EMLSAG00000000007, EMLSAG00000000007-682773 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000007
Unique NameEMLSAG00000000007-682773
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" species:7955 "Danio rerio" [GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0051536 "iron-sulfur cluster binding" evidence=IEA] [GO:0006810 "transport" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 ZFIN:ZDB-GENE-040426-2060 GO:GO:0005739 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 eggNOG:COG0723 PANTHER:PTHR10134 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 EMBL:BC059475 UniGene:Dr.76290 ProteinModelPortal:Q6PC48 SMR:Q6PC48 PRIDE:Q6PC48 InParanoid:Q6PC48 Bgee:Q6PC48 Uniprot:Q6PC48)

HSP 1 Score: 288.886 bits (738), Expect = 1.290e-95
Identity = 128/215 (59.53%), Postives = 168/215 (78.14%), Query Frame = 0
Query:   46 ATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            A SG   S S+N  ++  +R  H+D+++PDFS YRR    +P   + ++   R+ F+Y+++GST +VG+Y  K +V++F++SM+ +ADVLAL+KIEIK++DIPEGKNM FKWRGKP+FVRHRT +EIE E  V++A LR P+ D +R  +  W++V+GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF +D  VV
Sbjct:   59 AKSGLAVSSSLNARSS--VRFAHTDIKIPDFSDYRRPEVLNPNKQSQESGDARRAFSYLMTGSTLVVGVYTAKTVVTQFVSSMSASADVLALSKIEIKLADIPEGKNMTFKWRGKPLFVRHRTEKEIETEAGVNLAELRDPQHDKDRVVNPSWVIVIGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPYYEFPDDDTVV 271          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9823 "Sus scrofa" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0005743 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 PANTHER:PTHR10134 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 KO:K00411 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:FP245509 RefSeq:XP_003127050.1 Ensembl:ENSSSCT00000030609 GeneID:100522678 KEGG:ssc:100522678 ArrayExpress:F1RNZ1 Uniprot:F1RNZ1)

HSP 1 Score: 280.796 bits (717), Expect = 2.068e-92
Identity = 133/249 (53.41%), Postives = 178/249 (71.49%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSV--THHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            G+L      A+P+ + S V     S    ES+    +G     S+      ++R  H+D++VPDFS YRR+   D T  + +++  RK F+Y+++ +T +   YA K  VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF  D LV+
Sbjct:   24 GALRPLVQAALPATSESPVLDAKRSFLCRESLSGQAAGRPLVASVGLNVPASVRYSHTDIRVPDFSDYRRAEVLDSTKSSKESSDARKGFSYLITATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSDDLVI 272          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9615 "Canis lupus familiaris" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0005743 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 PANTHER:PTHR10134 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:AAEX03001116 RefSeq:XP_533711.1 ProteinModelPortal:E2R1A6 Ensembl:ENSCAFT00000012203 GeneID:476503 KEGG:cfa:476503 NextBio:20852151 Uniprot:E2R1A6)

