEQ KW+IL +  D TEEE  LFAALQLQ +L  + P+P   +E++ DDVD  L +L+ +L+  A    +N    +D+  +P L+D+L+YM+PK+    KGFK  +F  ++L L +Y       N       +LKGCEVS +V++ +++Y IKL +P+A+GM D  L+C SE QY++WMAACRLA++GK+MA +SY  EV+SI   L MQ                +  V  P+  NVD  EY++S+++R+   K +++ R+ +AH NV+ L   EAK+ Y++A+Q+LP++G+  F+VRF   +K EL+ VA NRL ++N+  G+ +KTWR+  +K W++NWE +H+ IQ  D +++ FK LSADCKVVHEFIGGYIFLSMR+K+ +Q +DEE FHKLTGGW
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFK--ATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAP-----------IFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLP---RGVSPSPGAYNDTMRRT-PIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEP---EENNKDDVDILLDELEQNLDAAA----LNR--RSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYL-SYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVD--EYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFED-EDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTGGW 719          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:fermt2 "fermitin family homolog 2 (Drosophila)" species:7955 "Danio rerio" [GO:0001525 "angiogenesis" evidence=IMP] [GO:0055008 "cardiac muscle tissue morphogenesis" evidence=IMP] [GO:0007010 "cytoskeleton organization" evidence=IMP] [GO:0014704 "intercalated disc" evidence=IMP] [GO:0016055 "Wnt signaling pathway" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA] [GO:0008360 "regulation of cell shape" evidence=IEA] [GO:0030054 "cell junction" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0042995 "cell projection" evidence=IEA] [GO:0005856 "cytoskeleton" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0031674 "I band" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0005938 "cell cortex" evidence=IEA] [GO:0031258 "lamellipodium membrane" evidence=IEA] Pfam:PF00169 InterPro:IPR001849 ZFIN:ZDB-GENE-050506-132 GO:GO:0005938 GO:GO:0005634 GO:GO:0014704 GO:GO:0007010 GO:GO:0009986 GO:GO:0016055 GO:GO:0005856 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR018979 Pfam:PF00373 Pfam:PF09379 SMART:SM00295 SUPFAM:SSF47031 GO:GO:0008360 GO:GO:0007155 GO:GO:0001525 GO:GO:0005925 GO:GO:0008289 GO:GO:0031674 GO:GO:0055008 GO:GO:0031258 OrthoDB:EOG7T7GSC TreeFam:TF314677 GeneTree:ENSGT00390000013444 EMBL:AL928709 EMBL:BC091937 RefSeq:NP_001243144.1 UniGene:Dr.83795 STRING:7955.ENSDARP00000049463 PRIDE:F1Q8X5 Ensembl:ENSDART00000049464 Ensembl:ENSDART00000085996 GeneID:553051 KEGG:dre:553051 CTD:10979 KO:K17083 OMA:MTPTYDS NextBio:20879937 Uniprot:F1Q8X5)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 305/733 (41.61%), Postives = 455/733 (62.07%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP---PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEED--EDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTP-VINPSTLNVDVEEYVASRFLRKMPKSK-------LRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G   DG+WEL + VTDL  +  LRV G+ H+GGVM+KLV +LD+  DWSDHALWW  +  WL KT WTLD+Y I AD  + FTP HK +R+QLP+++++   +++S  + K ++     FN   + +E    R+             +   T   +G   + +  +  +  S  +  +  T T+ +   + L   + T++W G S                                      PL  GN S         LA+S P   P +  K  + +P++L+++A++N  WLDSS SLMEQ VK+ + LLLR+K++SFFDLNPK D +R+N +YEQ KW IL E ++CTEEEMM+FAALQ  ++  + +   +  +  E + D+VDAALSDL+I+LEG    + +      DI +IP L+D+++  +PK+ TLKG+K ++   K++ +  YK+ E+++    +  +NL+GCEV+P+VNIS +++ IKL IP ADGM++++LRC +E QY++WMAACRLA+KGKTMA +SY+ EV++IL+FL MQH    P +I P T +++ E  V+ R+L+K    +       +  RILEAH NV  ++LIEAKM +++A+QSLP++G++ F+ +F G KKDEL+G+  NRL+RM+  TGD IKTWR++ +K WN+NWE K + ++  D  ++ F C   DCKVVHEFIGGYIFLS R KD N+ +DEE F+KLT GW
Sbjct:   11 GCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNI-RHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGP--LLTPGSGSIYSSPGLYSKTMTPTYDSRDGSPL---SPTSAWFGDS--------------------------------------PLSEGNPS--------ILAVSQPITSPDILVK--MYKPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTL-----GDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHG-TPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHMNPDPQIIEPITTDINPECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGW 683          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:FERMT1 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0005829 "cytosol" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0031941 "filamentous actin" evidence=IEA] [GO:0043616 "keratinocyte proliferation" evidence=IEA] [GO:0051546 "keratinocyte migration" evidence=IEA] [GO:0090162 "establishment of epithelial cell polarity" evidence=IEA] Pfam:PF00169 InterPro:IPR001849 GO:GO:0005829 GO:GO:0043616 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR019747 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00660 GO:GO:0007155 GO:GO:0005925 GO:GO:0031941 GO:GO:0090162 CTD:55612 KO:K17082 OrthoDB:EOG7T7GSC TreeFam:TF314677 GO:GO:0051546 GeneTree:ENSGT00390000013444 EMBL:AADN03003520 RefSeq:XP_004935305.1 RefSeq:XP_415024.2 Ensembl:ENSGALT00000014344 GeneID:416727 KEGG:gga:416727 Uniprot:F1NPF7)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 306/755 (40.53%), Postives = 450/755 (59.60%), Query Frame = 0
Query:    5 YSSNTGVRLDGSWELTLLVTDLQVEK-----ILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLR-------YVDCVMDYSLSLCKPL---ATDHLKFNYGDYRQEEGKKR----------RITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTF--IANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMS-PPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSE-EDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTP--VINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            Y SNT       W L L+  D Q EK      LRV GD H+GGVM+KLV +++++ DWSD+ALWW  +  WL KT WTLD+  + AD  + FTP HK +R++LP+++       +   V      +CK L    ++ L       +Q E   R           +  ++ LN SNS + SG                 LS S  +  +  T T+  I+ + A+     ST +W                                       S SPL   N S         LA S P  S E    + +P+ L ++A++N  WLDSS SLMEQG+ + D LLLR+K+Y+FFDLNPK D VRIN IYEQ +W IL E +DCTEEEM++FAALQ  +S  ++  +  +  +E + D+V+AALS+L+++LEG    + +      DI  IP L+D+LR +RP+R +++  K ++FV K+ ++  +KN+E          +NLKGCEV P+VN++ K++GIKL IP A GM+++YLRC +E+QY++WMAA  LA+KGKTMA +SY  EV  IL+FL M++   +P    +P ++++  E +V+ R+++K    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G+S ++VRF G KK+++LGV+ NRL+R+++ TGDPI TWR++T+K WN+NWE + + I+     +V F CLSADCK++HE IGGYIFLS R+KD ++ +DEE FHKLTGG
Sbjct:    7 YESNT-------WAL-LVTVDHQYEKEQKEFTLRVTGDLHIGGVMLKLVEQIEVSQDWSDYALWWEQKKCWLLKTHWTLDKCGVQADAKLLFTPQHKMLRLRLPNMKTVRLKVSFSSVVFKAVSDICKILNIRRSEELSL----LKQSEDILRKKKRKDKNVKEVVTEDILNLSNSPTSSG-----------------LSASPGLYSKTMTPTYDPISGTPAS-----STITW--------------------------------------FSDSPLTEQNCS--------ILAFSHPNCSPETLAEMYQPRTLADKAKLNAGWLDSSRSLMEQGILEDDQLLLRFKYYTFFDLNPKYDAVRINQIYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSSSSETQDFTNESEVDEVEAALSNLEVTLEGGKSSNILE-----DITDIPKLADYLRLVRPRRLSMRTAKPYWFVFKDTSISYFKNKESGQGEPIE-KLNLKGCEVVPDVNVAAKKFGIKLLIPVAAGMNEVYLRCDNENQYARWMAASVLASKGKTMADSSYHPEVHKILSFLKMKNWTMSPQTASDPESIDMKPECFVSLRYVKKYKSKQLAARILEAHQNVSQMPLVEAKLRFIQAWQSLPEFGLSYYIVRFKGSKKEDVLGVSYNRLIRIDIATGDPITTWRFSTMKQWNVNWEIRQVGIEFDQNVSVAFTCLSADCKIIHEHIGGYIFLSTRSKDHSESLDEELFHKLTGG 675          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:FERMT1 "Fermitin family homolog 1" species:9601 "Pongo abelii" [GO:0005829 "cytosol" evidence=ISS] [GO:0007155 "cell adhesion" evidence=ISS] [GO:0030054 "cell junction" evidence=ISS] [GO:0043616 "keratinocyte proliferation" evidence=ISS] [GO:0051546 "keratinocyte migration" evidence=ISS] [GO:0090162 "establishment of epithelial cell polarity" evidence=ISS] Pfam:PF00169 InterPro:IPR001849 GO:GO:0005829 GO:GO:0043616 GO:GO:0005856 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 Pfam:PF00373 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00661 GO:GO:0030054 GO:GO:0007155 GO:GO:0005925 GO:GO:0032587 GO:GO:0090162 CTD:55612 HOVERGEN:HBG020688 KO:K17082 GO:GO:0051546 EMBL:CR859726 RefSeq:NP_001128976.1 UniGene:Pab.19731 ProteinModelPortal:Q5R8M5 SMR:Q5R8M5 GeneID:100190816 KEGG:pon:100190816 InParanoid:Q5R8M5 Uniprot:Q5R8M5)

HSP 1 Score: 476.478 bits (1225), Expect = 2.236e-156
Identity = 231/480 (48.12%), Postives = 333/480 (69.38%), Query Frame = 0
Query:  252 SPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVS-LXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQH--PASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            SPL   N S L           PP S EA   + +P++LV++A++N  WLDSS SLMEQG+++   LLLR+K+YSFFDLNPK D VRIN +YEQ +W IL E +DCTEEEM++FAALQ  +S L  +        E + D+++AALS+L+++LEG    S +      DI  IP L+D+L+  RPK+  LK FK ++FV K+ ++  +KN+E          +NL+GCEV P VN++ +++GIKL IP ADGM+++YLRC  E+QY++WMAAC LA+KGKTMA +SY  EV +IL+FL M++   AS    +P  ++++ E +V+ R  +K    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGV+ NRL++++  TG P+ TWR+  IK WN++WET+ ++I+        F CLSADCK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  209 SPLTEQNCSILAFSQ-------PPQSSEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDGQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKADSLLE-----DITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSIAYFKNKELEQGEPLE-KLNLRGCEVVPNVNVAERKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSSYRPEVLNILSFLRMKNRNSASQVASSPENMDMNPECFVSPRCAKKHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVSWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 109.768 bits (273), Expect = 1.635e-23
Identity = 51/113 (45.13%), Postives = 75/113 (66.37%), Query Frame = 0
Query:   15 GSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
             SWEL + V     + Q +  LRV GD HVGGVM++LV +++I+ DWSD ALWW  ++ WL KT WTLD+Y + AD  + FTP HK +R++LP+L+ V   + +S  + K ++
Sbjct:   10 ASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLQLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVS 122          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:Fermt1 "fermitin family member 1" species:10116 "Rattus norvegicus" [GO:0003674 "molecular_function" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0005829 "cytosol" evidence=IEA;ISO] [GO:0005925 "focal adhesion" evidence=IEA;ISO] [GO:0007155 "cell adhesion" evidence=IEA;ISO] [GO:0008150 "biological_process" evidence=ND] [GO:0030054 "cell junction" evidence=ISO] [GO:0031941 "filamentous actin" evidence=IEA;ISO] [GO:0043616 "keratinocyte proliferation" evidence=IEA;ISO] [GO:0051546 "keratinocyte migration" evidence=IEA;ISO] [GO:0090162 "establishment of epithelial cell polarity" evidence=IEA;ISO] Pfam:PF00169 InterPro:IPR001849 RGD:1306816 GO:GO:0005829 GO:GO:0043616 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR018979 Pfam:PF00373 Pfam:PF09379 SMART:SM00295 SUPFAM:SSF47031 GO:GO:0007155 GO:GO:0005925 GO:GO:0031941 GO:GO:0090162 EMBL:CH473949 CTD:55612 KO:K17082 OMA:VSPRCAK OrthoDB:EOG7T7GSC TreeFam:TF314677 GO:GO:0051546 GeneTree:ENSGT00390000013444 EMBL:AABR06026263 EMBL:AABR06026264 RefSeq:NP_001099985.1 RefSeq:XP_006235138.1 UniGene:Rn.230025 Ensembl:ENSRNOT00000028901 GeneID:296179 KEGG:rno:296179 UCSC:RGD:1306816 NextBio:640746 PRO:PR:D3ZTV0 Uniprot:D3ZTV0)

HSP 1 Score: 474.937 bits (1221), Expect = 1.070e-155
Identity = 229/482 (47.51%), Postives = 336/482 (69.71%), Query Frame = 0
Query:  252 SPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVS---LXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPS--TLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            SPL   N S L           PPPS E    + +P++LV++A+MN  WLDSS SLMEQ +++ + LLLR+K+Y+FFDLNPK D VRIN +YEQ +W +L E +DCTEEEM++FAALQ  +S   L A +   + + E D+  V+AALS L+++LEG    + +      DI  IP L+D+L+  +PK+  LK FK ++FV K+ ++  +KN+E          +N++GCE+ P+VN++ +++GIKL IP ADGM+++YLRC  EDQY++WMAAC LA+KGKTMA +SY  EV SIL+FL M++  S+P++  S  +++++ E  V+ R  +K    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGV+ NRL+RM+  TG P+ TWR+  +K WN+NWE + + I+     ++ F CLSA CK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  209 SPLTEQNCSVLAFSQ-------PPPSPEVLAEMFQPRSLVDKAKMNAGWLDSSRSLMEQSIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQYHISKLSLCAEIQDFATKSEVDE--VEAALSSLEVTLEGGKADNTLE-----DITDIPKLADYLKLFKPKKLMLKAFKQYWFVFKDTSIAYFKNQELEQGEPIE-KLNIRGCEIVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVVSILSFLKMKNRNSSPLVASSLESMDMNPECLVSPRCAKKHKSKQLAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRMDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFTCLSAGCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 108.612 bits (270), Expect = 3.713e-23
Identity = 53/120 (44.17%), Postives = 75/120 (62.50%), Query Frame = 0
Query:    8 NTGVRLDGSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
            ++G     SWEL + V     + Q +  LRV GD H+GGVM+KLV +++IA DWSD ALWW  +  WL KT WTLD+  + AD  + FTP HK +R++LP+ R V   + +S  + K +A
Sbjct:    3 SSGDFTSASWELVVRVDHANEEQQTDITLRVSGDLHIGGVMLKLVEQMNIAQDWSDFALWWEQKRCWLLKTHWTLDKCGVQADAKLLFTPQHKMLRLRLPNTRTVRLRVSFSAVVFKAVA 122          
BLAST of EMLSAG00000000006 vs. GO
Match: - (symbol:FERMT1 "Fermitin family homolog 1" species:9606 "Homo sapiens" [GO:0005829 "cytosol" evidence=IDA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IDA] [GO:0030054 "cell junction" evidence=IDA] [GO:0031941 "filamentous actin" evidence=IEA] [GO:0032587 "ruffle membrane" evidence=IEA] [GO:0043616 "keratinocyte proliferation" evidence=IDA] [GO:0051546 "keratinocyte migration" evidence=IDA] [GO:0090162 "establishment of epithelial cell polarity" evidence=IDA] InterPro:IPR001849 GO:GO:0005829 GO:GO:0043616 Gene3D:2.30.29.30 InterPro:IPR011993 SMART:SM00233 PROSITE:PS50003 Gene3D:1.20.80.10 InterPro:IPR019749 InterPro:IPR014352 InterPro:IPR019748 InterPro:IPR018979 Pfam:PF00373 Pfam:PF09379 SMART:SM00295 SUPFAM:SSF47031 PROSITE:PS00661 GO:GO:0030054 GO:GO:0007155 GO:GO:0005925 EMBL:CH471133 GO:GO:0031941 GO:GO:0032587 GO:GO:0090162 EMBL:AF443278 EMBL:AY137240 EMBL:AK000123 EMBL:AK000747 EMBL:AK092195 EMBL:AL118505 EMBL:BC035882 RefSeq:NP_060141.3 UniGene:Hs.472054 ProteinModelPortal:Q9BQL6 SMR:Q9BQL6 BioGrid:120752 IntAct:Q9BQL6 MINT:MINT-4538047 STRING:9606.ENSP00000217289 PhosphoSite:Q9BQL6 DMDM:26392456 PaxDb:Q9BQL6 PRIDE:Q9BQL6 Ensembl:ENST00000217289 GeneID:55612 KEGG:hsa:55612 UCSC:uc002wmq.3 UCSC:uc002wmr.3 UCSC:uc002wms.3 CTD:55612 GeneCards:GC20M006055 H-InvDB:HIX0015632 HGNC:HGNC:15889 HPA:HPA039778 HPA:HPA041966 MIM:173650 MIM:607900 neXtProt:NX_Q9BQL6 Orphanet:2907 Orphanet:2908 PharmGKB:PA162388314 eggNOG:NOG238024 HOGENOM:HOG000231715 HOVERGEN:HBG020688 InParanoid:Q9BQL6 KO:K17082 OMA:VSPRCAK OrthoDB:EOG7T7GSC PhylomeDB:Q9BQL6 TreeFam:TF314677 GeneWiki:C20orf42 GenomeRNAi:55612 NextBio:60184 PRO:PR:Q9BQL6 ArrayExpress:Q9BQL6 Bgee:Q9BQL6 CleanEx:HS_FERMT1 Genevestigator:Q9BQL6 GO:GO:0051546 Uniprot:Q9BQL6)