HSP 1 Score: 279.641 bits (714), Expect = 6.602e-92
Identity = 123/200 (61.50%), Postives = 165/200 (82.50%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFK-EDILVVG 261
            +IR  H+D++VPDFS YRR+   D T  + +++  RK F+Y+++ +T+I   YA K +VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+V+ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP+YEF  +D+++VG
Sbjct:   75 SIRYSHTDIRVPDFSDYRRAEVLDGTKSSKESSEARKGFSYLITATTSIGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIEQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTGDDMVIVG 274          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9913 "Bos taurus" [GO:0005739 "mitochondrion" evidence=ISS] [GO:0005743 "mitochondrial inner membrane" evidence=ISS] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0016021 GO:GO:0005743 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 PDB:2YBB PDBsum:2YBB PDB:1BCC PDB:1BE3 PDB:1BGY PDB:1L0L PDB:1L0N PDB:1NTK PDB:1NTM PDB:1NTZ PDB:1NU1 PDB:1PP9 PDB:1PPJ PDB:1QCR PDB:1SQB PDB:1SQP PDB:1SQQ PDB:1SQV PDB:1SQX PDB:2A06 PDB:2FYU PDBsum:1BCC PDBsum:1BE3 PDBsum:1BGY PDBsum:1L0L PDBsum:1L0N PDBsum:1NTK PDBsum:1NTM PDBsum:1NTZ PDBsum:1NU1 PDBsum:1PP9 PDBsum:1PPJ PDBsum:1QCR PDBsum:1SQB PDBsum:1SQP PDBsum:1SQQ PDBsum:1SQV PDBsum:1SQX PDBsum:2A06 PDBsum:2FYU TCDB:3.D.3.2.1 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 PANTHER:PTHR10134 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 EMBL:M34336 EMBL:S58789 EMBL:BC115994 EMBL:BC133620 EMBL:BC133632 PIR:A46063 RefSeq:NP_777238.1 UniGene:Bt.265 PDB:1RIE PDBsum:1RIE ProteinModelPortal:P13272 SMR:P13272 IntAct:P13272 PRIDE:P13272 GeneID:287020 KEGG:bta:287020 CTD:7386 KO:K00411 EvolutionaryTrace:P13272 NextBio:20806543 Uniprot:P13272)

HSP 1 Score: 277.715 bits (709), Expect = 4.174e-91
Identity = 133/249 (53.41%), Postives = 179/249 (71.89%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSVT--HHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            G+L      AVP+ + S V     S    ES+    +G     S++     ++R  H+D++VPDFS YRR    D T  + +++  RK F+Y+V+ +T +   YA K +VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP+YEF  D +V+
Sbjct:   24 GALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRYSHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:Uqcrfs1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:10116 "Rattus norvegicus" [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:1902600 "hydrogen ion transmembrane transport" evidence=TAS] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 RGD:628838 GO:GO:0032403 GO:GO:0042493 GO:GO:0046872 GO:GO:0046677 GO:GO:0009725 GO:GO:0051537 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0005750 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 eggNOG:COG0723 PANTHER:PTHR10134 HOGENOM:HOG000255193 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:AY539946 EMBL:BC085339 EMBL:M24542 PIR:A32296 RefSeq:NP_001008888.1 UniGene:Rn.2603 ProteinModelPortal:P20788 SMR:P20788 IntAct:P20788 STRING:10116.ENSRNOP00000024609 PaxDb:P20788 PRIDE:P20788 Ensembl:ENSRNOT00000024609 GeneID:291103 KEGG:rno:291103 UCSC:RGD:628838 InParanoid:P20788 NextBio:632121 PRO:PR:P20788 Genevestigator:P20788 Uniprot:P20788)

HSP 1 Score: 275.404 bits (703), Expect = 3.172e-90
Identity = 136/253 (53.75%), Postives = 180/253 (71.15%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSVTHHSAPI----SESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKE-DILVVG 261
            G+L      AVP+ +   V     P     S S   AT   + +  +N     ++R  H+D++VPDFS YRR+   D T  + +++  RK F+Y+V+ +T +   YA K  VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF   D++VVG
Sbjct:   24 GALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATVGLN--VPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG 274          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:Uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" species:10116 "Rattus norvegicus" [GO:0005739 "mitochondrion" evidence=ISO] [GO:0005743 "mitochondrial inner membrane" evidence=ISO] [GO:0005750 "mitochondrial respiratory chain complex III" evidence=IDA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=TAS] [GO:0009725 "response to hormone" evidence=IEP] [GO:0031966 "mitochondrial membrane" evidence=IDA] [GO:0032403 "protein complex binding" evidence=IDA] [GO:0042493 "response to drug" evidence=IEP] [GO:0045275 "respiratory chain complex III" evidence=TAS] [GO:0046677 "response to antibiotic" evidence=IEP] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:1902600 "hydrogen ion transmembrane transport" evidence=TAS] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 RGD:628838 GO:GO:0032403 GO:GO:0042493 GO:GO:0046872 GO:GO:0046677 GO:GO:0009725 GO:GO:0051537 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0005750 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 eggNOG:COG0723 PANTHER:PTHR10134 HOGENOM:HOG000255193 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:AY539946 EMBL:BC085339 EMBL:M24542 PIR:A32296 RefSeq:NP_001008888.1 UniGene:Rn.2603 ProteinModelPortal:P20788 SMR:P20788 IntAct:P20788 STRING:10116.ENSRNOP00000024609 PaxDb:P20788 PRIDE:P20788 Ensembl:ENSRNOT00000024609 GeneID:291103 KEGG:rno:291103 UCSC:RGD:628838 InParanoid:P20788 NextBio:632121 PRO:PR:P20788 Genevestigator:P20788 Uniprot:P20788)

HSP 1 Score: 275.404 bits (703), Expect = 3.172e-90
Identity = 136/253 (53.75%), Postives = 180/253 (71.15%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSVTHHSAPI----SESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKE-DILVVG 261
            G+L      AVP+ +   V     P     S S   AT   + +  +N     ++R  H+D++VPDFS YRR+   D T  + +++  RK F+Y+V+ +T +   YA K  VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF   D++VVG
Sbjct:   24 GALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATVGLN--VPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG 274          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9606 "Homo sapiens" [GO:0005739 "mitochondrion" evidence=IDA] [GO:0005743 "mitochondrial inner membrane" evidence=TAS] [GO:0005750 "mitochondrial respiratory chain complex III" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0009725 "response to hormone" evidence=IEA] [GO:0022904 "respiratory electron transport chain" evidence=TAS] [GO:0032403 "protein complex binding" evidence=IEA] [GO:0042493 "response to drug" evidence=IEA] [GO:0044237 "cellular metabolic process" evidence=TAS] [GO:0044281 "small molecule metabolic process" evidence=TAS] [GO:0046677 "response to antibiotic" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] Reactome:REACT_111217 InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0044281 GO:GO:0005743 GO:GO:0042493 GO:GO:0046872 GO:GO:0046677 GO:GO:0009725 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0022904 GO:GO:0005750 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 PANTHER:PTHR10134 HPA:HPA041863 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 OMA:DYRRAEV TreeFam:TF105037 EMBL:L32977 EMBL:L32917 EMBL:AK291134 EMBL:AC007786 EMBL:BC000649 EMBL:BC010035 EMBL:BC067832 RefSeq:NP_005994.2 UniGene:Hs.743307 ProteinModelPortal:P47985 SMR:P47985 BioGrid:113232 IntAct:P47985 MINT:MINT-2803370 STRING:9606.ENSP00000306397 PhosphoSite:P47985 DMDM:143811471 OGP:P47985 REPRODUCTION-2DPAGE:IPI00026964 SWISS-2DPAGE:P47985 UCD-2DPAGE:P47985 PRIDE:P47985 DNASU:7386 Ensembl:ENST00000304863 GeneID:7386 KEGG:hsa:7386 UCSC:uc002nsd.2 GeneCards:GC19M029698 H-InvDB:HIX0041192 HGNC:HGNC:12587 MIM:191327 neXtProt:NX_P47985 PharmGKB:PA37218 InParanoid:P47985 OrthoDB:EOG7GBFXQ PhylomeDB:P47985 ChiTaRS:UQCRFS1 GeneWiki:UQCRFS1 GenomeRNAi:7386 NextBio:28920 PRO:PR:P47985 Bgee:P47985 CleanEx:HS_UQCRFS1 Genevestigator:P47985 Uniprot:P47985)