HSP 1 Score: 474.552 bits (1220), Expect = 1.575e-155
Identity = 230/475 (48.42%), Postives = 335/475 (70.53%), Query Frame = 0
Query:  258 NDSNLKSGSEWSLAMSPPP-SVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVS-LXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDV--EEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            +DS L   +   LA S PP S EA   + +P++LV++A++N  WLDSS SLMEQG+++ + LLLR+K+YSFFDLNPK D VRIN +YEQ +W IL E +DCTEEEM++FAALQ  +S L  +        E + D+++AALS+L+++LEG    S +      DI  IP L+D+L+  RPK+   K FK ++F+ K+ ++  +KN+E          +NL+GCEV P+VN++ +++GIKL IP ADGM+++YLRC  E+QY++WMAAC LA+KGKTMA +SY  EV +IL+FL M++  S   +  S  N+D+  E +V+ R  ++    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGV+ NRL++++  TG P+ TWR+  IK WN+NWET+ ++I+        F CLSADCK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  207 SDSPLTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKADSLLE-----DITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLE-KLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 110.923 bits (276), Expect = 6.486e-24
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = 0
Query:   15 GSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
             SWEL + V     + Q +  LRV GD HVGGVM+KLV +++I+ DWSD ALWW  ++ WL KT WTLD+Y + AD  + FTP HK +R++LP+L+ V   + +S  + K ++
Sbjct:   10 ASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVS 122          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592929146|gb|GAXK01029399.1| (TSA: Calanus finmarchicus comp150873_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 429/740 (57.97%), Postives = 537/740 (72.57%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKXXXXXXXXXXXXGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKS-GSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANXXXXXXXXXXXXXXXXXXXXXXXISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDS--YNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSWEL LLVTDLQVE+ LRV+G+ H+GGVMIKLV+ LDIAMDWSDHA+WWP +N WL  TRWTLDQYNITAD  +YFTPMHK +RIQLPDLR+ DC +D+S                     LS CKPL +DHLKFNYG  ++ E + RR+TL                           +   ++P      R DTNTFIANS  TL RK++ +S                           H + + G +         +     N KS GS+WSLAMSPPP+ EAK +++RPK+LVE+ARMNVAWLDSSLS+MEQG+ +FDT+LLRYK+++F+DLNPK D VRINLIYEQ KW ILNE +DCTEEEM+LFA+LQLQV L ANVPQP ++ EDD +     L    ISL+G     + N+    DI  IP L+ +L+Y++PKRFTLKG+K  YFV K+L L ++KN EDS  Y+   +FS+ LKGCEV P+VNI + RYGIKL++PS+DGMSDL+LRC SE QY++WMAACRLAAKGK +A   +D EV +I AFLSMQHPA +P INPSTL++ VE+Y+A RF+++  KSK+R RILEAH+NVKDLNLIEAKMN++KA+QSLP++GVSLFVV+FHGE+K+EL+G+A NRLMRM L +G+ I TWRYNT+KAWN+NWET HMMIQLG+G+NVIF+C+SA+CKVVHEFIGGYIFLSMR+KD++QI++EE FHKLTGGW
Sbjct:   88 DGSWELRLLVTDLQVERTLRVQGEDHIGGVMIKLVDILDIAMDWSDHAVWWPLKNIWLNNTRWTLDQYNITADEMLYFTPMHKTLRIQLPDLRFTDCQVDFSIKAFNAVVHLCKELGIRHPEELSFCKPLDSDHLKFNYGSLQKAE-RSRRVTL---------------------------AAMPVTPG-----RHDTNTFIANS-ETLRRKSTNSS-------------------------PMHKKHSRGDIT--------IGTPKLNTKSYGSDWSLAMSPPPTEEAKETIVRPKSLVEKARMNVAWLDSSLSIMEQGINEFDTILLRYKYFAFYDLNPKEDPVRINLIYEQAKWQILNEEIDCTEEEMLLFASLQLQVGLQANVPQPLDDTEDDIESALNELQ---ISLDG----GYANKA--EDITQIPQLTGYLKYIKPKRFTLKGYKTSYFVCKDLQLSSWKNSEDSGDYSQEPNFSICLKGCEVLPDVNIHQGRYGIKLSVPSSDGMSDLWLRCESESQYAQWMAACRLAAKGKNLADYGFDQEVSAIKAFLSMQHPAHSPAINPSTLDIQVEDYIAPRFVKR--KSKVRQRILEAHANVKDLNLIEAKMNFIKAWQSLPEFGVSLFVVKFHGERKEELVGIAYNRLMRMVLLSGEHITTWRYNTVKAWNVNWETGHMMIQLGNGENVIFQCISAECKVVHEFIGGYIFLSMRSKDSSQILNEELFHKLTGGW 2073          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592947235|gb|GAXK01011318.1| (TSA: Calanus finmarchicus comp22292_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 415/747 (55.56%), Postives = 528/747 (70.68%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKXXXXXXXXXXXXGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGS-SSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGND--------SNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANXXXXXXXXXXXXXXXXXXXXXXXISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYN-YHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSW+LT+ VTDLQVE+ LRV+GD H+GGVMIKLV+ LDIAMDWSDHA+WWP+RNKWL+KTRWTLDQYN+ ADT ++FTPMHK +RIQLPDLRYVDC +D+S                     LSLCKPL  +HL+ NY    QE   +RR                    ++GN                  DR DTNTF+++              NG+ +S++  +  R  T  +H         S  GTL  NG++SP  NG+             +  E SLAMSPP + EAK +L++PK+L +RARMNV WLDSSLS+MEQGV++FDTL LRYK+YSF+DLN K D  RIN I+EQ +W ILNE +DCTEEEMMLFAALQLQV++ AN       D+D+ DDVD  L  LQ+SLEG             D+   P ++D+L+Y +PKRFTLK +K  YFV K L L+AYKN + S++     FSV+LKGCEV+P +N++  ++ +KL +PSA+GM+++YL+  S+ QY++W+AACRLAAKGKT+A +S+D+EV SI AFLSMQ PAS P INP+T+ +  E+YVA RF RK+ KSKLR +ILE+H+NVKDLNL+EAKMN+++A+QSLP+YGVSLFVVRFHGEKKDELLGV SNR+MRM+LQ GD IKTWRY+T+KAWN+NWET+HMMIQ  D KNVIF+CLSADCKV+HEFIGGYIFLSMR+K++NQ +++E FHKLTGGW
Sbjct:  736 DGSWQLTVFVTDLQVERNLRVRGDLHIGGVMIKLVDSLDIAMDWSDHAIWWPNRNKWLDKTRWTLDQYNVNADTVIHFTPMHKTLRIQLPDLRYVDCTVDFSVKTFNASVVMAKDLGLRHPEELSLCKPLDPEHLRQNY----QEVMMRRRPPPPT---------------KEGN----------------TGDRLDTNTFVSH--------------NGTLNSKSPHATLRTPTKGHH---------SPQGTLNGNGNYSPYSNGHTYVSGRPQTPQGPTLDEMSLAMSPPATPEAKTTLLKPKSLEQRARMNVGWLDSSLSIMEQGVREFDTLCLRYKYYSFYDLNSKYDSNRINQIFEQARWQILNEEVDCTEEEMMLFAALQLQVAMQAN-VPQPNNDDDEGDDVDEELKKLQMSLEGGT-----GGGGWGDVTEDPSIADYLQYFKPKRFTLKSYKRLYFVCKNLYLLAYKNADASHSGGDLLFSVHLKGCEVTPAINLTANKFELKLEVPSAEGMTEMYLKFNSDQQYAEWLAACRLAAKGKTLADSSFDAEVNSIKAFLSMQSPASAPAINPNTVEIVAEDYVAPRFARKI-KSKLRQKILESHANVKDLNLLEAKMNFIRAWQSLPEYGVSLFVVRFHGEKKDELLGVGSNRVMRMSLQNGDHIKTWRYSTMKAWNVNWETRHMMIQFEDDKNVIFQCLSADCKVIHEFIGGYIFLSMRSKESNQQLNQELFHKLTGGW 2781          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592906502|gb|GAXK01051873.1| (TSA: Calanus finmarchicus comp28518_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 63.1586 bits (152), Expect = 3.384e-9
Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:  276 PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYK-FYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSL 374
            P ++AK + +R KNL       V W+D S +L EQGV + + LLLR K FYS  +++ + D V++NL+YEQ K  IL        E  + FAALQ+Q+  
Sbjct: 8602 PQIDAKMATLR-KNL--HTEDGVNWVDHSKTLREQGVDEAEILLLRRKYFYSDANVDAR-DPVQLNLLYEQAKEAILEGTHPVPLETAIQFAALQVQIQF 8889          

HSP 2 Score: 58.9214 bits (141), Expect = 6.061e-8
Identity = 33/150 (22.00%), Postives = 78/150 (52.00%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDEL----LGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNK 711
             D++E++   F++      +  +I   H ++   + I++K  Y+K  + LP +GV  F+V+   + +++L    LGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + +   IGGYI + ++ +
Sbjct: 8128 ADLKEFLPLGFMKV---RNVEKKIFGEHKSLMGTSEIDSKYKYVKLARGLPTFGVHFFLVKEKQKGRNKLVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQIAALIGGYIDIILKRR 8562          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592906503|gb|GAXK01051872.1| (TSA: Calanus finmarchicus comp28518_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 63.1586 bits (152), Expect = 3.385e-9
Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:  276 PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYK-FYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSL 374
            P ++AK + +R KNL       V W+D S +L EQGV + + LLLR K FYS  +++ + D V++NL+YEQ K  IL        E  + FAALQ+Q+  
Sbjct: 8635 PQIDAKMATLR-KNL--HTEDGVNWVDHSKTLREQGVDEAEILLLRRKYFYSDANVDAR-DPVQLNLLYEQAKEAILEGTHPVPLETAIQFAALQVQIQF 8922          

HSP 2 Score: 58.9214 bits (141), Expect = 6.063e-8
Identity = 33/150 (22.00%), Postives = 78/150 (52.00%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDEL----LGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNK 711
             D++E++   F++      +  +I   H ++   + I++K  Y+K  + LP +GV  F+V+   + +++L    LGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + +   IGGYI + ++ +
Sbjct: 8161 ADLKEFLPLGFMKV---RNVEKKIFGEHKSLMGTSEIDSKYKYVKLARGLPTFGVHFFLVKEKQKGRNKLVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQIAALIGGYIDIILKRR 8595          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592906504|gb|GAXK01051871.1| (TSA: Calanus finmarchicus comp28518_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 63.1586 bits (152), Expect = 3.392e-9
Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:  276 PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYK-FYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSL 374
            P ++AK + +R KNL       V W+D S +L EQGV + + LLLR K FYS  +++ + D V++NL+YEQ K  IL        E  + FAALQ+Q+  
Sbjct: 8602 PQIDAKMATLR-KNL--HTEDGVNWVDHSKTLREQGVDEAEILLLRRKYFYSDANVDAR-DPVQLNLLYEQAKEAILEGTHPVPLETAIQFAALQVQIQF 8889          

HSP 2 Score: 58.9214 bits (141), Expect = 6.075e-8
Identity = 33/150 (22.00%), Postives = 78/150 (52.00%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDEL----LGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNK 711
             D++E++   F++      +  +I   H ++   + I++K  Y+K  + LP +GV  F+V+   + +++L    LGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + +   IGGYI + ++ +
Sbjct: 8128 ADLKEFLPLGFMKV---RNVEKKIFGEHKSLMGTSEIDSKYKYVKLARGLPTFGVHFFLVKEKQKGRNKLVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQIAALIGGYIDIILKRR 8562          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592906505|gb|GAXK01051870.1| (TSA: Calanus finmarchicus comp28518_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 63.1586 bits (152), Expect = 3.393e-9
Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:  276 PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYK-FYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSL 374
            P ++AK + +R KNL       V W+D S +L EQGV + + LLLR K FYS  +++ + D V++NL+YEQ K  IL        E  + FAALQ+Q+  
Sbjct: 8635 PQIDAKMATLR-KNL--HTEDGVNWVDHSKTLREQGVDEAEILLLRRKYFYSDANVDAR-DPVQLNLLYEQAKEAILEGTHPVPLETAIQFAALQVQIQF 8922          

HSP 2 Score: 58.9214 bits (141), Expect = 6.076e-8
Identity = 33/150 (22.00%), Postives = 78/150 (52.00%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDEL----LGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNK 711
             D++E++   F++      +  +I   H ++   + I++K  Y+K  + LP +GV  F+V+   + +++L    LGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + +   IGGYI + ++ +
Sbjct: 8161 ADLKEFLPLGFMKV---RNVEKKIFGEHKSLMGTSEIDSKYKYVKLARGLPTFGVHFFLVKEKQKGRNKLVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQIAALIGGYIDIILKRR 8595          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592943246|gb|GAXK01015307.1| (TSA: Calanus finmarchicus comp631113_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 55.0694 bits (131), Expect = 8.301e-7
Identity = 38/155 (24.52%), Postives = 77/155 (49.68%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDE----LLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRN-KDANQ 715
            ++++ ++   F  K   S    +IL  H N+   + I+AK  Y+K  +SL  +GV  F+VR   + +      LLG+  + ++R++  T + ++T+    +K W  +  +K   +  G  K   F   +++ + + + + GY+ + M N K A Q
Sbjct: 6913 INIKSFLPEGF--KGKASSAEKKILAEHKNLIGTSEIDAKFRYVKLARSLSTFGVHFFLVREPQKGRSRMIPLLLGITKDSILRLDYDTKETMETFPLTHVKRWAAS--SKIFSVDFGSHKEKNFSVQTSEGEKISDLVDGYVKIIMENSKKAKQ 7365          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592943247|gb|GAXK01015306.1| (TSA: Calanus finmarchicus comp631113_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 55.0694 bits (131), Expect = 8.317e-7
Identity = 38/155 (24.52%), Postives = 77/155 (49.68%), Query Frame = 0
Query:  566 VDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDE----LLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRN-KDANQ 715
            ++++ ++   F  K   S    +IL  H N+   + I+AK  Y+K  +SL  +GV  F+VR   + +      LLG+  + ++R++  T + ++T+    +K W  +  +K   +  G  K   F   +++ + + + + GY+ + M N K A Q
Sbjct: 7061 INIKSFLPEGF--KGKASSAEKKILAEHKNLIGTSEIDAKFRYVKLARSLSTFGVHFFLVREPQKGRSRMIPLLLGITKDSILRLDYDTKETMETFPLTHVKRWAAS--SKIFSVDFGSHKEKNFSVQTSEGEKISDLVDGYVKIIMENSKKAKQ 7513          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592943242|gb|GAXK01015311.1| (TSA: Calanus finmarchicus comp631113_c0_seq6 transcribed RNA sequence)

HSP 1 Score: 44.669 bits (104), Expect = 6.782e-4
Identity = 29/87 (33.33%), Postives = 46/87 (52.87%), Query Frame = 0
Query:  281 KYSLIRPKNLVERARMN---------------VAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNP-KMDGVRINLIYEQLKWTIL 351
            +YSL   K+    A++N               V WLD   +L EQG  + + L++R KF+ + D+N  K D +++N++YEQ K  IL
Sbjct:   42 EYSLASTKDAAHDAQINKKMETIKAKLHTEDEVNWLDQHKTLREQGATEAEPLIMRRKFF-YTDVNVNKDDPIQLNMLYEQSKHAIL 299          
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Match: gi|592943243|gb|GAXK01015310.1| (TSA: Calanus finmarchicus comp631113_c0_seq5 transcribed RNA sequence)

HSP 1 Score: 44.2838 bits (103), Expect = 8.628e-4
Identity = 29/87 (33.33%), Postives = 46/87 (52.87%), Query Frame = 0
Query:  281 KYSLIRPKNLVERARMN---------------VAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNP-KMDGVRINLIYEQLKWTIL 351
            +YSL   K+    A++N               V WLD   +L EQG  + + L++R KF+ + D+N  K D +++N++YEQ K  IL
Sbjct:   72 EYSLASTKDAAHDAQINKKMETIKAKLHTEDEVNWLDQHKTLREQGATEAEPLIMRRKFF-YTDVNVNKDDPIQLNMLYEQSKHAIL 329          
BLAST of EMLSAG00000000006 vs. L. salmonis peptides
Match: EMLSAP00000000006 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:20696:26805:1 gene:EMLSAG00000000006 transcript:EMLSAT00000000006 description:"maker-LSalAtl2s1003-snap-gene-0.21")

HSP 1 Score: 1517.29 bits (3927), Expect = 0.000e+0
Identity = 730/730 (100.00%), Postives = 730/730 (100.00%), Query Frame = 0
Query:    1 MEHNYSSNTGVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGWH 730
            MEHNYSSNTGVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGWH
Sbjct:    1 MEHNYSSNTGVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGWH 730          
BLAST of EMLSAG00000000006 vs. L. salmonis peptides
Match: EMLSAP00000010809 (pep:novel supercontig:LSalAtl2s:LSalAtl2s716:83456:127747:1 gene:EMLSAG00000010809 transcript:EMLSAT00000010809 description:"maker-LSalAtl2s716-snap-gene-1.13")

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 415/763 (54.39%), Postives = 526/763 (68.94%), Query Frame = 0
Query:    1 MEHNYSSNTGVRL-DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLS-------LCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNG--------NDSNLKSG----SEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKM--------------PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            M ++  S  G+ L DGSW LT+ VT+LQ+EK LRV+ D H+GG+MI+LV+EL               RNKWL+ TR+TLDQYNITAD  ++FTPMHK +RIQLPDLR++DC +D+S++       LC+ L  +HLK NY +                           T R+K  H      T D        +R DTNTFI +S++T   K+  +  NG S         NGTL     K++    S+ GTL+ NG++SP  NG          +N+ S     SE SL  SP PS E + S + P++LVERARMNV WLDS+LS+MEQ V++ D L LR+K+Y+F+D+NPK D VRIN I+EQ KW ILNE +DCTEEEM+LFAALQLQV L +NVPQP E  E+DDD VDAAL+DLQ++LEG   R       N D+  +P L+D+LRY++PKRFTLK FK HYFVL++L L+ Y+N ED  +      V LKGCEV+PE+NIS+ +Y IKL +PSADGMS++ LRC  E+QY+KWMAA RLAA+GKTMA  SY+SEVKSI+AFLSMQ PA  PVINP+TL++++EEYVA RFLRK+              P   LR RILEAH+NVKDLNL+EAKMN++KA+QSLPDYGVSLFVV+F  EKK+ELLG+ +N++MR+ L TGD IK WRY+T+KAWN+NWE+KHMMIQ  D KNVIF CLSADCKVVHEFIGGYIFLSMR+KD  Q +D+++FHKLTG W
Sbjct:    1 MNNSGMSKGGIILGDGSWNLTIFVTNLQIEKNLRVRSDLHIGGLMIRLVDELA--------------RNKWLDNTRYTLDQYNITADAIIHFTPMHKMVRIQLPDLRFLDCSLDFSVTTFNASKNLCRELEPEHLKQNYQE--------------------------TTPRKKAQHP----PTKD----GRYNERVDTNTFIPSSSSTPSGKSRISHSNGGS--------LNGTLRTPA-KTNGAYHSHPGTLR-NGNYSPYSNGLSPASHFLKSTNISSTMFNDSEISLTHSPTPSPEIRNSQLHPRSLVERARMNVGWLDSTLSIMEQRVQEMDVLTLRFKYYNFYDINPKYDSVRINQIFEQAKWQILNEAIDCTEEEMLLFAALQLQVGLQSNVPQPHEVFEEDDD-VDAALNDLQVTLEGSVRR-------NGDLTTVPQLADYLRYLKPKRFTLKSFKRHYFVLQDLNLLTYRNVEDVASAEPLMDVGLKGCEVTPEINISQNKYQIKLEVPSADGMSEILLRCEWEEQYAKWMAALRLAARGKTMADISYESEVKSIMAFLSMQRPAEAPVINPATLDINLEEYVAPRFLRKLRSKDKSCGCRPACLPDKSLRQRILEAHTNVKDLNLLEAKMNFIKAWQSLPDYGVSLFVVKFFKEKKEELLGIXANKIMRIALSTGDHIKNWRYSTMKAWNVNWESKHMMIQFEDEKNVIFNCLSADCKVVHEFIGGYIFLSMRSKDKIQQLDDKEFHKLTGNW 697          
BLAST of EMLSAG00000000006 vs. L. salmonis peptides
Match: EMLSAP00000009360 (pep:novel supercontig:LSalAtl2s:LSalAtl2s599:228236:277505:1 gene:EMLSAG00000009360 transcript:EMLSAT00000009360 description:"maker-LSalAtl2s599-augustus-gene-2.22")