HSP 1 Score: 274.633 bits (701), Expect = 6.280e-90
Identity = 121/193 (62.69%), Postives = 155/193 (80.31%), Query Frame = 0
Query:   68 HSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            H+D++VPDFS YRR    D T  + +++  RK F+Y+V+G T +   YA K  V++F++SM+ +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIR GPAPLNLEVPTYEF  D +V+
Sbjct:   80 HTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9031 "Gallus gallus" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0016021 GO:GO:0005743 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 PDB:1BCC PDB:2BCC PDB:3BCC PDBsum:1BCC PDBsum:2BCC PDBsum:3BCC GO:GO:0008121 PDB:3CWB PDB:3H1H PDB:3H1I PDB:3H1J PDB:3H1K PDB:3H1L PDB:3L70 PDB:3L71 PDB:3L72 PDB:3L73 PDB:3L74 PDB:3L75 PDB:3TGU PDBsum:3CWB PDBsum:3H1H PDBsum:3H1I PDBsum:3H1J PDBsum:3H1K PDBsum:3H1L PDBsum:3L70 PDBsum:3L71 PDBsum:3L72 PDBsum:3L73 PDBsum:3L74 PDBsum:3L75 PDBsum:3TGU InterPro:IPR011070 SUPFAM:SSF56568 eggNOG:COG0723 PANTHER:PTHR10134 HOGENOM:HOG000255193 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 EMBL:AJ719669 RefSeq:NP_001005843.1 UniGene:Gga.5791 ProteinModelPortal:Q5ZLR5 SMR:Q5ZLR5 STRING:9031.ENSGALP00000007075 PaxDb:Q5ZLR5 PRIDE:Q5ZLR5 Ensembl:ENSGALT00000044199 GeneID:415752 KEGG:gga:415752 GeneTree:ENSGT00390000001014 InParanoid:Q5ZLR5 OMA:DYRRAEV TreeFam:TF105037 EvolutionaryTrace:Q5ZLR5 NextBio:20819306 PRO:PR:Q5ZLR5 Uniprot:Q5ZLR5)

HSP 1 Score: 274.248 bits (700), Expect = 7.239e-90
Identity = 121/200 (60.50%), Postives = 160/200 (80.00%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            ++R +H+DV VPDFS YRR    D T+ +  ++ +RK F+Y+V+ +  +   YA K +V++FI+S++ +ADVLAL+KIEIK+SDIPEGKN+ FKWRGKP+FVRHRT  EI  E  VDV+ LR P+ D +R +  +W+++VGVC HLGCVPIAN+G+FGGYYCPCHGSHYDASGRIRKGPAP NLEVPTY+F  +D++VVG
Sbjct:   73 SVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG 272          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:Uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" species:10090 "Mus musculus" [GO:0005515 "protein binding" evidence=IPI] [GO:0005739 "mitochondrion" evidence=ISO;IDA] [GO:0005743 "mitochondrial inner membrane" evidence=IDA] [GO:0005750 "mitochondrial respiratory chain complex III" evidence=ISO] [GO:0006810 "transport" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA] [GO:0031966 "mitochondrial membrane" evidence=ISO] [GO:0032403 "protein complex binding" evidence=ISO] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051536 "iron-sulfur cluster binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 MGI:MGI:1913944 GO:GO:0005743 GO:GO:0042493 GO:GO:0046872 GO:GO:0046677 GO:GO:0009725 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0005750 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 eggNOG:COG0723 PANTHER:PTHR10134 HOGENOM:HOG000255193 HOVERGEN:HBG001040 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 CTD:7386 KO:K00411 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:AK003966 EMBL:AK012180 EMBL:AK014470 EMBL:AK153139 EMBL:AK152391 EMBL:AL611944 EMBL:BC019934 RefSeq:NP_079986.1 UniGene:Mm.181933 ProteinModelPortal:Q9CR68 SMR:Q9CR68 BioGrid:211651 IntAct:Q9CR68 MINT:MINT-1842979 PhosphoSite:Q9CR68 PaxDb:Q9CR68 PRIDE:Q9CR68 Ensembl:ENSMUST00000042834 GeneID:66694 KEGG:mmu:66694 UCSC:uc007pyv.2 InParanoid:Q9CR68 NextBio:322393 PRO:PR:Q9CR68 Bgee:Q9CR68 Genevestigator:Q9CR68 Uniprot:Q9CR68)

HSP 1 Score: 273.863 bits (699), Expect = 1.034e-89
Identity = 123/200 (61.50%), Postives = 163/200 (81.50%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            ++R  H+DV+VPDFS YRR+   D T  + +++  RK F+Y+V+ +T +   YA K +VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF  +D++VVG
Sbjct:   75 SVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG 274          
BLAST of EMLSAG00000000007 vs. GO
Match: - (symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" species:9913 "Bos taurus" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA] [GO:0070469 "respiratory chain" evidence=IEA] InterPro:IPR004192 InterPro:IPR005805 InterPro:IPR006317 InterPro:IPR014349 InterPro:IPR015248 InterPro:IPR017941 Pfam:PF00355 Pfam:PF02921 Pfam:PF09165 PRINTS:PR00162 PROSITE:PS51296 GO:GO:0005743 GO:GO:0046872 GO:GO:0070469 GO:GO:0051537 GO:GO:1902600 Gene3D:2.102.10.10 SUPFAM:SSF50022 GO:GO:0008121 InterPro:IPR011070 SUPFAM:SSF56568 PANTHER:PTHR10134 Gene3D:1.20.5.270 TIGRFAMs:TIGR01416 GeneTree:ENSGT00390000001014 OMA:DYRRAEV TreeFam:TF105037 OrthoDB:EOG7GBFXQ EMBL:DAAA02045942 Ensembl:ENSBTAT00000066053 Uniprot:G3MXD1)

HSP 1 Score: 272.322 bits (695), Expect = 4.334e-89
Identity = 124/210 (59.05%), Postives = 165/210 (78.57%), Query Frame = 0
Query:   51 MTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            + S S+N   +  +R  H+D++VPDFS YRR    D T  + +++  RK F+Y+V+ +T +   YA K +VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP+YEF  D +V+
Sbjct:   62 VASVSLNVPAS--VRYSHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVI 269          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592779429|gb|GAXK01175139.1| (TSA: Calanus finmarchicus comp2304_c3_seq6 transcribed RNA sequence)

HSP 1 Score: 281.182 bits (718), Expect = 4.952e-92
Identity = 154/277 (55.60%), Postives = 204/277 (73.65%), Query Frame = 0
Query:    4 MQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIP---QATSGCMTSFSMNQ--------------ATTWNIRCLHS-DVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWXXXXXXXXXXXXXPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            MQ++ +AA  G L+RA++ AVPS T +       P+  + P   QA +  +TS+SM++                +  +RC H+ ++ VPDF++YRRSA KDPT+ + + A +R  F+YV++G   + G Y  K +V++FI++ + + DVLA+AKIEIK++DIPEGKNM FKWRGKP+F+RHRT+QEIEIEN VD A+LR P+ DSER +D +WLV++GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF E+ +LVVG
Sbjct:  133 MQSVVRAASLGQLARASASAVPSATAAV---KDTPLPTAAPLVVQAPATPLTSYSMSKQLLTGSQVRLSSGLGVSSQVRCYHAGNMDVPDFTYYRRSAVKDPTAKSSETAQDRMAFSYVMAGGFGLGGAYGAKALVNQFISTWSASQDVLAMAKIEIKLADIPEGKNMTFKWRGKPLFIRHRTAQEIEIENGVDPATLRDPQTDSERVKDAEWLVILGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPFYEFPEEGMLVVG 954          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592779431|gb|GAXK01175137.1| (TSA: Calanus finmarchicus comp2304_c3_seq4 transcribed RNA sequence)

HSP 1 Score: 281.567 bits (719), Expect = 5.631e-91
Identity = 154/277 (55.60%), Postives = 204/277 (73.65%), Query Frame = 0
Query:    4 MQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIP---QATSGCMTSFSMNQ--------------ATTWNIRCLHS-DVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWXXXXXXXXXXXXXPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            MQ++ +AA  G L+RA++ AVPS T +       P+  + P   QA +  +TS+SM++                +  +RC H+ ++ VPDF++YRRSA KDPT+ + + A +R  F+YV++G   + G Y  K +V++FI++ + + DVLA+AKIEIK++DIPEGKNM FKWRGKP+F+RHRT+QEIEIEN VD A+LR P+ DSER +D +WLV++GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF E+ +LVVG
Sbjct:  422 MQSVVRAASLGQLARASASAVPSATAAV---KDTPLPTAAPLVVQAPATPLTSYSMSKQLLTGSQVRLSSGLGVSSQVRCYHAGNMDVPDFTYYRRSAVKDPTAKSSETAQDRMAFSYVMAGGFGLGGAYGAKALVNQFISTWSASQDVLAMAKIEIKLADIPEGKNMTFKWRGKPLFIRHRTAQEIEIENGVDPATLRDPQTDSERVKDAEWLVILGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPFYEFPEEGMLVVG 1243          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592779425|gb|GAXK01175143.1| (TSA: Calanus finmarchicus comp2304_c3_seq10 transcribed RNA sequence)