HSP 1 Score: 55.0694 bits (131), Expect = 6.830e-8
Identity = 29/118 (24.58%), Postives = 64/118 (54.24%), Query Frame = 0
Query:  599 LNLIEAKMNYLKAFQSLPDYGVSLFVV--RFHGEKK--DELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKD 712
            L+ +++K+ Y+K  + L  +GV  F+V  + HG  K    LLGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + + + I GYI + ++ ++
Sbjct:  314 LSEVDSKVEYVKLARGLKTFGVHFFLVKEKMHGRNKLAPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQISQLIAGYIDIILKKRN 429          

HSP 2 Score: 54.6842 bits (130), Expect = 9.270e-8
Identity = 30/76 (39.47%), Postives = 45/76 (59.21%), Query Frame = 0
Query:  298 VAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLN-PKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQV 372
            V W+D   +L EQG+ + D LLL+ K++ F D N    D +++NL+YEQ +  IL+     T+     FAALQ Q+
Sbjct:  195 VNWVDHGRTLREQGIIESDILLLKRKYF-FSDANIDSRDPIQLNLLYEQAREGILDGTHPVTQNVAEEFAALQFQI 269          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|41018372|sp|Q9VZI3.1|UN112_DROME (RecName: Full=Unc-112-related protein; AltName: Full=Fermitin-1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 339/749 (45.26%), Postives = 489/749 (65.29%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQP--------SEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSA---DGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + +W L +L+TDLQVEK LRVKGD H+GGVM+ LV+  ++  DWSDHALWWP +N WL +TR TLDQ  + +D+ ++FTPMHK +R+Q+PDLRY+D  +++S                     LS CKPL  +HLK N+    Q   +K  +   N +     +  + +F            T   + S   +DR      +    +   R+ +T      SS         GT          H+ + + +   N SF  L            + +LAMSP  PS + +  L+RPK+ VE+AR+NV WLDSSLS+MEQGV+++DTL LR+K+++FFDLNPK D VRIN +YEQ KW+ILNE ++ TEEE ++FAALQ QV+   ++  P        S ++   +DD+D+AL++LQI+LEG             +I  IP LSD+L++++P+RFTLKG+K ++F  ++L L  YK++++S     + S+NLKGCEV+P+VN+++ ++ I+L +PS       S++++RC +E+QY+KWMAACRLAAKG+++A +SYDSEV SI + L MQ PA    +  +  +V+  +Y++ + +RK+  SK   RILEAH+NV+ L+L++AKM Y++A+QSLPD+GV+LF+++F G KK+ELLGVA+NR+MRM+L TGD IKTWRYNT+KAWN+NW  K MMIQL D +N++F   SADCKVVHEFIGGYIF+SMR+K+ NQ ++EE FHKLTGGW
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQ---RKIPVAEANGIAYVQPALDTNSF---------VPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISS-------PTGTWK--------HNSTGYASYDSNSSFGDL------------QENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGEDDIDSALNELQITLEGPG-----GGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPLTVNPRSVEPMDYLSPKMMRKL-SSKAVQRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQD-ENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGW 707          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|41018395|sp|Q18685.1|UN112_CAEEL (RecName: Full=Protein unc-112; AltName: Full=Mitogen-inducible mig-2 protein-like; AltName: Full=Uncoordinated protein 112)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 306/739 (41.41%), Postives = 463/739 (62.65%), Query Frame = 0
Query:   13 LDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYG-DYRQEEGKKRRITLKN-SLNTSNSSSPSGTFR-RKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGS----SSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRF-TLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPA-------------STPVINPSTLNVDVEEYVASRFLRKM-PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            +DG W+L +LVTDL +++ + V G+ +VGG+M++LV+E D+  DWSDHALWWP++ +WL+ TR TLDQ  ITA+T + FTPMHK  RIQLPD++ +D  +D+S++  K  AT  L  + G  Y +E   KR I  ++    TS++ + +G    R G   +  ++    +P            F + S   + R+  + + + S    ++    +L R+GTL    R       + + T+++     P ++ ++       + +L  SP  +      + RP+N VE+A +N  WLDSS SLMEQG+ + D +LLR+KF +FFDLNPK D VRIN +YEQ KW+IL +  D TEEE  LFAALQLQ +L  + P+P   +E++ DDVD  L +L+ +L+  A    +N    +D+  +P L+D+L+YM+PK+    KGFK  +F  ++L L +Y       N       +LKGCEVS +V++ +++Y IKL +P+A+GM D  L+C SE QY++WMAACRLA++GK+MA +SY  EV+SI   L MQ                +  V  P+  NVD  EY++S+++R+   K +++ R+ +AH NV+ L   EAK+ Y++A+Q+LP++G+  F+VRF   +K EL+ VA NRL ++N+  G+ +KTWR+  +K W++NWE +H+ IQ  D +++ FK LSADCKVVHEFIGGYIFLSMR+K+ +Q +DEE FHKLTGGW
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFK--ATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAP-----------IFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLP---RGVSPSPGAYNDTMRRT-PIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEP---EENNKDDVDILLDELEQNLDAAA----LNR--RSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYL-SYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVD--EYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFED-EDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTGGW 719          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|510479189|sp|F1Q8X5.1|FERM2_DANRE (RecName: Full=Fermitin family homolog 2; AltName: Full=Kindlin-2)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 305/733 (41.61%), Postives = 455/733 (62.07%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP---PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEED--EDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTP-VINPSTLNVDVEEYVASRFLRKMPKSK-------LRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G   DG+WEL + VTDL  +  LRV G+ H+GGVM+KLV +LD+  DWSDHALWW  +  WL KT WTLD+Y I AD  + FTP HK +R+QLP+++++   +++S  + K ++     FN   + +E    R+             +   T   +G   + +  +  +  S  +  +  T T+ +   + L   + T++W G S                                      PL  GN S         LA+S P   P +  K  + +P++L+++A++N  WLDSS SLMEQ VK+ + LLLR+K++SFFDLNPK D +R+N +YEQ KW IL E ++CTEEEMM+FAALQ  ++  + +   +  +  E + D+VDAALSDL+I+LEG    + +      DI +IP L+D+++  +PK+ TLKG+K ++   K++ +  YK+ E+++    +  +NL+GCEV+P+VNIS +++ IKL IP ADGM++++LRC +E QY++WMAACRLA+KGKTMA +SY+ EV++IL+FL MQH    P +I P T +++ E  V+ R+L+K    +       +  RILEAH NV  ++LIEAKM +++A+QSLP++G++ F+ +F G KKDEL+G+  NRL+RM+  TGD IKTWR++ +K WN+NWE K + ++  D  ++ F C   DCKVVHEFIGGYIFLS R KD N+ +DEE F+KLT GW
Sbjct:   11 GCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNI-RHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGP--LLTPGSGSIYSSPGLYSKTMTPTYDSRDGSPL---SPTSAWFGDS--------------------------------------PLSEGNPS--------ILAVSQPITSPDILVK--MYKPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTL-----GDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHG-TPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHMNPDPQIIEPITTDINPECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGW 683          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|75061776|sp|Q5R8M5.1|FERM1_PONAB (RecName: Full=Fermitin family homolog 1; AltName: Full=Kindlin-1; AltName: Full=Unc-112-related protein 1)

HSP 1 Score: 476.478 bits (1225), Expect = 3.538e-158
Identity = 231/480 (48.12%), Postives = 333/480 (69.38%), Query Frame = 0
Query:  252 SPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVS-LXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQH--PASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            SPL   N S L           PP S EA   + +P++LV++A++N  WLDSS SLMEQG+++   LLLR+K+YSFFDLNPK D VRIN +YEQ +W IL E +DCTEEEM++FAALQ  +S L  +        E + D+++AALS+L+++LEG    S +      DI  IP L+D+L+  RPK+  LK FK ++FV K+ ++  +KN+E          +NL+GCEV P VN++ +++GIKL IP ADGM+++YLRC  E+QY++WMAAC LA+KGKTMA +SY  EV +IL+FL M++   AS    +P  ++++ E +V+ R  +K    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGV+ NRL++++  TG P+ TWR+  IK WN++WET+ ++I+        F CLSADCK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  209 SPLTEQNCSILAFSQ-------PPQSSEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDGQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKADSLLE-----DITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSIAYFKNKELEQGEPLE-KLNLRGCEVVPNVNVAERKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSSYRPEVLNILSFLRMKNRNSASQVASSPENMDMNPECFVSPRCAKKHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVSWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 109.768 bits (273), Expect = 1.231e-23
Identity = 51/113 (45.13%), Postives = 75/113 (66.37%), Query Frame = 0
Query:   15 GSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
             SWEL + V     + Q +  LRV GD HVGGVM++LV +++I+ DWSD ALWW  ++ WL KT WTLD+Y + AD  + FTP HK +R++LP+L+ V   + +S  + K ++
Sbjct:   10 ASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLQLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVS 122          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|26392456|sp|Q9BQL6.1|FERM1_HUMAN (RecName: Full=Fermitin family homolog 1; AltName: Full=Kindlerin; AltName: Full=Kindlin syndrome protein; AltName: Full=Kindlin-1; AltName: Full=Unc-112-related protein 1)

HSP 1 Score: 474.552 bits (1220), Expect = 2.512e-157
Identity = 230/475 (48.42%), Postives = 335/475 (70.53%), Query Frame = 0
Query:  258 NDSNLKSGSEWSLAMSPPP-SVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVS-LXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDV--EEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            +DS L   +   LA S PP S EA   + +P++LV++A++N  WLDSS SLMEQG+++ + LLLR+K+YSFFDLNPK D VRIN +YEQ +W IL E +DCTEEEM++FAALQ  +S L  +        E + D+++AALS+L+++LEG    S +      DI  IP L+D+L+  RPK+   K FK ++F+ K+ ++  +KN+E          +NL+GCEV P+VN++ +++GIKL IP ADGM+++YLRC  E+QY++WMAAC LA+KGKTMA +SY  EV +IL+FL M++  S   +  S  N+D+  E +V+ R  ++    +L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGV+ NRL++++  TG P+ TWR+  IK WN+NWET+ ++I+        F CLSADCK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  207 SDSPLTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKADSLLE-----DITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLE-KLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 110.923 bits (276), Expect = 4.850e-24
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = 0
Query:   15 GSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
             SWEL + V     + Q +  LRV GD HVGGVM+KLV +++I+ DWSD ALWW  ++ WL KT WTLD+Y + AD  + FTP HK +R++LP+L+ V   + +S  + K ++
Sbjct:   10 ASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVS 122          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|341941120|sp|P59113.4|FERM1_MOUSE (RecName: Full=Fermitin family homolog 1; AltName: Full=Kindlin-1; AltName: Full=Unc-112-related protein 1)

HSP 1 Score: 471.47 bits (1212), Expect = 3.156e-156
Identity = 231/480 (48.12%), Postives = 333/480 (69.38%), Query Frame = 0
Query:  252 SPLVNGNDSNLKSGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSE-EDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVE-EYVASRFLRKMPKSK-LRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            SPL   N S L           PPPS +    + +P++LV++A+MN  WLDSS SLMEQ +++ + L LR+K+Y+FFDLNPK D VRIN +YEQ +W +L E +DCTEEEM++FAALQ  +S  +   +  +   + + D+V+AALS L+++LEG    + +      DI  IP L+D+L+  RPK+  LK  K ++FV K+ ++  +KN+E          +NL+GCE+ P+VN+S +++GIKL IP ADGM+++YLRC  EDQY++WMAAC LA+KGKTMA +SY  EV SIL+FL M++  S+P++  S  N+D+  E + S    K  KSK L  RILEAH NV  + L+EAK+ +++A+QSLP++G++ ++VRF G KKD++LGVA NRL+R++  TG P+ TWR+  +K WN+NWE + + I+     ++ F CLSADCK+VHE+IGGYIFLS R+KD N+ +DE+ FHKLTGG
Sbjct:  209 SPLTEQNCSVLAFSQ-------PPPSPDVLADMFQPRSLVDKAKMNAGWLDSSRSLMEQSIQEDEQLQLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQYHISKLSQCAEIQDFATKSEVDEVEAALSSLEVTLEGGKADNTLE-----DITDIPKLADYLKLFRPKKLMLKACKQYWFVFKDTSIAYFKNKELEQGEPIE-KLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVISILSFLKMKNRNSSPLVASSLENMDMNPECLVSPCCAKKHKSKQLAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVAYNRLIRIDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG 675          

HSP 2 Score: 109.383 bits (272), Expect = 1.574e-23
Identity = 53/120 (44.17%), Postives = 76/120 (63.33%), Query Frame = 0
Query:    8 NTGVRLDGSWELTLLV----TDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLA 123
            ++G     SWEL + V     + Q E  LRV GD H+GGVM+KLV +++IA DWSD+ALWW  +  WL KT WTLD+  + AD  + FTP HK +R++LP+ + V   + +S  + K +A
Sbjct:    3 SSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKMLRLRLPNAKTVRLRVSFSAVVFKAVA 122          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|38258220|sp|Q96AC1.1|FERM2_HUMAN (RecName: Full=Fermitin family homolog 2; AltName: Full=Kindlin-2; AltName: Full=Mitogen-inducible gene 2 protein; Short=MIG-2; AltName: Full=Pleckstrin homology domain-containing family C member 1; Short=PH domain-containing family C member 1)

HSP 1 Score: 466.463 bits (1199), Expect = 2.981e-154
Identity = 238/479 (49.69%), Postives = 340/479 (70.98%), Query Frame = 0
Query:  258 NDSNLKSGSEWSLAMSPP---PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDD--DDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDV--EEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
             DS L  G+   LA+S P   P + AK  + +P+ L+++A++N  WLDSS SLMEQ VK+ + LLLR+K+YSFFDLNPK D +RIN +YEQ KW IL E ++CTEEEMM+FAALQ  ++  + +   +  +  D   D+VDAALSDL+I+LEG         T+  DI +IP L+D+++  +PK+ TLKG+K ++   K+ ++  YK++E+S     +  +NL+GCEV+P+VNIS +++ IKL IP A+GM++++LRC +E QY+ WMAACRLA+KGKTMA +SY+ EV++IL+FL MQH    P + P  +  D+  E  V+ R+L+K    ++  RILEAH NV  ++LIEAKM +++A+QSLP++G++ F+ RF G KK+EL+G+A NRL+RM+  TGD IKTWR++ +K WN+NWE K + ++  D   + F C   DCKVVHEFIGGYIFLS R KD N+ +DEE F+KLT GW
Sbjct:  209 GDSALSEGNPGILAVSQPITSPEILAK--MFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGK-----TSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSG-TPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGW 679          

HSP 2 Score: 131.724 bits (330), Expect = 1.252e-30
Identity = 60/121 (49.59%), Postives = 83/121 (68.60%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFN 130
            G   DG+WEL++ VTDL  +  LRV G+ H+GGVM+KLV +LD+  DWSDHALWW  +  WL KT WTLD+Y I AD  + FTP HK +R+QLP+++YV   +++S  + K ++     FN
Sbjct:   11 GCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFN 131          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|38258078|sp|Q8CIB5.1|FERM2_MOUSE (RecName: Full=Fermitin family homolog 2; AltName: Full=Kindlin-2; AltName: Full=Pleckstrin homology domain-containing family C member 1)

HSP 1 Score: 461.07 bits (1185), Expect = 3.427e-152
Identity = 237/479 (49.48%), Postives = 338/479 (70.56%), Query Frame = 0
Query:  258 NDSNLKSGSEWSLAMSPP---PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDD--DDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDV--EEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
             DS L  G+   LA+S P   P + AK  + +P+ L+++A+ N  WLDSS SLMEQ VK+ + LLLR+K+YSFFDLNPK D +RIN +YEQ KW +L E ++CTEEEMM+FAALQ  ++  + +   +  +  D   D+VDAALSDL+I+LEG         T+  DI +IP L+D+++  +PK+ TLKG+K ++   K+ ++  YK+ E+S     +  +NL+GCEV+P+VNIS +++ IKL IP A+GM++++LRC +E QY+ WMAACRLA+KGKTMA +SY+ EV++IL+FL MQH    P + P  +  DV  E  V+ R+L+K    ++  RILEAH NV  ++LIEAKM +++A+QSLP++G++ F+ RF G K++EL+G+A NRL+RM+  TGD IKTWR++ +K WN+NWE K + ++  D   + F C   DCKVVHEFIGGYIFLS R KD N+ +DEE F+KLT GW
Sbjct:  209 GDSALSEGNPGILAVSQPVTSPEILAK--MFKPQALLDKAKTNQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGK-----TSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSG-TPAHQLNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPDQITTDVNPECLVSPRYLKKYKSKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGW 679          

HSP 2 Score: 128.257 bits (321), Expect = 1.593e-29
Identity = 59/121 (48.76%), Postives = 82/121 (67.77%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPLATDHLKFN 130
            G   DG+WEL++ VTDL  +  LRV G+ H+GGVM+KLV +LD+  DWSDHALWW  +  WL KT WTLD+  I AD  + FTP HK +R+QLP+++YV   +++S  + K ++     FN
Sbjct:   11 GCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFN 131          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|118597389|sp|Q32LP0.1|URP2_BOVIN (RecName: Full=Fermitin family homolog 3; AltName: Full=Kindlin-3; AltName: Full=Unc-112-related protein 2)