HSP 1 Score: 277.33 bits (708), Expect = 9.635e-91
Identity = 149/260 (57.31%), Postives = 195/260 (75.00%), Query Frame = 0
Query:    4 MQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHS-DVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWXXXXXXXXXXXXXPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            MQ++ +AA  G L+RA++ AVPS T +       P+  + P      ++S          +RC H+ ++ VPDF++YRRSA KDPT+ + + A +R  F+YV++G   + G Y  K +V++FI++ + + DVLA+AKIEIK++DIPEGKNM FKWRGKP+F+RHRT+QEIEIEN VD A+LR P+ DSER +D +WLV++GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF E+ +LVVG
Sbjct:  133 MQSVVRAASLGQLARASASAVPSATAAV---KDTPLPTAAPLVVQAPVSS---------QVRCYHAGNMDVPDFTYYRRSAVKDPTAKSSETAQDRMAFSYVMAGGFGLGGAYGAKALVNQFISTWSASQDVLAMAKIEIKLADIPEGKNMTFKWRGKPLFIRHRTAQEIEIENGVDPATLRDPQTDSERVKDAEWLVILGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPFYEFPEEGMLVVG 876          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592779430|gb|GAXK01175138.1| (TSA: Calanus finmarchicus comp2304_c3_seq5 transcribed RNA sequence)

HSP 1 Score: 277.33 bits (708), Expect = 1.280e-89
Identity = 149/260 (57.31%), Postives = 195/260 (75.00%), Query Frame = 0
Query:    4 MQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHS-DVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWXXXXXXXXXXXXXPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            MQ++ +AA  G L+RA++ AVPS T +       P+  + P      ++S          +RC H+ ++ VPDF++YRRSA KDPT+ + + A +R  F+YV++G   + G Y  K +V++FI++ + + DVLA+AKIEIK++DIPEGKNM FKWRGKP+F+RHRT+QEIEIEN VD A+LR P+ DSER +D +WLV++GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF E+ +LVVG
Sbjct:  422 MQSVVRAASLGQLARASASAVPSATAAV---KDTPLPTAAPLVVQAPVSS---------QVRCYHAGNMDVPDFTYYRRSAVKDPTAKSSETAQDRMAFSYVMAGGFGLGGAYGAKALVNQFISTWSASQDVLAMAKIEIKLADIPEGKNMTFKWRGKPLFIRHRTAQEIEIENGVDPATLRDPQTDSERVKDAEWLVILGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPFYEFPEEGMLVVG 1165          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592780785|gb|GAXK01173783.1| (TSA: Calanus finmarchicus comp5719031_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 182.956 bits (463), Expect = 1.296e-56
Identity = 92/129 (71.32%), Postives = 114/129 (88.37%), Query Frame = 0
Query:  133 DVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWXXXXXXXXXXXXXPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVV 260
            DVLALAKIE+K++DIPEGKN+ FKWRGKP+F+RHRT+ EI+ E  VDV+SLR P+ D++RCQ  +WLV++GVC HLGCVPIAN+G++GGYYCPCHGSHYD++GRIRKGPAPLNLEVP + F  E+ LVV
Sbjct:    1 DVLALAKIEVKLADIPEGKNVTFKWRGKPLFIRHRTAAEIDTEQGVDVSSLRDPQHDNDRCQRPEWLVLLGVCTHLGCVPIANSGDYGGYYCPCHGSHYDSAGRIRKGPAPLNLEVPVHTFVDENTLVV 387          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592869649|gb|GAXK01087913.1| (TSA: Calanus finmarchicus comp6570314_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 65.0846 bits (157), Expect = 1.435e-12
Identity = 35/79 (44.30%), Postives = 53/79 (67.09%), Query Frame = 0
Query:   52 TSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAA-NRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMN 129
            TSFS+   +   +R  H+D++VPDFS YRR    D   V+ K++A  R+ F+Y+V GS A+ G YA K +VS+F++SM+
Sbjct:   85 TSFSIGGPS--QVRYAHTDIRVPDFSEYRRKDLLD-NKVDAKDSAPKRQGFSYLVVGSGAVAGAYAAKSVVSEFVSSMS 312          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592915635|gb|GAXK01042740.1| (TSA: Calanus finmarchicus comp6519066_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 49.6766 bits (117), Expect = 1.715e-6
Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 0
Query:  220 GGYYCPCHGSHYDASGRIRKG-PAPLNLEVPTYEFKEDI-LVVG 261
            GG+ CPCHGS +D +GR+ K  PAP NLEVP + +  D  L++G
Sbjct:  268 GGFLCPCHGSTFDMAGRVFKNKPAPDNLEVPPHMYLSDTRLLIG 399          
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Match: gi|592878436|gb|GAXK01079465.1| (TSA: Calanus finmarchicus comp3091676_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 45.4394 bits (106), Expect = 8.651e-5
Identity = 15/27 (55.56%), Postives = 22/27 (81.48%), Query Frame = 0
Query:  222 YYCPCHGSHYDASGRIRKGPAPLNLEV 248
            + CPCHGS YD +G++ +GPAPL+L +
Sbjct:  385 FMCPCHGSQYDKNGKVVRGPAPLSLAL 465          
BLAST of EMLSAG00000000007 vs. L. salmonis peptides
Match: EMLSAP00000000007 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:209319:213491:1 gene:EMLSAG00000000007 transcript:EMLSAT00000000007 description:"maker-LSalAtl2s1003-snap-gene-1.12")