HSP 1 Score: 451.825 bits (1161), Expect = 1.053e-148
Identity = 221/461 (47.94%), Postives = 315/461 (68.33%), Query Frame = 0
Query:  286 RPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQV---SLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQ-----------HP----ASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            RP +L+++ +++  WLDSS  LM+QG+K  DTL LR+K+YSFFDL+PK D VR+  +YEQ +W +L E +DCTEEEMM+FAALQ  +   S    V +P+  D    DD+D ALS+L++ LEG A    ++      +  IP L DHLR  RP++ TLKG++ H+ V KE  L  YK+++++        +NLKGCEV P+VN+S +++ IKL +PS +GMS++YLRC  E QY++WMA CRLA+KG+TMA +SY SEV++ILAFLS+Q           HP    AS   +NP  L       VA RF RK    +L  RILEAH NV  L+L EA++ +++A+QSLPD+G+S  VVRF G +KDE+LG+A+NRL+R++L  GD +KTWR++ ++ WN+NW+ + + I+  +  NV F C+SA C++VHE+IGGYIFLS R +   + +DE+ F +LTGG
Sbjct:  215 RPSSLLDKTQLHSRWLDSSRCLMQQGIKAGDTLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVDEPAGTD-SGLDDLDLALSNLEVKLEGSAPTDMLD-----SLTTIPELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGEPIQ-QLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYSSEVQAILAFLSLQRTGGGGGGSGNHPQGPDASAEGLNPYGL-------VAPRFQRKFKAKQLTPRILEAHQNVAQLSLSEAQLRFIQAWQSLPDFGISYVVVRFKGSRKDEILGIANNRLIRIDLSVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGG 661          

HSP 2 Score: 105.916 bits (263), Expect = 2.171e-22
Identity = 49/130 (37.69%), Postives = 80/130 (61.54%), Query Frame = 0
Query:    7 SNTGVRLDGSWELTLLV--TDLQVEKI-LRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS-------LSLCKPLATDH 126
            + TG  +D SWEL + +   D + E + LRV G+ H+GGV++K+V E+    DWSDHA+WW  + +WL +T WTLD+Y I AD  ++F P H+ + ++LP+ R +     +S       +++C+ L+  H
Sbjct:    6 TATGDYIDSSWELRVFIGEEDPEAESLTLRVTGESHIGGVLLKIVEEIKRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAMVAICRLLSIRH 135          
BLAST of EMLSAG00000000006 vs. SwissProt
Match: gi|41018469|sp|Q8K1B8.1|URP2_MOUSE (RecName: Full=Fermitin family homolog 3; AltName: Full=Kindlin-3; AltName: Full=Unc-112-related protein 2)

HSP 1 Score: 441.039 bits (1133), Expect = 1.420e-144
Identity = 217/473 (45.88%), Postives = 317/473 (67.02%), Query Frame = 0
Query:  274 PPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQV---SLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHP---------------ASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGG 728
            P P       L RP +L ++ +++  WLDSS  LM+QG+K  D L LR+K+YSFFDL+PK D VR+  +YEQ +W +L E +DCTEEEMM+FAALQ  +   +L  +V + +  D   DD +DAAL++L++ L+G A    ++      +  IP L DHLR  RP++ TLKG++ ++ V K+  L  YK+++++    T   +NLKGCEV P+VN+S +++ IKL +PS +GMS++YLRC  E QY++WMAACRLA+KG+TMA +SY SEV++ILAFLS+Q                 A    +NP  L       VA RF RK    +L  RILEAH NV  L+L EA++ +++A+QSLPD+G+S  +VRF G +KDE+LG+A+NRL+R++L  GD +KTWR++ ++ WN+NW+ + + I+  +  NV F C+SA C++VHE+IGGYIFLS R +   + +DE+ F +LTGG
Sbjct:  203 PAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQGIKAGDVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLTLSGDVGELASGDLGLDD-LDAALNNLEVKLKGSAPSDMLD-----SLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQ-QLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQRAGGSNGGSGNKPQGPEAPAEGLNPYGL-------VAPRFQRKFKAKQLTPRILEAHQNVAQLSLTEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGG 661          

HSP 2 Score: 104.76 bits (260), Expect = 4.301e-22
Identity = 49/119 (41.18%), Postives = 74/119 (62.18%), Query Frame = 0
Query:    7 SNTGVRLDGSWELTLLVTDLQVEK---ILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYSLSLCKPL 122
            + +G  +D SWEL + V +   E     LRV G+ H+GGV++K+V E++   DWSDHA+WW  + +WL +T WTLD+Y I AD  ++F P H+ + ++LP+ R    V+    S  KPL
Sbjct:    6 TASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRR----VLRLRASFSKPL 120          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: EFX74788.1 (hypothetical protein DAPPUDRAFT_199712 [Daphnia pulex])

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 411/739 (55.62%), Postives = 521/739 (70.50%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSV-STSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSWEL +LVTDL VE+ LRVKGD H+GGVM++LV ELDIA DWSDHALWWP RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS  KPL +D L++NY +       K+R    NS +T+      G      N+ + ++ +TS  +P          NT I  S A +    S+ S                                 GT +KN   +   N + SN+    + SLA+SP  PS EA+  L+RPKNL+ERAR+NVAWLDSSLS+MEQGV+++  LLLRYKFYSF+DLNPK D VRIN IYEQ KW +LNE +DCTEEEM++F ALQLQV+L +  PQP  +  D DDD+DAALSDLQ +LEG    S       +DI +IP LSD LRYM+PKRFTLKGFK ++FV K+L L A+KN+ +S     +  + L+GCEV+P+VN+S+ ++GI+L +P  DGMS++++RC SE QY+KWMAACRLAAKGKTMA ASYD+EV SILAFL+MQ PA  P INPS+L++  ++YVA RF+RK+ K+K+  RILEAH+NVKDL+L EAK+NY+KA+QSLP+YGVSLFVV+F G++K+ELLGVA NRLMRM+L TGD IKTWRYNT+KAWN+NWE KHMM+Q  + ++VIF CLSADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:   10 DGSWELKVLVTDLSVERCLRVKGDLHIGGVMLRLVEELDIAADWSDHALWWPARNCWLSRTRSTLDQYGVQADALLHFTPMHKTLRVQLPDLRYLDCRVDFSVKTFNAVVTLCKELGIRHPEELSFAKPLESDDLRYNYRERESNTSHKKRTVANNSADTNTFIGHHGNSTHSSNNSLDNIKATSGCTPVLP-------NTTINRSPAPVPTPISSPS---------------------------------GTWRKNSPLNTTANSSFSNM----DMSLALSPATPSQEARSRLLRPKNLIERARLNVAWLDSSLSIMEQGVREYSALLLRYKFYSFYDLNPKYDAVRINQIYEQAKWQLLNEEIDCTEEEMLMFGALQLQVNLQSAQPQPLSDTRDGDDDIDAALSDLQDTLEGTHVHS-----NTSDITSIPELSDFLRYMKPKRFTLKGFKRYWFVCKDLQLFAFKNKGES-GSGPAHQIPLRGCEVTPDVNLSQDKFGIRLEVPGPDGMSEMWIRCDSEAQYAKWMAACRLAAKGKTMADASYDAEVSSILAFLAMQKPAPAPAINPSSLDIQPDDYVAPRFIRKL-KNKVSTRILEAHTNVKDLSLTEAKLNYIKAWQSLPEYGVSLFVVKFMGQRKEELLGVAFNRLMRMDLTTGDHIKTWRYNTMKAWNVNWEVKHMMVQF-EEESVIFSCLSADCKVVHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 696          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: XP_392367.3 (PREDICTED: unc-112-related protein [Apis mellifera])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 403/763 (52.82%), Postives = 519/763 (68.02%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDY----RQEEGKKRRITLKNSLNT--SNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSN-----LKSGSEWSLAMSPP---PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD----DDDVDAALSDLQISLEGEAHRSFINETVNN---DIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHT-SFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LRVKG+ H+GGVM++LV +LDIAMDWSDHALWWP+RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+R +DC +D+S                     LS CKPL  +HLK+N  D     + E  K     +    NT    S SP G             ST  L  S   +  P T     +ST      +S  S  G+  RN  S G   T                      GSF    N N+S      L  G   SLA SP    P V AK  LIRPKNLVERARMNVAWLDSSLS+MEQG+++FDTL L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A+VPQPS +        +DD+DAAL+DLQ++LEG          ++N   DI  +P L D+LR+++PKRFTLK FK ++   ++L L  YK+ E++ +  + +  +NL+GCEV+P+V++S+ RYGI+L +PSA+GM+++++RC +E QY+KWMAACRLAAKG+++A ASY+SEV SI AFL +Q PA  P INP+ L++  E+YVA RF++K  K KL  RILEAH+NVKDL LIEAK+NY+KA+QSLP+YG+SLFVVRF  + KDELLG+A+NRLMRM L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +N+IF+C SADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:    5 GHEVDGSWVLRVYVTDLQVERSLRVKGELHIGGVMLRLVEDLDIAMDWSDHALWWPERNHWLTRTRSTLDQYGVAADALLHFTPMHKTLRVQLPDMRCLDCKVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDLPAKKKIENQKNGHWNVPADTNTFIPVSQSPRG-------------STGSLDQSSPFMCAPVTPNNRNHSTPI----SSPVSQTGTWKRNNNSSGFGST----------------------GSF----NANNSTMSLEVLNGGLSESLAQSPATISPEVRAK--LIRPKNLVERARMNVAWLDSSLSIMEQGIREFDTLRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASVPQPSYDSNGAASPIEDDIDAALTDLQVTLEG--------SNISNGPSDITQVPELCDYLRFLKPKRFTLKAFKRYWVTCRDLQLRLYKSREETNSAESPAHVINLRGCEVTPDVHLSQGRYGIRLEVPSAEGMTEMWIRCDNEQQYAKWMAACRLAAKGRSLADASYESEVNSITAFLQLQRPAPAPAINPNALDIVPEDYVAPRFVKKF-KGKLVQRILEAHANVKDLPLIEAKLNYIKAWQSLPEYGISLFVVRFTAKSKDELLGIANNRLMRMELHSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEENIIFECQSADCKVVHEFIGGYIFLSMRSKEANQTLNEEMFHKLTGGW 712          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: gb|KYB26554.1| (Unc-112-related protein-like Protein [Tribolium castaneum])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 387/759 (50.99%), Postives = 511/759 (67.33%), Query Frame = 0
Query:    7 SNTGVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKS--------GSEWSL--AMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDED----DDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTS-FSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            +N  +  DGSW L +LVTDLQ E+ LRVK D H+GGVM++LV +L+I+MDWSDHALWWP +N WL +TR TLDQY + AD  ++FTPMHKN+R+QLPDLRY+D  +D+S                     LSLCKPL   HLK+NY                       +S P    ++K  + +      +L P        DTNTFIANS+            +GS+     SL ++G +      S     S          ++   NG   NL +        GS  S      PPPS EA+  +IRPK+LVE+ARMNVAWLDSSLS+MEQGV+++DTL LR+KFY F+DLNPK D +RIN IYEQ +W +LNE +DCTEEEM++FAALQLQV+L A  PQP  ++ +     +DD+DAAL+DLQ +LEG    S+      NDI  +P L D LR+++PKRFTLK +K ++F  ++L L  YK++E+  +   S + +NL+GCEV+P+VNIS+ +Y IKL +PSA+GMS++Y+RC  E QY+KWMA CRLA+KG+++A +SY++E ++IL FL MQ PA  P INPS+L++  E+Y+A RFL+K  + K   RILEAH+NVKDL LIEAKMNY+KA+QSLPDYG++LFV++F G KK+ELLGVA  R+M+M++ TGD +KTWRYNT+ AWN+NWE KHMMIQ  D  N++F C SADCKVVHEFIGGYIFLS R+KDA+Q ++EE FHKLTGGW
Sbjct:    3 ANGQIVGDGSWNLRVLVTDLQAERQLRVKSDLHIGGVMLRLVEDLEISMDWSDHALWWPSKNIWLTRTRSTLDQYGVQADALLHFTPMHKNLRVQLPDLRYLDMKVDFSVKTFSAVIHLCKDLGIRHPEELSLCKPLEPCHLKYNY-----------------------NSMP----KKKVENGVAKNGHPNLPP--------DTNTFIANSSP-----------DGSTG----SLDKSGFMCAPVTPSRPPPSSTPTGSWGRQVYNSETNGYSPNLTTSISSEQLNGSYDSFLAQTPPPPSPEARKHMIRPKSLVEKARMNVAWLDSSLSIMEQGVREYDTLCLRFKFYVFYDLNPKYDAIRINQIYEQARWQLLNEEIDCTEEEMLMFAALQLQVNLQAKQPQPHLDNGNVSSPVEDDIDAALTDLQTTLEGSTINSYA-----NDITQVPELCDELRFLKPKRFTLKAYKRYWFTCRDLHLYLYKSKEEMIHRQNSIYDINLRGCEVTPDVNISQNKYVIKLEVPSAEGMSEMYIRCDEESQYAKWMACCRLASKGRSLADSSYETEKQTILEFLQMQRPADEPAINPSSLDLQAEDYIAPRFLKKF-RGK-NQRILEAHANVKDLPLIEAKMNYIKAWQSLPDYGLTLFVIKFMGSKKEELLGVAPTRIMKMDITTGDHLKTWRYNTMIAWNVNWEVKHMMIQFEDC-NIMFSCSSADCKVVHEFIGGYIFLSTRSKDASQTLNEELFHKLTGGW 703          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: gb|EFA07132.1| (Unc-112-related protein-like Protein [Tribolium castaneum])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 385/759 (50.72%), Postives = 508/759 (66.93%), Query Frame = 0
Query:    7 SNTGVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKS--------GSEWSL--AMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDED----DDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTS-FSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            +N  +  DGSW L +LVTDLQ E+ LRVK D H+GGVM++LV +L+I+MDWSDHALWWP +N WL +TR TLDQY + AD  ++FTPMHKN+R+QLPDLRY+D  +D+S                     LSLCKPL   HLK+NY                       +S P    ++K  + +      +L P        DTNTFIANS+       ST S + S    +       +              N G+  +   ++   NG   NL +        GS  S      PPPS EA+  +IRPK+LVE+ARMNVAWLDSSLS+MEQGV+++DTL LR+KFY F+DLNPK D +RIN IYEQ +W +LNE +DCTEEEM++FAALQLQV+L A  PQP  ++ +     +DD+DAAL+DLQ +LEG    S+      NDI  +P L D LR+++PKRFTLK +K ++F  ++L L  YK++E+  +   S + +NL+GCEV+P+VNIS+ +Y IKL +PSA+GMS++Y+RC  E QY+KWMA CRLA+KG+++A +SY++E ++IL FL MQ PA  P INPS+L++  E+Y+A RFL+K        RILEAH+NVKDL LIEAKMNY+KA+QSLPDYG++LFV++F G KK+ELLGVA  R+M+M++ TGD +KTWRYNT+ AWN+NWE KHMMIQ  D  N++F C SADCKVVHEFIGGYIFLS R+KDA+Q ++EE FHKLTGGW
Sbjct:    3 ANGQIVGDGSWNLRVLVTDLQAERQLRVKSDLHIGGVMLRLVEDLEISMDWSDHALWWPSKNIWLTRTRSTLDQYGVQADALLHFTPMHKNLRVQLPDLRYLDMKVDFSVKTFSAVIHLCKDLGIRHPEELSLCKPLEPCHLKYNY-----------------------NSMP----KKKVENGVAKNGHPNLPP--------DTNTFIANSSP----DGSTGSLDKSG---FMCAPVTPSRPPPSSTPVSSPVGNTGSWGRQ-VYNSETNGYSPNLTTSISSEQLNGSYDSFLAQTPPPPSPEARKHMIRPKSLVEKARMNVAWLDSSLSIMEQGVREYDTLCLRFKFYVFYDLNPKYDAIRINQIYEQARWQLLNEEIDCTEEEMLMFAALQLQVNLQAKQPQPHLDNGNVSSPVEDDIDAALTDLQTTLEGSTINSYA-----NDITQVPELCDELRFLKPKRFTLKAYKRYWFTCRDLHLYLYKSKEEMIHRQNSIYDINLRGCEVTPDVNISQNKYVIKLEVPSAEGMSEMYIRCDEESQYAKWMACCRLASKGRSLADSSYETEKQTILEFLQMQRPADEPAINPSSLDLQAEDYIAPRFLKKFRGKN--QRILEAHANVKDLPLIEAKMNYIKAWQSLPDYGLTLFVIKFMGSKKEELLGVAPTRIMKMDITTGDHLKTWRYNTMIAWNVNWEVKHMMIQFEDC-NIMFSCSSADCKVVHEFIGGYIFLSTRSKDASQTLNEELFHKLTGGW 710          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: gb|EEC14011.1| (conserved hypothetical protein, partial [Ixodes scapularis])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 380/734 (51.77%), Postives = 494/734 (67.30%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS-------LSLCKPLATDH---LKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSF-SPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKN-EEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKM-PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G+++DGSWEL + VTDL++E+ LRVKGD H+GGVM+ LV  L++  DWSDHALWWP++N WL +T+ TLDQ  + AD  ++FTPMHK +RIQ PDLR +D   D+S       + +CK L   H   L F     R +EG     T   +LN S +   +GT                       +D P     +A    ++GR+T   + N +++    ++  NGTL                    NGSF SP     D +  S  E  LA SP  P+ E K +L+RPK LVERAR+N  WLDSSLSLMEQ V++FD L LRYKFYSF+DLNPK D VRIN IYEQ KW +L E +DCTEEEMMLFAALQLQV++ AN  QP  +    +DD+DAAL+DLQ+SLEG       NET N  I  +P L  +LR+++PKRFTLKGFK  +F+ KE  +  YK+ EE       S+ +NLKG EV+P+V +++ +YGI+L +P  +GM++ +LRC +EDQY++WMA CRLAAKGKTMA ASYD+EV SI  FL +Q PA  P + PS LN++VE++VA RFL+K+  K  +  RI+EAH NVKDL+L++AK++++KA+Q+LP++G+SLFVVRF G KK+ELLGVA NRLMRM L TGD IKTWR+NT+KAWN+NWE K MM+Q  +  +V F CLSADCK VHEFIGGYIFLSMR+KD NQ ++EE FHKLTGGW
Sbjct:   10 GIKIDGSWELHIYVTDLKIERKLRVKGDTHIGGVMLNLVESLNVPTDWSDHALWWPEQNTWLTRTKSTLDQCGVMADALLHFTPMHKTLRIQFPDLRIMDVRTDFSVKTFSSVVKVCKELGIRHPEELSFCR-PLRPKEG-----TDSINLNRSKAGDSNGT-----------------------LDGP-----LAAPLNSVGRRTECAA-NSTTTHWNTTMAHNGTLP-----------------GLNGSFLSP-----DGSFLSQYELPLAQSPNRPAQEIKAALLRPKTLVERARLNAGWLDSSLSLMEQDVREFDLLQLRYKFYSFYDLNPKKDAVRINQIYEQAKWALLTEEVDCTEEEMMLFAALQLQVNMQANSSQP--DFSRGEDDIDAALTDLQVSLEGTL---LTNETSN--ITQVPELHSYLRFLKPKRFTLKGFKRMFFIFKETRMCVYKSREEYESGGSPSYVINLKGSEVTPDVYLAQGKYGIRLEVPGPEGMTEYWLRCETEDQYAQWMAGCRLAAKGKTMADASYDAEVSSIQQFLQLQRPAPAPALAPSELNIEVEDFVAPRFLKKLKTKQAITQRIVEAHGNVKDLSLVDAKLSFIKAWQALPEFGISLFVVRFSGSKKEELLGVAFNRLMRMELSTGDHIKTWRFNTMKAWNVNWEVKQMMVQFEEEPHVAFACLSADCKTVHEFIGGYIFLSMRSKDQNQALNEELFHKLTGGW 679          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: EAA01071.2 (AGAP002054-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 361/757 (47.69%), Postives = 498/757 (65.79%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHS---QSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAA-------------LSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDS-YNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGM-SDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGWH 730
            D +W L + +TDLQV+K LRV+GD H+GGVM++LV+  +   DWSDHALWWP RN+WL +T+ TLDQ  + AD  ++FTPMHK +R+Q+PDLRY+DC +D+S                     LSLCKPL   HLK NY D       K++I ++ + N              G  +IH                PDTNTFI  +   L    S  S +G   +   S        +   K    S    S  GTL+         + + +   + +   LA SP  PS EA+  L++PK LVERARMN++WLDSSLS+MEQG+++F+TL LR+K+Y+FFDLNPK D VRIN +YEQ KW +LNE +DCTEEEM++F ALQLQV+    VPQ        D  +D +             L +LQI+LEG +     N     DI  IP L+D+LR+++PK+FTLKG+K ++F  K+L L  YK+ ED+  N     ++NL+GCEV+PEVN+++K++ IKL +P    + S++++RC +E+QY+KWMAACRLA+KG+++A +SYDSEV SI +FLSMQ PA  P IN +   +D  EY+A R+ +K+ KSK   R+LEAH+NVKDL+LIEAK++Y++A+QSLP++GV+LFV++F G KK+ELLGVASNR+M+M++ TGD +KTWRYNT+KAWN+NWE + MM+Q  + + V+F CLSADCKV+HEFIGGYIF+SMR+K+ NQ ++EE FHKLTGGW+
Sbjct:    6 DNTWNLKVYITDLQVQKTLRVRGDLHIGGVMLRLVDP-ENPKDWSDHALWWPTRNQWLTRTKSTLDQVGLHADALLHFTPMHKTLRVQMPDLRYLDCRVDFSIKTFGAVVALCKDLGIRHPEELSLCKPLEPMHLKKNYADL-----AKKKIPIEQNGN--------------GRDYIHLA--------------PDTNTFIPVAAHNLN--GSNGSLDGPVHQGPFSCAPVPNAHFSTPKPALQSTPISSPTGTLRHGHGSGNSDSSSSTGDGNEN---LAYSPYAPSPEARSRLLKPKTLVERARMNISWLDSSLSIMEQGIREFETLCLRFKYYTFFDLNPKYDQVRINQLYEQAKWQLLNEEIDCTEEEMLMFGALQLQVNKQNEVPQA-------DSGIDTSSLDNAADDDVDAALRELQITLEGPS-----NGVNAGDITHIPELTDYLRFLKPKKFTLKGYKRYWFTYKDLHLHLYKSREDARANSAPQVTINLRGCEVTPEVNLAQKKFNIKLEVPLEQSINSEMWIRCDNEEQYAKWMAACRLASKGRSLADSSYDSEVASIRSFLSMQKPAQAPAININPGEIDPSEYLAPRYAKKL-KSKAMIRMLEAHANVKDLSLIEAKLSYIRAWQSLPEFGVTLFVIKFDGHKKEELLGVASNRIMKMDIATGDHLKTWRYNTMKAWNVNWEIRCMMVQFQN-ETVVFSCLSADCKVIHEFIGGYIFMSMRSKETNQTLNEELFHKLTGGWN 709          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: AAF49380.1 (fermitin 2 [Drosophila melanogaster])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 352/753 (46.75%), Postives = 501/753 (66.53%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNH-GTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXAN-VPQ---------PSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGM----SDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + SW L + +TDL +EK +RV+GD H+GG+M++LV+  +   DWSDHALWWP RN WL +T+ TLDQ  + AD+ ++FTPMHK +R+QLPDLRY+D  +DYS                     LSLCKPL  +HLK N+     +    +R+ +         + P GT              + L P+       DTN+F+  ST+  G   ST S +  S+            + HR +S   + S   GT K++       + + S+L    E +LA SPP P  + +   +RPK+LVE+AR+NV WLDSSLS+MEQG++++DTL LR+K+++FFDLNPK D VRIN +YEQ KW++LNE +DCTEEE ++FAALQ QV+   +  PQ          S ++ D++D++D+AL +LQI+LEG  +        + +I  IP LSD+LRY++P+RFTL+G+K +YF  ++L L  +KN EDS     + S+NLKGCEV+P+VN+S+ +Y I+L + S DG     S++++RC +E QY+KWMAACRLAAKG+++A +SY+SEV SIL+ L MQ PA    +N    +V+  +Y++ + +RK+  +K   RILEAH+NV++LN +++K+ Y++A++SLPD+GVSLF+++F G +K+ELLGVA NR+MRM+L +GD IKTWRYNT+KAWN+NW  K MMIQ  D +NV+F C SADCKVVHEFIGGYIF+SMR+KD NQ ++EE FHKLTGGW
Sbjct:    6 ENSWNLRIFITDLALEKTMRVRGDQHIGGIMLQLVDPEN-PKDWSDHALWWPARNVWLSRTKLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDSRVDYSVKTFSAVVNLCKQLDIRYPEELSLCKPLEAEHLKRNFAQVPHQ----KRVPI---------AEPDGT--------------TYLQPAA------DTNSFVPISTSFHGEGGSTGSLDKPSAPGSFFCAPLSPHN-HRARSPVRTVSPFPGTWKQSQLGYATYDSSSSSLGDFQE-NLASSPPTPCADVRALQLRPKSLVEKARLNVGWLDSSLSIMEQGIREYDTLCLRFKYFTFFDLNPKCDQVRINQLYEQAKWSVLNEELDCTEEESLMFAALQFQVNHHVDHTPQGAAVDSGIETSSQENDNEDEIDSALKELQITLEGPDYGG-----DSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRDLHLHLFKNAEDSRRVAPAISINLKGCEVTPDVNLSQGKYAIRLEV-SPDGGHGINSEVWVRCENEQQYAKWMAACRLAAKGRSLADSSYESEVDSILSLLQMQRPAHGVHVNIDPRSVEAVDYLSPKIIRKL-SNKAVQRILEAHANVRELNALDSKLKYIQAWRSLPDFGVSLFIIKFDGHRKEELLGVAHNRIMRMDLSSGDHIKTWRYNTMKAWNVNWNIKCMMIQFED-ENVVFSCHSADCKVVHEFIGGYIFMSMRSKDTNQTLNEELFHKLTGGW 714          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: EEB19040.1 (conserved hypothetical protein [Pediculus humanus corporis])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 360/722 (49.86%), Postives = 471/722 (65.24%), Query Frame = 0
Query:   55 MDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIA-------------NSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD--DDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSV-NLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVI--NPSTLNVDVEEYVASRFL-------RKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            MDWSDHALWWP +N WL +TR TLDQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS CKPL ++HLK N  D   +         KN  N  N   PS                             DTNTFIA             NS       T T    GS       LG +GT  + R +S   S S +GTL      S   +G+        E SLA SP  P+ EA+  L+RPK+LVERARMNVAWLDSSLS+MEQGV++FDTL LR+KFY+F+DLNPK D VRIN +YEQ KW +LNE +DCTEEE+++FAALQ+Q+++ A +PQP  E  ++  DDD+DAAL+DLQ+SLEG    +       NDI  +P L D+LR+++PKRFTLK FK ++F  ++L L  YK++ED+ N      V NL+GCEV+PEVNI++ ++ IKL + S DGM+++++RC SE+QY+KWMAACRL AKG+++A +SY++EVK+I AFL MQH A +P I       +   + Y+  + +       +     +L  RILEAH+NVKDLNL++AKM+Y+KA+QSLP++G+SLFV+ F G KK+ELLGVA NR+MRM+L  GD +KTWRYN++ AWN+NWE KHMMIQ  +G N+IF CLSADCKV+HEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:    1 MDWSDHALWWPKKNFWLTRTRSTLDQYGVQADALLHFTPMHKCLRVQLPDLRYLDCKVDFSIKTFNAVINLCKELGIRHPEELSFCKPLESNHLKHNLKDLNNKR--------KNHENIQNGQIPS-----------------------------DTNTFIATEAHNGSNGSLDKNSPYMCAPMTPTKGSVGSP------LGSSGT--WKRNQSPAFSDSLNGTLILPSLLSDTTDGS-------IESSLANSPTTPNQEARSRLLRPKSLVERARMNVAWLDSSLSIMEQGVREFDTLNLRFKFYAFYDLNPKCDSVRINQLYEQAKWQLLNEEIDCTEEEVLMFAALQVQINIQAGIPQPKMELGNNIADDDIDAALTDLQVSLEGTNISNGC-----NDITQVPKLYDYLRFLKPKRFTLKQFKKYWFTCRDLKLTLYKSQEDADNGGEPVHVINLRGCEVTPEVNIAQGKFAIKLEVASPDGMTEMWIRCDSEEQYAKWMAACRLGAKGRSLADSSYEAEVKNIEAFLKMQHRAPSPAIIQRKGIASALYDAYILFKSILDLFIDTKTTFSFQLIQRILEAHANVKDLNLMDAKMSYIKAWQSLPEFGISLFVINFMGHKKEELLGVAFNRIMRMDL-NGDHLKTWRYNSLIAWNVNWEVKHMMIQHEEG-NIIFSCLSADCKVIHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 663          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: AAG22245.1 (fermitin 1, isoform B [Drosophila melanogaster])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 339/749 (45.26%), Postives = 489/749 (65.29%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQP--------SEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSA---DGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + +W L +L+TDLQVEK LRVKGD H+GGVM+ LV+  ++  DWSDHALWWP +N WL +TR TLDQ  + +D+ ++FTPMHK +R+Q+PDLRY+D  +++S                     LS CKPL  +HLK N+    Q   +K  +   N +     +  + +F            T   + S   +DR      +    +   R+ +T      SS         GT          H+ + + +   N SF  L            + +LAMSP  PS + +  L+RPK+ VE+AR+NV WLDSSLS+MEQGV+++DTL LR+K+++FFDLNPK D VRIN +YEQ KW+ILNE ++ TEEE ++FAALQ QV+   ++  P        S ++   +DD+D+AL++LQI+LEG             +I  IP LSD+L++++P+RFTLKG+K ++F  ++L L  YK++++S     + S+NLKGCEV+P+VN+++ ++ I+L +PS       S++++RC +E+QY+KWMAACRLAAKG+++A +SYDSEV SI + L MQ PA    +  +  +V+  +Y++ + +RK+  SK   RILEAH+NV+ L+L++AKM Y++A+QSLPD+GV+LF+++F G KK+ELLGVA+NR+MRM+L TGD IKTWRYNT+KAWN+NW  K MMIQL D +N++F   SADCKVVHEFIGGYIF+SMR+K+ NQ ++EE FHKLTGGW
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQ---RKIPVAEANGIAYVQPALDTNSF---------VPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISS-------PTGTWK--------HNSTGYASYDSNSSFGDL------------QENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGEDDIDSALNELQITLEGPG-----GGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPLTVNPRSVEPMDYLSPKMMRKL-SSKAVQRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQD-ENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGW 707          
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Match: AAF47838.1 (fermitin 1, isoform A [Drosophila melanogaster])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 339/749 (45.26%), Postives = 489/749 (65.29%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP-PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQP--------SEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSA---DGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            + +W L +L+TDLQVEK LRVKGD H+GGVM+ LV+  ++  DWSDHALWWP +N WL +TR TLDQ  + +D+ ++FTPMHK +R+Q+PDLRY+D  +++S                     LS CKPL  +HLK N+    Q   +K  +   N +     +  + +F            T   + S   +DR      +    +   R+ +T      SS         GT          H+ + + +   N SF  L            + +LAMSP  PS + +  L+RPK+ VE+AR+NV WLDSSLS+MEQGV+++DTL LR+K+++FFDLNPK D VRIN +YEQ KW+ILNE ++ TEEE ++FAALQ QV+   ++  P        S ++   +DD+D+AL++LQI+LEG             +I  IP LSD+L++++P+RFTLKG+K ++F  ++L L  YK++++S     + S+NLKGCEV+P+VN+++ ++ I+L +PS       S++++RC +E+QY+KWMAACRLAAKG+++A +SYDSEV SI + L MQ PA    +  +  +V+  +Y++ + +RK+  SK   RILEAH+NV+ L+L++AKM Y++A+QSLPD+GV+LF+++F G KK+ELLGVA+NR+MRM+L TGD IKTWRYNT+KAWN+NW  K MMIQL D +N++F   SADCKVVHEFIGGYIF+SMR+K+ NQ ++EE FHKLTGGW
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQ---RKIPVAEANGIAYVQPALDTNSF---------VPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISS-------PTGTWK--------HNSTGYASYDSNSSFGDL------------QENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGIDTSSQETGGEDDIDSALNELQITLEGPG-----GGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPLTVNPRSVEPMDYLSPKMMRKL-SSKAVQRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQD-ENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGW 707          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|942302599|gb|JAN33232.1| (Fermitin family [Daphnia magna] >gi|1022761173|gb|KZS07187.1| Fermitin 2 [Daphnia magna])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 416/753 (55.25%), Postives = 528/753 (70.12%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSV-STSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRN--YRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKM------------PKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSWEL +LVTDL VE+ LRVKGD H+GGVM++LV ELDIA DWSDHALWWP RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS  KPL +D L++NY +       K+R     S +T+      G      N+ + ++ +TS  +P          NT I  S A +    S+   +G+  +N  Y +   NG   ++   S F        L  N S +   N + SN+    + SLA+SP  PS EA+  L+RPKNL+ERAR+NVAWLDSSLS+MEQGV+++ TLLLRYKFYSF+DLNPK D VRIN IYEQ KW +LNE +DCTEEEM++F ALQLQV+L +  PQP  E  D DDD+DAALSDLQ +LEG    S       +DI +IP LSD+LRYM+PKRFTLKGFK ++FV K+L L A+KN+ DS +  T   + L+GCEV+P+VN+S+ ++GI+L +P  DGMS++++RC SE QY+KWMAACRLAAKGKTMA ASYD+EV SILAFL+MQ PA  P INPS+L++  ++YVA RF+RK+                +  RILEAH+NVKDL+L EAK+NY+KA+QSLP+YGVSLFVV+F  ++K+ELLGVA NRLMRM + TGD IKTWRYNT+KAWN+NWE KHMM+Q  + +NVIF CLSADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:   10 DGSWELKVLVTDLAVERCLRVKGDLHIGGVMLRLVEELDIAADWSDHALWWPTRNCWLSRTRSTLDQYGVQADALLHFTPMHKTLRVQLPDLRYLDCRVDFSVKTFNAVVTLCKELGIRHPEELSFAKPLESDDLRYNYRERESITSHKKRSAANTSADTNTFIGHHGNSTHSSNNSLDNIKATSGCTPVLP-------NTTINRSPAPVPTPISSPVNSGTWRKNSPYSTPASNG---HNVTPSIFD-------LTANNSLNTTGNTSFSNM----DMSLALSPATPSQEARSRLLRPKNLIERARLNVAWLDSSLSIMEQGVREYSTLLLRYKFYSFYDLNPKYDAVRINQIYEQAKWQLLNEEIDCTEEEMLMFGALQLQVNLQSARPQPLSETRDGDDDIDAALSDLQDTLEGTHVHS-----NTSDITSIPELSDYLRYMKPKRFTLKGFKRYWFVCKDLQLFAFKNKGDSGSGPT-HQIPLRGCEVTPDVNLSQDKFGIRLEVPGPDGMSEMWIRCDSEAQYAKWMAACRLAAKGKTMADASYDAEVSSILAFLAMQKPAPAPAINPSSLDIQPDDYVAPRFIRKLKNKSCAGCTGTQADKSVSTRILEAHTNVKDLSLTEAKLNYIKAWQSLPEYGVSLFVVKFMNQRKEELLGVAFNRLMRMEMTTGDHIKTWRYNTMKAWNVNWEVKHMMVQF-EEENVIFSCLSADCKVVHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 734          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|321463775|gb|EFX74788.1| (hypothetical protein DAPPUDRAFT_199712 [Daphnia pulex])

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 411/739 (55.62%), Postives = 521/739 (70.50%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSV-STSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSWEL +LVTDL VE+ LRVKGD H+GGVM++LV ELDIA DWSDHALWWP RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS  KPL +D L++NY +       K+R    NS +T+      G      N+ + ++ +TS  +P          NT I  S A +    S+ S                                 GT +KN   +   N + SN+    + SLA+SP  PS EA+  L+RPKNL+ERAR+NVAWLDSSLS+MEQGV+++  LLLRYKFYSF+DLNPK D VRIN IYEQ KW +LNE +DCTEEEM++F ALQLQV+L +  PQP  +  D DDD+DAALSDLQ +LEG    S       +DI +IP LSD LRYM+PKRFTLKGFK ++FV K+L L A+KN+ +S     +  + L+GCEV+P+VN+S+ ++GI+L +P  DGMS++++RC SE QY+KWMAACRLAAKGKTMA ASYD+EV SILAFL+MQ PA  P INPS+L++  ++YVA RF+RK+ K+K+  RILEAH+NVKDL+L EAK+NY+KA+QSLP+YGVSLFVV+F G++K+ELLGVA NRLMRM+L TGD IKTWRYNT+KAWN+NWE KHMM+Q  + ++VIF CLSADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:   10 DGSWELKVLVTDLSVERCLRVKGDLHIGGVMLRLVEELDIAADWSDHALWWPARNCWLSRTRSTLDQYGVQADALLHFTPMHKTLRVQLPDLRYLDCRVDFSVKTFNAVVTLCKELGIRHPEELSFAKPLESDDLRYNYRERESNTSHKKRTVANNSADTNTFIGHHGNSTHSSNNSLDNIKATSGCTPVLP-------NTTINRSPAPVPTPISSPS---------------------------------GTWRKNSPLNTTANSSFSNM----DMSLALSPATPSQEARSRLLRPKNLIERARLNVAWLDSSLSIMEQGVREYSALLLRYKFYSFYDLNPKYDAVRINQIYEQAKWQLLNEEIDCTEEEMLMFGALQLQVNLQSAQPQPLSDTRDGDDDIDAALSDLQDTLEGTHVHS-----NTSDITSIPELSDFLRYMKPKRFTLKGFKRYWFVCKDLQLFAFKNKGES-GSGPAHQIPLRGCEVTPDVNLSQDKFGIRLEVPGPDGMSEMWIRCDSEAQYAKWMAACRLAAKGKTMADASYDAEVSSILAFLAMQKPAPAPAINPSSLDIQPDDYVAPRFIRKL-KNKVSTRILEAHTNVKDLSLTEAKLNYIKAWQSLPEYGVSLFVVKFMGQRKEELLGVAFNRLMRMDLTTGDHIKTWRYNTMKAWNVNWEVKHMMVQF-EEESVIFSCLSADCKVVHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 696          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|942406379|gb|JAN85119.1| (Fermitin family [Daphnia magna])

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 420/800 (52.50%), Postives = 533/800 (66.62%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSV-STSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRN--YRSLGRNGTLDYHRRKSDFHSQSN------------------------HGTLKKNG-----SFSPLVNGNDSNLKSGSEWS-----LAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLL-------------------------LRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSWEL +LVTDL VE+ LRVKGD H+GGVM++LV ELDIA DWSDHALWWP RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS  KPL +D L++NY +       K+R     S +T+      G      N+ + ++ +TS  +P          NT I  S A +    S+   +G+  +N  Y +   NG   ++   S F   +N                        + T   NG     S   L   N  N    + +S     LA+SP  PS EA+  L+RPKNL+ERAR+NVAWLDSSLS+MEQGV+++ TLL                         LRYKFYSF+DLNPK D VRIN IYEQ KW +LNE +DCTEEEM++F ALQLQV+L +  PQP  E  D DDD+DAALSDLQ +LEG    S       +DI +IP LSD+LRYM+PKRFTLKGFK ++FV K+L L A+KN+ DS +  T   + L+GCEV+P+VN+S+ ++GI+L +P  DGMS++++RC SE QY+KWMAACRLAAKGKTMA ASYD+EV SILAFL+MQ PA  P INPS+L++  ++YVA RF+RK+ K+K+  RILEAH+NVKDL+L EAK+NY+KA+QSLP+YGVSLFVV+F  ++K+ELLGVA NRLMRM + TGD IKTWRYNT+KAWN+NWE KHMM+Q  + +NVIF CLSADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:   10 DGSWELKVLVTDLAVERCLRVKGDLHIGGVMLRLVEELDIAADWSDHALWWPTRNCWLSRTRSTLDQYGVQADALLHFTPMHKTLRVQLPDLRYLDCRVDFSVKTFNAVVTLCKELGIRHPEELSFAKPLESDDLRYNYRERESITSHKKRSAANTSADTNTFIGHHGNSTHSSNNSLDNIKATSGCTPVLP-------NTTINRSPAPVPTPISSPVNSGTWRKNSPYSTPASNG---HNVTPSIFDLTANNXXXXXXXXXXXXXXXXXXXXXXPYSTPASNGHNVTPSIFDLTANNSLNTTGNTSFSNMDMSLALSPATPSQEARSRLLRPKNLIERARLNVAWLDSSLSIMEQGVREYSTLLFLNVAWLDSSLSIMEQGVREYSTLLLRYKFYSFYDLNPKYDAVRINQIYEQAKWQLLNEEIDCTEEEMLMFGALQLQVNLQSARPQPLSETRDGDDDIDAALSDLQDTLEGTHVHS-----NTSDITSIPELSDYLRYMKPKRFTLKGFKRYWFVCKDLQLFAFKNKGDSGSGPT-HQIPLRGCEVTPDVNLSQDKFGIRLEVPGPDGMSEMWIRCDSEAQYAKWMAACRLAAKGKTMADASYDAEVSSILAFLAMQKPAPAPAINPSSLDIQPDDYVAPRFIRKL-KNKVSTRILEAHTNVKDLSLTEAKLNYIKAWQSLPEYGVSLFVVKFMNQRKEELLGVAFNRLMRMEMTTGDHIKTWRYNTMKAWNVNWEVKHMMVQF-EEENVIFSCLSADCKVVHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 791          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|1058004086|gb|JAS05727.1| (hypothetical protein g.42184 [Clastoptera arizonana] >gi|1058054787|gb|JAS31055.1| hypothetical protein g.42183 [Clastoptera arizonana])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 404/754 (53.58%), Postives = 533/754 (70.69%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIAN-----STATLGRK-----TSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGS-EWSLAMSPP-PSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD----DDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKN-EEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSW L + VTDLQV++ LRVKGD H+GGVM++LV +LDIAMDWSDHALWWP RN WL +TR T+DQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LSLCKPL  +HLK+N  D     G K+   +  S                G  H+ +                DTNTFI+N     ST++L +         T  + SS+     +G+ GT            ++N   L  NGS++P  N     L +GS + SLA SPP PS EA+ +L+RPK L+ERARMNV+WLDSSLS+MEQG+++FDTL LR+KF+SF+DLNPK+D VRIN IYEQ KW +LNE +DCTEEE ++FAALQ+Q++L A +PQP+ ++       DD++DAAL+DLQ+SLEG +H S      +NDI  +P L D+LR+++PKRFTLK FK ++F  ++L L  YK+ EE +      + +NL+GCEV+PEVN+ + +Y IKL + S+DGMS++++RC  E+QY+KWMAACRLAAKG+++A +SY++EV SILAFL MQHPA TP INP++L++  ++YVASR+ RK+ K KL  RILEAH+NVKDL LIEAK+NY+KA+QSLPD+G+SLF+V+F G KK+ELLGVA NRLMRM+L TGD +KTWRYNT+KAWN+NWE KHMM+Q  +G N+IF CLSADCKV+HEFIGGYIFLS R+K+ANQ ++E+ FHKLTGGW
Sbjct:   10 DGSWNLRVYVTDLQVDRSLRVKGDLHIGGVMLRLVEDLDIAMDWSDHALWWPARNLWLTRTRSTIDQYGVQADAVLHFTPMHKTLRVQLPDLRYLDCRVDFSIKTFNTVIQLCKELGIRHPEELSLCKPLEPNHLKYNLKDL---PGNKKNREMNGS----------------GPKHVPA----------------DTNTFISNQSPGGSTSSLDKSQPFLCAPMTPKHYSSTPISSPMGQTGTW----------KRNNQTDL--NGSYTPNGNVTSIELLNGSLDTSLAQSPPTPSHEARATLLRPKTLIERARMNVSWLDSSLSIMEQGIREFDTLRLRFKFFSFYDLNPKIDAVRINQIYEQAKWQLLNEELDCTEEEALMFAALQVQINLQAGLPQPNLDNNSTLSIADDEIDAALTDLQVSLEG-SHIS-----ASNDITQVPELYDYLRFLKPKRFTLKAFKRYWFTCRDLHLRLYKSREEANSGVQPLYDINLRGCEVTPEVNLGQGKYNIKLEVASSDGMSEMWIRCDMEEQYAKWMAACRLAAKGRSLADSSYEAEVASILAFLQMQHPAPTPAINPASLDIVPDDYVASRYARKL-KGKLVQRILEAHTNVKDLPLIEAKLNYIKAWQSLPDFGISLFIVKFMGHKKEELLGVAFNRLMRMDLNTGDHLKTWRYNTMKAWNVNWEVKHMMVQFEEG-NIIFACLSADCKVIHEFIGGYIFLSTRSKEANQALNEDLFHKLTGGW 708          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|1058218634|gb|JAT12833.1| (hypothetical protein g.42271 [Graphocephala atropunctata] >gi|1058226904|gb|JAT16968.1| hypothetical protein g.42283 [Graphocephala atropunctata])

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 400/751 (53.26%), Postives = 518/751 (68.97%), Query Frame = 0
Query:   14 DGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKN------GSFSPLVNGNDSNLK--SGS-EWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDED----DDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKN-EEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            DGSW L + VTDLQVE+ LRVKGD H+GGVM++LV +LDIAMDWSDHALWWP +N WL +TR T+DQY + AD  ++FTPMHK +R+QLPDLRY+DC +D+S                     LS CKPL  +HLK+N  D     GKKR       +N +N    +                             DTNTFIAN         S     GS  ++   +    T  ++         S  GT K+N      GS+SP +NGN + L+  +GS + SLA+SP PS EA+ SL+RPK LVE+ARMNV WLDSSLS+MEQGV++F+TL L++KF  F+DLNPK D VRIN IYEQ KW +LNE +DCTEEE ++F ALQ+QV+L A +PQPS ++       DD++DAALSDLQ++LEG    S I+ T  NDI  +P L D+LR+++PKRFTLK FK ++F  ++L L  YK+ EE       +  +NL GCEV+PEVN+S+ +YGIKL + S +GMS++Y+RC SE QY+KWMAACRLA+KG+++A ASY++EV +I  FL MQHPA    INP++L++  E+YVA R  +K+ K KL  RILEAH+NVKDL L+EAKMNY+KA+QSLPD+G+SLFVV+F G KK+ELLGVA N+LMRM++ TGD IKTW YNT+KAWN+NWE KHMM+Q  +G N+IF C SADCKV+HEFIGGYIFLSMR+K+ANQ ++++ FHKLTGGW
Sbjct:   10 DGSWNLRVYVTDLQVERSLRVKGDLHIGGVMLRLVEDLDIAMDWSDHALWWPAKNSWLTRTRSTIDQYGVQADALLHFTPMHKTLRVQLPDLRYLDCRVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDM---PGKKRE------MNGTNGKLMAA----------------------------DTNTFIANQ--------SPAGSTGSLDKSQPFMCAPVTPRHYTSTPISSPMSTTGTWKRNNNTDLNGSYSPAINGNVTTLEMLNGSLDSSLALSPAPSQEARSSLLRPKTLVEKARMNVGWLDSSLSIMEQGVREFNTLRLKFKFLCFYDLNPKTDAVRINQIYEQAKWMLLNEELDCTEEEALMFGALQVQVNLQAGLPQPSLDNSSLVSAADDEIDAALSDLQVTLEG----SHISGT--NDITQVPELYDYLRFLKPKRFTLKAFKRYWFTCRDLHLKMYKSREECGAGAAPTLDINLCGCEVTPEVNLSQNKYGIKLEVASPEGMSEMYIRCDSESQYAKWMAACRLASKGRSLADASYEAEVTNIQKFLQMQHPAPVAAINPASLDITPEDYVAPRIAKKL-KGKLVQRILEAHANVKDLALVEAKMNYIKAWQSLPDFGISLFVVKFMGHKKEELLGVAFNKLMRMDMSTGDHIKTWTYNTMKAWNVNWEVKHMMVQFEEG-NIIFACHSADCKVIHEFIGGYIFLSMRSKEANQSLNQDLFHKLTGGW 707          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|752880813|ref|XP_011257990.1| (PREDICTED: unc-112-related protein [Camponotus floridanus])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 403/758 (53.17%), Postives = 528/758 (69.66%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNH-GTLKKNGSFSPL-----VNGNDSN-----LKSGSEWSLAMSPPP-SVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD----DDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTS-FSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LRVKG+ H+GGVM++LV +LDIAMDWSDHALWWP+RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+R +DC +D+S                     LS CKPL  +HLK+N  D      KK+    KN                 G+ ++ +                DTNTFI  S +  G   ST S + SS      +  N         +   S  +H GT K+N + S L      N N+S      L  G   SLA SP   S E +  LIRPK+L+ERARMNVAWLDSSLS+MEQG+++FDTL L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A+VPQP+ +        +DD+DAAL+DLQ++LEG    S IN+   +DI  +P L D LR+ +PKRFTLK FK ++F  ++L L  YK+ E++    +  + +NL+GCEV+P+V++S+ RYGI+L +PSA+GM+++++RC +E QY+KWMAACRLAAKG+T+A ASY+SEV SI+AFL +Q PA  P INP++L++  E+YVASRF +K  K KL  RILEAH+NVKDL+LIEAK+NY+KA+QSLP+YG+SLF+VRF G+ KDELLG+A+NRLMRM L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +N+IF+C SADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:    5 GHEVDGSWVLRVYVTDLQVERSLRVKGELHIGGVMLRLVEDLDIAMDWSDHALWWPERNHWLTRTRSTLDQYGVAADALLHFTPMHKTLRVQLPDMRCLDCRVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDL---PAKKKIENQKN-----------------GHWNVPA----------------DTNTFIPVSQSPRG---STGSLDQSSPFMCAPVTPNN----RNHSTPISSPVSHTGTWKRNNNSSGLGSTGSFNANNSTMSLEALNGGLSESLAQSPTSISPETRTKLIRPKSLIERARMNVAWLDSSLSIMEQGIREFDTLRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASVPQPTYDSNGATSPIEDDIDAALTDLQVTLEG----SNINKG-PSDITQVPELCDELRFFKPKRFTLKAFKRYWFTCRDLQLRLYKSREEANGSESPVYVINLRGCEVTPDVHLSQGRYGIRLEVPSAEGMTEMWIRCDNEQQYAKWMAACRLAAKGRTLADASYESEVNSIIAFLQLQRPAPAPAINPNSLDIIPEDYVASRFAKKF-KGKLVQRILEAHANVKDLSLIEAKLNYIKAWQSLPEYGISLFIVRFTGKSKDELLGIANNRLMRMELHSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEENIIFECQSADCKVVHEFIGGYIFLSMRSKEANQTLNEEMFHKLTGGW 712          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|665804496|ref|XP_008550393.1| (PREDICTED: unc-112-related protein [Microplitis demolitor])

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 401/760 (52.76%), Postives = 526/760 (69.21%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNH-GTLKKNGSFSPL-----VNGNDSN-----LKSGSEWSLAMSP---PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD----DDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHT-SFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LRVKG+ H+GGVM++LV +LDIAMDWSDHALWWP RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+RY+DC +D+S                     LS CKPL  +HLK+N  D      KK+    KN                 G+ ++ +                DTNTFI  S +  G        NGS  ++   +    T +     +   S  +H GT K+N + S        N N+S      L  G   SLA SP    P V AK  LI+PKNLVERARMNVAWLDSSLS+MEQG++++D L L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A++PQPS E        +DD+DAAL+DLQ+SLEG    S  N T  +DI  +P L D+LR+ +PKRFTLK FK ++F  ++L L  YK  E+S +    ++ +NL+GCEV+P+V++S+ RYGI+L +PSADGM+++++RC +E QY+KWMAACRLAAKG+++A +SY+SEV SI AFL +Q PA  P I+P++LN+  E+YVA R+ +K+ + KL  RILEAH+NVKDL LIEAK+NY+KA+QSLP+YG+SLF+VRF G+ KDELLG+A+NRLMRM+L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +N+IF+C SADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:    5 GHEVDGSWVLRVYVTDLQVERNLRVKGELHIGGVMLRLVEDLDIAMDWSDHALWWPKRNHWLTRTRSTLDQYGVAADALLHFTPMHKTLRVQLPDMRYLDCRVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDL---PAKKKIENQKN-----------------GHWNVPA----------------DTNTFIPVSQSPQGS-------NGSLDQSSPFMCAPVTPNNRNHSTPISSPVSHTGTWKRNNNSSGFGSTGSFNANNSTMSLEALNGGMTESLAQSPSAASPDVHAK--LIKPKNLVERARMNVAWLDSSLSIMEQGIREYDILRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASMPQPSYESNGSPSLIEDDIDAALTDLQVSLEGS---SISNGT--SDITQVPELCDYLRFFKPKRFTLKAFKRYWFTCRDLQLRLYKTREESNSSEAPAYIINLRGCEVTPDVHLSQGRYGIRLEVPSADGMTEMWIRCDTEQQYAKWMAACRLAAKGRSLADSSYESEVNSITAFLQLQRPAPAPAISPTSLNITPEDYVAPRYSKKL-RGKLVQRILEAHANVKDLPLIEAKLNYIKAWQSLPEYGISLFIVRFTGKNKDELLGIANNRLMRMDLHSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEENIIFECQSADCKVVHEFIGGYIFLSMRSKEANQTLNEEMFHKLTGGW 712          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|1061112614|ref|XP_017882375.1| (PREDICTED: unc-112-related protein-like isoform X2 [Ceratina calcarata])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 402/760 (52.89%), Postives = 521/760 (68.55%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPL-----VNGNDSN-----LKSGSEWSLAMSPPP-SVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD-----DDDVDAALSDLQISLEGEAHRSFINETVNN---DIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LRVKG+ H+GGVM++LV +LDIA+DWSDHALWWP+RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+R +DC +D+S                     LS CKPL  +HLK+N  D      KK+  + KN                    H+ +                DTNTFI  S +  G   ST S + SS      +  N     +R  S   S    GT K+N + S        N N+S      L  G   SLA SP   S E +  LIRPKNLVERARMNVAWLDSSLS+MEQG+++FDTL L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A+VPQPS  D +      +DD+DAAL+DLQ++LEG          + N   DI  +P L D LR+++PKRFTLK FK ++   ++L L  YK  E++ +   +  +NL+GCEV+P+V++S+ RYGI+L +PSA+GM+++++RC +E QY+KWMAACRLAAKG+++A ASY+SEV SI AFL +Q PA  P INP+ L++  E+YVA RF++K  K KL  RILEAH+NVKDL+LIEAK+NY+KA+QSLP+YG+SLFVVRF G+ KDELLG+A+NRLMRM L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +++IF+C SADCKVVHEFIGGYIFLSMR+KDANQ ++EE FHKLTGGW
Sbjct:    5 GHEIDGSWVLRVYVTDLQVERSLRVKGELHIGGVMLRLVEDLDIAIDWSDHALWWPERNHWLTRTRSTLDQYGVAADAFLHFTPMHKTLRVQLPDMRCLDCKVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDL---PAKKKIESQKNGW------------------HVPA----------------DTNTFIPVSQSPRG---STGSLDQSSPFMCAPVTPN-----NRNHSTPISSPQTGTWKRNNNSSGFGSTGSFNANNSTTSLEVLNGGLSESLAQSPTSISPEVRSKLIRPKNLVERARMNVAWLDSSLSIMEQGIREFDTLRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASVPQPSCYDSNGASSPVEDDIDAALTDLQVTLEG--------SNIGNGPSDITQVPELCDFLRFLKPKRFTLKAFKRYWVTCRDLQLRLYKTREETNSESPAHVINLRGCEVTPDVHLSQGRYGIRLEVPSAEGMTEMWIRCDNEQQYAKWMAACRLAAKGRSLADASYESEVNSITAFLQLQRPAPAPAINPNALDIVPEDYVAPRFVKKF-KGKLVQRILEAHANVKDLSLIEAKLNYVKAWQSLPEYGISLFVVRFTGKSKDELLGIANNRLMRMELHSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEESIIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEEMFHKLTGGW 709          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|1061112612|ref|XP_017882374.1| (PREDICTED: unc-112-related protein-like isoform X1 [Ceratina calcarata])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 400/755 (52.98%), Postives = 518/755 (68.61%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDY---RQEEGKKRRITLKNSLNT--SNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSPPP-SVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD-----DDDVDAALSDLQISLEGEAHRSFINETVNN---DIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LRVKG+ H+GGVM++LV +LDIA+DWSDHALWWP+RN WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+R +DC +D+S                     LS CKPL  +HLK+N  D    ++ E +K    +    NT    S SP G             ST  L  S   +  P T     +ST      +S  S  G+  RN  S G   T                G+   N S + L       L  G   SLA SP   S E +  LIRPKNLVERARMNVAWLDSSLS+MEQG+++FDTL L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A+VPQPS  D +      +DD+DAAL+DLQ++LEG          + N   DI  +P L D LR+++PKRFTLK FK ++   ++L L  YK  E++ +   +  +NL+GCEV+P+V++S+ RYGI+L +PSA+GM+++++RC +E QY+KWMAACRLAAKG+++A ASY+SEV SI AFL +Q PA  P INP+ L++  E+YVA RF++K  K KL  RILEAH+NVKDL+LIEAK+NY+KA+QSLP+YG+SLFVVRF G+ KDELLG+A+NRLMRM L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +++IF+C SADCKVVHEFIGGYIFLSMR+KDANQ ++EE FHKLTGGW
Sbjct:    5 GHEIDGSWVLRVYVTDLQVERSLRVKGELHIGGVMLRLVEDLDIAIDWSDHALWWPERNHWLTRTRSTLDQYGVAADAFLHFTPMHKTLRVQLPDMRCLDCKVDFSVKTFNAVINLCKELGIRHPEELSFCKPLEPNHLKYNLKDLPAKKKIESQKNGWHVPADTNTFIPVSQSPRG-------------STGSLDQSSPFMCAPVTPNNRNHSTPI----SSPVSQTGTWKRNNNSSGFGST----------------GSFNANNSTTSL-----EVLNGGLSESLAQSPTSISPEVRSKLIRPKNLVERARMNVAWLDSSLSIMEQGIREFDTLRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASVPQPSCYDSNGASSPVEDDIDAALTDLQVTLEGS--------NIGNGPSDITQVPELCDFLRFLKPKRFTLKAFKRYWVTCRDLQLRLYKTREETNSESPAHVINLRGCEVTPDVHLSQGRYGIRLEVPSAEGMTEMWIRCDNEQQYAKWMAACRLAAKGRSLADASYESEVNSITAFLQLQRPAPAPAINPNALDIVPEDYVAPRFVKKF-KGKLVQRILEAHANVKDLSLIEAKLNYVKAWQSLPEYGISLFVVRFTGKSKDELLGIANNRLMRMELHSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEESIIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEEMFHKLTGGW 711          
BLAST of EMLSAG00000000006 vs. nr
Match: gi|1000737344|ref|XP_015591185.1| (PREDICTED: unc-112-related protein-like [Cephus cinctus])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 398/755 (52.72%), Postives = 525/755 (69.54%), Query Frame = 0
Query:   10 GVRLDGSWELTLLVTDLQVEKILRVKGDHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDY----RQEEGKKRRITLKNSLNT--SNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGNDSNLKSGSEWSLAMSP---PPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDD----DDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYH-TSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            G  +DGSW L + VTDLQVE+ LR+KG+ H+GGVM++LV +LDIAMDWSDHALWWP RN+WL +TR TLDQY + AD  ++FTPMHK +R+QLPD+R +DC +D+S                     LS CKPL  +HLK+N  D     + E  K     +    NT    S SP G             ST  L  S   +  P T T   +ST      +S  S  G+  +N  S G   T  ++   S    ++ +G L +                     SLA SP    P + +K  LIRPK LVERARMNVAWLDSSLS+MEQG++++DTL L++KFYSF+DLNPK D VRIN+IYEQ KW +L E +DCTEEEM++FAALQ+QV+L A+VPQPS +        +DD+DAAL+DLQ++LEG    S IN +  +DI  +P L D+LR+++PKRFTLK FK ++F  ++L L  YK +ED+ +    +  +NL+GCEV+P+V++S+ RYGI+L +PSA+GM+++++RC +E QY+KWMAACRLAAKG+T+A ASY+SEV SI+AFL +Q PA  P INP++L++  E+YVA RF +K  K KL  RILEAH+NVKDL+L+EAK+NY+KA+QSLP+YG+SLFVVRF G+ KDELLG+A+NRLMRM+L +GD +KTWRYNT+KAWN+NWE KHMM+Q  + +N+IF+C SADCKVVHEFIGGYIFLSMR+K+ANQ ++EE FHKLTGGW
Sbjct:    5 GHEVDGSWVLRVFVTDLQVERSLRIKGELHIGGVMLRLVEDLDIAMDWSDHALWWPTRNQWLTRTRSTLDQYGVAADALLHFTPMHKTLRVQLPDMRCLDCRVDFSVKTFNAVINLCKEIGIRHPEELSFCKPLEPNHLKYNLKDLPAKKKIENQKNGHWNVPADTNTFIPVSQSPRG-------------STDSLDQSSPFMCAPVTPTNRNHSTPI----SSPVSQPGTWKKNNNSSGFGSTGSFNANNSTMSLEALNGGLTE---------------------SLAQSPTTVSPDIRSK--LIRPKTLVERARMNVAWLDSSLSIMEQGIREYDTLRLKFKFYSFYDLNPKTDAVRINMIYEQAKWQLLAEEIDCTEEEMLMFAALQVQVNLQASVPQPSYDSNGASSPVEDDIDAALTDLQVTLEG----SNINNS-PSDITQVPELCDYLRFLKPKRFTLKAFKRYWFTCRDLQLRLYKTKEDTNSSEKPAHIINLRGCEVTPDVHLSQGRYGIRLEVPSAEGMTEIWIRCDTEQQYAKWMAACRLAAKGRTLADASYESEVDSIIAFLQLQRPAPAPAINPNSLDITPEDYVAPRFAKKF-KGKLVQRILEAHANVKDLHLVEAKLNYIKAWQSLPEYGISLFVVRFTGKNKDELLGIANNRLMRMDLNSGDHLKTWRYNTMKAWNVNWEVKHMMVQF-EEENIIFECQSADCKVVHEFIGGYIFLSMRSKEANQTLNEEMFHKLTGGW 712          
BLAST of EMLSAG00000000006 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold232_size243569-snap-gene-0.14 (protein:Tk07014 transcript:maker-scaffold232_size243569-snap-gene-0.14-mRNA-1 annotation:"fermitin family homolog 2-like")

HSP 1 Score: 944.11 bits (2439), Expect = 0.000e+0
Identity = 482/726 (66.39%), Postives = 571/726 (78.65%), Query Frame = 0
Query:   37 DHHVGGVMIKLVNELDIAMDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNGND----SNLK-----SGSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNNDIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSYNYH--TSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGWH 730
            DH V G         +IAMDWSDHA+WWP++N WL+KTRWTLDQ+N+TAD  ++FTPMHK +RIQLPDLRY+DC +D+S                     +SL KP+A +HLKFNYG+YR +E KKRR+TL             GT      H +H  S  D+S    +VDR DTNTF+ANS ATLGRK S+ SW  S ++ +RSLGRNGTLD+HRR+S+ HS   +GT + NG+ SP  NGN     ++L      SGSEWSLA+SPPPS EAKYS++RPKNL ERAR+NV WLDSSLSLMEQG++DFDTLLLR+KFYSF++LN K D VRINLIYEQ KW ILNE +DCTEEEMMLFAALQLQV L ANV QP+++DE++DD   AAL+DLQISLEG       N     DI+A+P L D+LRY+RPKRFTLKG K  YFVL++L L A+K ++DS +Y    SF+VNLKGCEVSP VNI++ +YGIKLAIPS DGMSDL+LRC SE QYS+WMAACRLAAKGKTMA   ++SEVKSI AFLSMQHPA+ PVINP+TL+++VEEYVASRFLRKM KS+LR++ILEAH+NVKDLNLIEAKMN++KA+QSLPDYGVSLFV RF GEKK+EL+G+A NRLMRMNLQTGD IKTWRYNTIKAWN+NWETKHMMIQLGDGKNVIFK LS+DCKVVHEFIGGYIFLSMR+KDANQ +DEE FHKLTGGW+
Sbjct:   20 DHPVSGP--------NIAMDWSDHAIWWPEKNIWLDKTRWTLDQFNLTADAIIHFTPMHKMLRIQLPDLRYIDCNVDFSIRTFTAVINICTELEIRHPEEMSLSKPVAEEHLKFNYGEYRIQEEKKRRVTL-------------GTMPAHSQHTLHHQSALDIS--SPVVDRADTNTFVANS-ATLGRKISSNSWTSSPAK-FRSLGRNGTLDHHRRRSE-HSGPYNGTFRPNGTLSPYSNGNGHLSTTSLTPGFPGSGSEWSLAISPPPSQEAKYSIVRPKNLTERARLNVGWLDSSLSLMEQGIRDFDTLLLRFKFYSFYNLNTKTDPVRINLIYEQAKWQILNEGIDCTEEEMMLFAALQLQVGLQANVAQPNDDDENEDDID-AALTDLQISLEGGT-----NNANGIDIMAVPSLGDYLRYLRPKRFTLKGHKRCYFVLRDLQLCAFKTKDDSQDYSRGPSFTVNLKGCEVSPGVNIAQGKYGIKLAIPSQDGMSDLWLRCESEGQYSQWMAACRLAAKGKTMADCGFESEVKSIQAFLSMQHPANAPVINPATLDINVEEYVASRFLRKM-KSRLRNKILEAHTNVKDLNLIEAKMNFIKAWQSLPDYGVSLFVARFLGEKKNELMGIAFNRLMRMNLQTGDHIKTWRYNTIKAWNVNWETKHMMIQLGDGKNVIFKTLSSDCKVVHEFIGGYIFLSMRSKDANQQLDEELFHKLTGGWN 712          
BLAST of EMLSAG00000000006 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold232_size243569-snap-gene-0.17 (protein:Tk07015 transcript:maker-scaffold232_size243569-snap-gene-0.17-mRNA-1 annotation:"unc-112-related protein")

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 408/720 (56.67%), Postives = 506/720 (70.28%), Query Frame = 0
Query:   55 MDWSDHALWWPDRNKWLEKTRWTLDQYNITADTCVYFTPMHKNIRIQLPDLRYVDCVMDYS---------------------LSLCKPLATDHLKFNYGDYRQEEGKKRRITLKNSLNTSNSSSPSGTFRRKGNHHIHSVSTSDLSPSXAIVDRPDTNTFIANSTATLGRKTSTTSWNGSSSRNYRSLGRNGTLDYHRRKSDFHSQSNHGTLKKNGSFSPLVNG-----------------NDSNLKS--GSEWSLAMSPPPSVEAKYSLIRPKNLVERARMNVAWLDSSLSLMEQGVKDFDTLLLRYKFYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQVSLXANVPQPSEEDEDDDDDVDAALSDLQISLEGEAHRSFINETVNN--DIVAIPVLSDHLRYMRPKRFTLKGFKGHYFVLKELALVAYKNEEDSY-NYHTSFSVNLKGCEVSPEVNISRKRYGIKLAIPSADGMSDLYLRCISEDQYSKWMAACRLAAKGKTMAXASYDSEVKSILAFLSMQHPASTPVINPSTLNVDVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVVRFHGEKKDELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGD--GKNVIFKCLSADCKVVHEFIGGYIFLSMRNKDANQIIDEEQFHKLTGGW 729
            MDWSDHA+WWP++N WL+KTRWTLDQYNITAD  +YFTPMHK +R+QLPDLR +DC +D+S                     LSLCKPL  D LK NY          +    K           +G                         +R DTNTFI+ +    GR+  +   NGS +   RS  +NG   ++         SN GTL +NG++SP  NG                 N S L +  G + SLA SPPPS +AK   + PK LVE+ARMNV WLDSSLS+MEQGV +FDTLLLR+K+YSF+DL+PK D VRIN IYEQ KW ILNE MDCTEEEM+LFAALQLQV+L +NV QP +  E +DDDVDAAL+DL+ISLEG         ++NN  ++   P L+D LRY RPKRFTLK FK  +FVL++L L A+++ + ++     + SVNLKGCEV+PE+NI++++Y IKL +PSA+GM++++LRC SE QY+KWMAACRLAAKGK++A +SYD+EVKSI AFLSMQHPA+ PVINP TL+++VEEYVA RFLRK+ KSKLR RILEA +NVK+LNL+EAKMN++KA+QSLP YGVSLFVV+FHGEKK+ELLGV+ N++MRM L  GD IKTWR++T+KAWN+NWETKHMMIQL D   +NVIF CLSADCKVVHEFIGGYIFLSMR+KDANQ ++EE FHKLTGGW
Sbjct:    1 MDWSDHAIWWPEKNMWLDKTRWTLDQYNITADAIIYFTPMHKTLRVQLPDLRIIDCNVDFSVRTFNASINLCKDLGIRHPEELSLCKPLEQDDLKQNY----------QETPKKKHPPPPTKDGKTG-------------------------ERIDTNTFISKN----GRQYHS---NGSLNGTLRSSNKNGAAPFY---------SNPGTL-RNGNYSPYTNGHTPTTPPFQNASSQGALNSSVLSAIDGGDLSLAQSPPPSQDAKAVQLHPKTLVEKARMNVGWLDSSLSIMEQGVSEFDTLLLRFKYYSFYDLSPKYDAVRINQIYEQAKWQILNEEMDCTEEEMLLFAALQLQVTLQSNVAQPHDLFE-EDDDVDAALNDLEISLEG---------SLNNGHNMTKTPFLADTLRYFRPKRFTLKSFKRLHFVLRDLNLNAFRSSDMAHKGSEPTVSVNLKGCEVTPEINIAQQKYQIKLEVPSAEGMTEMWLRCDSEGQYAKWMAACRLAAKGKSLADSSYDAEVKSIQAFLSMQHPANAPVINPETLDINVEEYVAPRFLRKL-KSKLRQRILEAQANVKNLNLLEAKMNFIKAWQSLPGYGVSLFVVKFHGEKKEELLGVSCNKIMRMTLNNGDHIKTWRFSTMKAWNVNWETKHMMIQLDDERNENVIFNCLSADCKVVHEFIGGYIFLSMRSKDANQQLNEEMFHKLTGGW 657          
BLAST of EMLSAG00000000006 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold475_size161908-snap-gene-0.21 (protein:Tk07975 transcript:maker-scaffold475_size161908-snap-gene-0.21-mRNA-1 annotation:"Talin-1")

HSP 1 Score: 64.3142 bits (155), Expect = 1.148e-10
Identity = 36/149 (24.16%), Postives = 77/149 (51.68%), Query Frame = 0
Query:  567 DVEEYVASRFLRKMPKSKLRHRILEAHSNVKDLNLIEAKMNYLKAFQSLPDYGVSLFVV--RFHGEKK--DELLGVASNRLMRMNLQTGDPIKTWRYNTIKAWNINWETKHMMIQLGDGKNVIFKCLSADCKVVHEFIGGYIFLSMRNK 711
            D+ E++   +LR    +K+  +I + H  +     I+AK+ Y+K  + LP +GV  F+V  +  G  +    LLGV  + ++R++ +T + +KTW   T++ W  +       +  GD ++  +   + + + + + I GYI + ++ +
Sbjct:  284 DLREFLPQSYLRA---NKIEKKIFQEHKKLFGTTEIDAKVKYVKLARGLPTFGVHFFLVKEKMRGRNRLVPRLLGVTKDSVLRLDEKTKEILKTWPLTTVRRWAASPNV--FTLDFGDYQDQYYSVQTTEGEQISQLIAGYIDIILKRR 427          

HSP 2 Score: 54.6842 bits (130), Expect = 1.057e-7
Identity = 29/76 (38.16%), Postives = 47/76 (61.84%), Query Frame = 0
Query:  298 VAWLDSSLSLMEQGVKDFDTLLLRYK-FYSFFDLNPKMDGVRINLIYEQLKWTILNENMDCTEEEMMLFAALQLQV 372
            V W+D   +L EQG+ + D LLL+ K FYS  +++ + D V++NL+YEQ K  +L+       ++ + F ALQ Q+
Sbjct:  194 VNWVDHGRTLREQGIGEIDVLLLKRKYFYSDANIDSR-DPVQLNLLYEQAKEAVLDGTHPVRLDDAVQFGALQSQI 268          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000006 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+046.75symbol:Fit2 "Fermitin 2" species:7227 "Drosophila ... [more]
-0.000e+045.26symbol:Fit1 "Fermitin 1" species:7227 "Drosophila ... [more]
-0.000e+042.80symbol:PLEKHC1 "Uncharacterized protein" species:9... [more]
-0.000e+041.41symbol:unc-112 species:6239 "Caenorhabditis elegan... [more]
-0.000e+041.41symbol:unc-112 "Protein unc-112" species:6239 "Cae... [more]
-0.000e+041.61symbol:fermt2 "fermitin family homolog 2 (Drosophi... [more]
-0.000e+040.53symbol:FERMT1 "Uncharacterized protein" species:90... [more]
-2.236e-15648.13symbol:FERMT1 "Fermitin family homolog 1" species:... [more]
-1.070e-15547.51symbol:Fermt1 "fermitin family member 1" species:1... [more]
-1.575e-15548.42symbol:FERMT1 "Fermitin family homolog 1" species:... [more]

Pages

back to top
BLAST of EMLSAG00000000006 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 23
Match NameE-valueIdentityDescription
gi|592929146|gb|GAXK01029399.1|0.000e+057.97TSA: Calanus finmarchicus comp150873_c0_seq1 trans... [more]
gi|592947235|gb|GAXK01011318.1|0.000e+055.56TSA: Calanus finmarchicus comp22292_c3_seq1 transc... [more]
gi|592906502|gb|GAXK01051873.1|3.384e-941.00TSA: Calanus finmarchicus comp28518_c0_seq4 transc... [more]
gi|592906503|gb|GAXK01051872.1|3.385e-941.00TSA: Calanus finmarchicus comp28518_c0_seq3 transc... [more]
gi|592906504|gb|GAXK01051871.1|3.392e-941.00TSA: Calanus finmarchicus comp28518_c0_seq2 transc... [more]
gi|592906505|gb|GAXK01051870.1|3.393e-941.00TSA: Calanus finmarchicus comp28518_c0_seq1 transc... [more]
gi|592943246|gb|GAXK01015307.1|8.301e-724.52TSA: Calanus finmarchicus comp631113_c0_seq2 trans... [more]
gi|592943247|gb|GAXK01015306.1|8.317e-724.52TSA: Calanus finmarchicus comp631113_c0_seq1 trans... [more]
gi|592943242|gb|GAXK01015311.1|6.782e-433.33TSA: Calanus finmarchicus comp631113_c0_seq6 trans... [more]
gi|592943243|gb|GAXK01015310.1|8.628e-433.33TSA: Calanus finmarchicus comp631113_c0_seq5 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000006 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000000060.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:2069... [more]
EMLSAP000000108090.000e+054.39pep:novel supercontig:LSalAtl2s:LSalAtl2s716:83456... [more]
EMLSAP000000093606.830e-824.58pep:novel supercontig:LSalAtl2s:LSalAtl2s599:22823... [more]
back to top
BLAST of EMLSAG00000000006 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
gi|41018372|sp|Q9VZI3.1|UN112_DROME0.000e+045.26RecName: Full=Unc-112-related protein; AltName: Fu... [more]
gi|41018395|sp|Q18685.1|UN112_CAEEL0.000e+041.41RecName: Full=Protein unc-112; AltName: Full=Mitog... [more]
gi|510479189|sp|F1Q8X5.1|FERM2_DANRE0.000e+041.61RecName: Full=Fermitin family homolog 2; AltName: ... [more]
gi|75061776|sp|Q5R8M5.1|FERM1_PONAB3.538e-15848.13RecName: Full=Fermitin family homolog 1; AltName: ... [more]
gi|26392456|sp|Q9BQL6.1|FERM1_HUMAN2.512e-15748.42RecName: Full=Fermitin family homolog 1; AltName: ... [more]
gi|341941120|sp|P59113.4|FERM1_MOUSE3.156e-15648.13RecName: Full=Fermitin family homolog 1; AltName: ... [more]
gi|38258220|sp|Q96AC1.1|FERM2_HUMAN2.981e-15449.69RecName: Full=Fermitin family homolog 2; AltName: ... [more]
gi|38258078|sp|Q8CIB5.1|FERM2_MOUSE3.427e-15249.48RecName: Full=Fermitin family homolog 2; AltName: ... [more]
gi|118597389|sp|Q32LP0.1|URP2_BOVIN1.053e-14847.94RecName: Full=Fermitin family homolog 3; AltName: ... [more]
gi|41018469|sp|Q8K1B8.1|URP2_MOUSE1.420e-14445.88RecName: Full=Fermitin family homolog 3; AltName: ... [more]

Pages

back to top
BLAST of EMLSAG00000000006 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX74788.10.000e+055.62hypothetical protein DAPPUDRAFT_199712 [Daphnia pu... [more]
XP_392367.30.000e+052.82PREDICTED: unc-112-related protein [Apis mellifera... [more]
gb|KYB26554.1|0.000e+050.99Unc-112-related protein-like Protein [Tribolium ca... [more]
gb|EFA07132.1|0.000e+050.72Unc-112-related protein-like Protein [Tribolium ca... [more]
gb|EEC14011.1|0.000e+051.77conserved hypothetical protein, partial [Ixodes sc... [more]
EAA01071.20.000e+047.69AGAP002054-PA [Anopheles gambiae str. PEST][more]
AAF49380.10.000e+046.75fermitin 2 [Drosophila melanogaster][more]
EEB19040.10.000e+049.86conserved hypothetical protein [Pediculus humanus ... [more]
AAG22245.10.000e+045.26fermitin 1, isoform B [Drosophila melanogaster][more]
AAF47838.10.000e+045.26fermitin 1, isoform A [Drosophila melanogaster][more]

Pages

back to top
BLAST of EMLSAG00000000006 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|942302599|gb|JAN33232.1|0.000e+055.25Fermitin family [Daphnia magna] >gi|1022761173|gb|... [more]
gi|321463775|gb|EFX74788.1|0.000e+055.62hypothetical protein DAPPUDRAFT_199712 [Daphnia pu... [more]
gi|942406379|gb|JAN85119.1|0.000e+052.50Fermitin family [Daphnia magna][more]
gi|1058004086|gb|JAS05727.1|0.000e+053.58hypothetical protein g.42184 [Clastoptera arizonan... [more]
gi|1058218634|gb|JAT12833.1|0.000e+053.26hypothetical protein g.42271 [Graphocephala atropu... [more]
gi|752880813|ref|XP_011257990.1|0.000e+053.17PREDICTED: unc-112-related protein [Camponotus flo... [more]
gi|665804496|ref|XP_008550393.1|0.000e+052.76PREDICTED: unc-112-related protein [Microplitis de... [more]
gi|1061112614|ref|XP_017882375.1|0.000e+052.89PREDICTED: unc-112-related protein-like isoform X2... [more]
gi|1061112612|ref|XP_017882374.1|0.000e+052.98PREDICTED: unc-112-related protein-like isoform X1... [more]
gi|1000737344|ref|XP_015591185.1|0.000e+052.72PREDICTED: unc-112-related protein-like [Cephus ci... [more]

Pages

back to top
BLAST of EMLSAG00000000006 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 3
Match NameE-valueIdentityDescription
maker-scaffold232_size243569-snap-gene-0.140.000e+066.39protein:Tk07014 transcript:maker-scaffold232_size2... [more]
maker-scaffold232_size243569-snap-gene-0.170.000e+056.67protein:Tk07015 transcript:maker-scaffold232_size2... [more]
maker-scaffold475_size161908-snap-gene-0.211.148e-1024.16protein:Tk07975 transcript:maker-scaffold475_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:20696..26805 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteUnc-112-related protein
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1003-snap-gene-0.21
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000006 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000006EMLSAT00000000006-695853Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:20696..26805+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000006-682772 ID=EMLSAG00000000006-682772|Name=EMLSAG00000000006|organism=Lepeophtheirus salmonis|type=gene|length=6110bp|location=Sequence derived from alignment at LSalAtl2s1003:20696..26805+ (Lepeophtheirus salmonis)
TTAAAATTGAAAATAGAAGATCCAGTATCTCTATGTAGTCTTTATTGTTT TTTATTGGAGATGAATTCAGAACGAGCTTTTGATTCTTAGGCTTAGAGGG TCGAGTTCCACTCCCTCCCTCACACATACTCTCCTTACACTCTTTTTTTT ATTCTGTCTCTTTGTTTCTTTTTGTCTCTTTTAGTTTATTTGTGTGTTTC TTTCTTTCCTTCCATTGAGTTTCTTTCTTTCTTTGGTCCCGTCTAGGGAT TTGTTTTGTTTTTGTTCCCCTTCGTTTTGTTTGTACTTCAATAATATCAT CATCGTTAATGAGACATTCCTTACTCATAACTTGAGACCATCGTCATGAT AAGTCCGTTCTACGAATAATCATAGATATCATCATGGAACACAATTACTC TTCGAATACTGGGGTTCGCCTGGATGGGAGTTGGGAGCTCACTCTTCTTG TCACGGATCTTCAAGTGGAGAAGATTCTCAGGGTCAAGGGAGATCATCAT GTTGGAGGTGTCATGATCAAGCTTGTCAATGAACTGGGTAAAGCAAACCT TGTTGTTCCTGTTCTTGAGATTTAATACATGATAATACGGACTTAATCAT TAATAATTGATTTGAAGCACTCGATATTATTATTTTATATTGCATAAGTC CTTGCTCTGATTATTGATGATTRCTGTTGTTGCTTTATTTTTATTCTCTT TGCCCATAACAGCGACAACAAAGACATAAGAGGAGTGTTCAAAGTTGTAG TAGGTCTGTTACTTGTCCTTCCTTTCAAATAGGAAATTGTTATTTATTTT TTAGATATTCATTTTCAATTACTTAAAATATGTTTAAGGTGGAGACGACA AATTCAATTAGATGCGTGACTCATTTCTACTTTAGGGAAGGACCTTCCCA TAAAATACTAATAATATAGCATTCATATCATCCCTATTAGACTTTTGTTG TTGTTTTATGATTCATTTTCATCCCAAATACAGAAATATGCAACAATTCT CATGTTGATTCTTGGAATGACTAAGAACATAACTAATTAGCAGTAACTTA GTATGTGGTATGAAATGAAAGATATACTTGCTGTGGGTCCTATCAAATTA CAAACTACTATCACTTATAATAATTATATTAAATAACTAATAAGTTGCTT CTATTCAATGTATTCATTTATGTCTCCCTCTTCAAATAATGTTTTCATGC CCTGAGTTCCTCATATGAATGTATTTCCTTCTCGTCATCAAATATGAATA AATAGTACTTACAATTCATTTAGACTTTTGTTAGTGTATATTAATAATTA TGAATGAAATGCAATGAAGGTACCTTGTTCATGTATACAACTTAAAATTA CAATAAATTGGCGCATCAATATAAAAGCAATTATGAACAAAAATCAATAT GTTTTTTTTTACTTCATATATACATTATTTCATAGACATAGTTGGGTGAT TTATAGGCTTACTATTCAAATTACTGGGATGGTTTATTATACTTCAAGAC TTTTAGCTATAGTTTAGAACATTTATTTAATTTAAGCGACTTATATTGAC CCCGATATGGTCCCTTTCAAATAAAATTTGTCAAATTCCCCTTATTTTAT TATGACGATGAATTTTACTATCTAAAGTGCAATTTGCGACGCACCCAAAG CGTTTATAATAATAATTTTTGAAAATAAATTGACGAATATTCGTATAAGT GAACAAATGTAATCCTCACTCAATTTTTAGAAAAATCATTCTAGCTCGCT TTTGTGTTGGCAGACTACATATGTAGTCTCATAACGATCCCCCAATAATA ACTCAATATATGTATGTATTACCTTATGTAAGCTTCAGAACTATATATTG TATAAATGTACATTGAACATATTTTATTTGTGTATTAAATTACACATCTT CAAAATGTCGAAGTCTCGGGTTTCAATAATTATATTCATCTTTTATTTTA AAAAAAATGTTTTGATATTCATAAATAATAATCTTGATAATTATGACCTC ACCTCTCCTTTCAGACATTGCTATGGACTGGTCAGATCATGCACTATGGT GGCCAGATCGAAATAAATGGCTTGAAAAAACGCGTTGGACATTAGATCAG TATAACATTACTGCTGATACCTGCGTTTATTTTACACCAATGCACAAAAA CATTAGGATTCAACTACCTGATCTGAGATATGTTGATTGTGTTATGGATT ATTCCGTACAAGCGTTCTCAGGGTTAAGGACTCTGTGCTCTGATTTAGGT GAGATTCGTATATATACAGGGTAGGGCTCATGGACTCGAAAGATGGATTT AGAAATACATCAATAATTTTATATTTTCATTAATATTCAAAAACCAAAAA AAAAATTAAAACATATGACAAGGTTTTTGCAGAACTTTTTTCACTCAATA TGGCCACCTTCATTATCAATCACAGCCTTTATATGAAGGCCTTGCAGGAG TTGATGACAAACTCCTCTGACAAGTTGTCCCATGCGGCCACTATGGAGGA CTTCAATGAGTCCACGTTTGGGTGTGAGGCCAGCGGTCATTCCGGTGACA GTGGAATTGATCAACTGTGAAAATCTTCTTGTCCTTGAAAATTCTAACCA TTGACCCATTTACCTTGATACATGTGAGTATTTCCTTGCACCTCTCAAGC CTCCTGGCTTTCATGCCCTCTGTCAGAAGGTGGTGTGGGGTCCTTGTGAA AGAAAGTTAYCCCAAGTTGTGCTTTATAGNNNNNNNNNNNNNNNNGTCTT AGGAGCCACAGAAGTCGTTAGCGAGGCAATTTATTTACTTAGTGGGATTA TCCTTTATAATTTTCTCCAAACTTAACAAGAACTTCGTATCCCTCTTTAA ATTATGCCCTCCACATTAGGACATCCTGTAGAGGTCTTCTCCATTTCTTT TTTMTTWTTTTCWTCTTGGCCAACTTAAAAACCAGCTCCTAGAACGCAAA ACAATGTCCGTAATATTCGTCACATCAACTACAGTAAATCTGAGATGCGC TGCCCTTTTGCTTGTTCCTCGCTCATGATGATGAAATAACTAAAACATTA GTATGTCTGTTTATGTAAAAAAGACGGCGTAAACAAAATATCTAAAAATT ATCACTAAAACTTTTCATAGTTATGAGAAAATAAACATTAATTAACAGTC CACGTTTTGCTGCCCTACATGTATATATATTTATGTATTGTAAAATTGAC TCATTTGTTTAATTTTTTAAAGGCTTATGTCACATCCTAATCGTAACATT TTATAATCTATGACTCATCTAATACACATATTATTCATAATATGGTTGCA TTTTATTTCGACGTTAACATTTTTTAAACAATAATTACATCTAATTTTCT TATAGAAATACGTCATTTTGAAGAGTTATCTCTTTGCAAACCCCTAGCAA CTGATCATTTAAAATTTAATTATGGAGATTATAGACAAGAAGAGGGGAAA AAACGTCGAATAACCTTAAAAAATAGTCTAAATACTTCTAACTCATCGTC ACCAAGTGGGACTTTTCGACGGAAAGGGAACCATCACATTCATTCTGTTT CAACTTCGGACTTGAGTCCTTCTMCAGCCATTGTAGATAGGCCAGATACG AATACATTCATAGCTAATAGTACTGCAACTCTTGGAAGAAAAACATCAAC GACGAGTTGGAATGGATCTTCCTCACGCAATTATCGATCCTTGGGGAGGA ATGGAACTTTGGATTATCATCGTAGAAAGAGTGACTTCCATTCACAATCT AATCATGTAATTTAATTTTAAAAAATGAACAAATTCTTCTTATTGTAAAT AAGTTTCTCTTTTCATTCATATTTTTAACATTTGATCCTTCAGGGTACTC TAAAAAAGAATGGTAGTTTTTCCCCACTTGTGAATGGAAATGATTCTAAT TTAAAATCCGGAAGTGAATGGTCCCTTGCCATGAGTCCTCCTCCTAGTGT TGAAGCGAAATATTCATTAATAAGGCCAAAGAACTTGGTTGAAAGAGCTA GGATGAATGTTGCGTCAGTATTTACTAAATTTATTCATTATTAGAATGAG TCTTTTAAGGTTTTTGTTTTATTTAATAGGTGGCTTGATTCTTCTTTGTC ATTAATGGAACAAGGAGTCAAAGATTTCGACACTCTATTACTCAGATATA AGTTTTACTCATTTTTTGACTTAAATCCTAAAATGGATGGTGTTCGTATA AATCTTATCTATGAACAGCTCAAATGGACAATTTTAAATGAGAATATGGA TTGCACTGAAGAAGAAATGATGTTGTTTGCTGCGTTGCAGGTATGGAGTT TTTTTGTTCTTTGATTTAATGCTTGAGATATTTAGATTTTTACTTTTTTT AAAGCTTCAAGTAAGTCTTMAAGCCAATGTTCCACAGCCCTCTGAAGAAG ATGAGGACGACGATGATGATGTAGACGCGGCTCTCAGTGATCTACAAATA TCGTTAGAAGGAGAAGCTCATCGAAGTTTTATAAATGAAACAGTAAATAA TGATATAGTGGCAATACCAGTTCTATCGGATCATCTAAGATATATGAGGT TTGAAAGATTGCTTTTATTTTAATTACGTTTGTAGTAATAAGAAGGCTTT GTTCCCTCCCATGTATTTTCAGGCCTAAAAGATTTACTTTAAAGGGCTTT AAGGGTCATTATTTCGTCTTGAAAGAATTAGCTTTGGTTGCTTATAAGAA CGAAGAAGACAGTTACAATTATCATACAAGCTTTTCCGTCAATCTAAAAG GTTGTGAAGTTAGTCCAGAAGTGAATATATCTAGAAAACGCTACGGAATC AAGCTAGCAATTCCTTCTGCAGACGGAATGTCTGATTTATATCTCCGTTG CATTTCGGTAATTAATCACTTTGATTATTTTTTAGTTGATTTGTTCATAA ATTATGTATACACCATATTTATAAATGTATAGGAGGATCAGTATTCTAAA TGGATGGCGGCCTGTCGACTTGCTGCCAAAGGCAAAACAATGGCGGRTGC TAGTTATGATTCAGAGGTTAAGTCAATTTTAGCCTTTCTTTCAATGCAAC ATCCGGCTTCAACCCCAGTGATAAACCCATCTACACTAAATGTAGATGTG GAAGAATATGTTGCATCCCGTTTTCTTCGTAAAATGCCAAAGTCTAAACT TCGCCATAGAATTTTGGAGGCTCACTCAAATGTGAAGGATCTAAATTTAA TCGAAGCAAAAATGAACTATTTAAAGGCTTTTCAATCTCTTCCGGACTAT GGAGTATCTTTGTTTGTTGTTCGTTTTCACGGAGAAAAGAAAGATGAGCT TCTAGGGGTTGCATCTAATCGTCTGATGCGAATGAATCTTCAAACAGGGG ATCCAATTAAGACCTGGAGATATAATACTATCAAAGTAAATATATATTGA ATATATTATGACGAGAAAAATATATGAGTTGGGTTGCATAATTTTTAATA GGCTTGGAACATTAATTGGGAAACTAAACATATGATGATCCAATTAGGAG ATGGAAAAAATGTTATTTTCAAGTGTCTTTCCGCTGACTGCAAAGTTGTT CATGAATTTATTGGTGGTTATATATTCTTGTCTATGAGGAATAAAGATGC AAATCAAATTATAGATGAAGAACAATTTCATAAGCTAACTGGAGGCTGGC ATTAAATGCTCTTCTCAGAAAATAAGTCTGGTTTTTTATGTAATAATTAT AATTATCGATGAAGGTGTTTTTGTTTAAATATTTTAATAGCCTTGTTTTT CATTAATACTGAAAGAATCCCTTTTTAAGTTCATACAAACTTAGAAAGTC TGAAAAGATTTTTTATTTTTTTCCTGTTCTTTGTGTCTCCATCCTTTAGA CAATCTTAATCGTTCTGCCTACTTCACCGTTTTAAAGGTTAATAATATTT AATCAGAAATTTGGAAAAAGTAGGCAATTATAACTAATTTTACCGGTTAC ATTAGTGTATTTCTAATTGAGAAAGTTCCTTTTTATATAATGCTTCCGTA CAAAATAACATGCATTTGAAATTTAACAACATGCTTTATTTCTGTGATTA TTATTTAAGTAAATATGGGCCAAAATATTTTTAATAGAATTTATATGTAT TTTATCAATC
back to top
Add to Basket