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 0
Query:    1 MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG 261
            MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG
Sbjct:    1 MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG 261          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036555|sp|Q69BJ7.1|UCRI_SAISC (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 284.263 bits (726), Expect = 1.936e-95
Identity = 126/200 (63.00%), Postives = 165/200 (82.50%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            ++R  H+D++VPDFS YRRS   D T  + +++  RK F+Y+V+ +TA+   YA K IV++FI+SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF  +D++VVG
Sbjct:   75 SVRYSHTDIKVPDFSDYRRSEVLDKTKSSRESSDARKVFSYMVTATTAVGVTYAAKSIVTQFISSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWMILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFLSDDMVVVG 274          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036557|sp|Q69BJ9.1|UCRI_AOTAZ (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 283.878 bits (725), Expect = 2.867e-95
Identity = 124/198 (62.63%), Postives = 162/198 (81.82%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            ++R  H+D++VPDFS YRRS   D T  + +++  RK F+Y+V+ +TA+   YA K IV++F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF  D LV+
Sbjct:   75 SVRYSHTDIKVPDFSDYRRSEVLDTTKSSRESSDARKGFSYLVTATTAVGVTYAAKSIVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWMILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSDDLVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036556|sp|Q69BJ8.1|UCRI_LAGLA (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 281.952 bits (720), Expect = 1.381e-94
Identity = 124/200 (62.00%), Postives = 165/200 (82.50%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFK-EDILVVG 261
            ++R  H+D++VPDFS YRRS   D T  + +++  RK F+Y+V+ +TA+   YA K IV++F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF  +D+++VG
Sbjct:   75 SVRYSHTDIKVPDFSDYRRSEVLDKTKSSRESSDARKGFSYLVTAATAVGVTYAAKSIVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWMILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTGDDMVIVG 274          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|1351360|sp|P13272.3|UCRI_BOVIN (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 277.715 bits (709), Expect = 8.637e-93
Identity = 133/249 (53.41%), Postives = 179/249 (71.89%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSVT--HHSAPISESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            G+L      AVP+ + S V     S    ES+    +G     S++     ++R  H+D++VPDFS YRR    D T  + +++  RK F+Y+V+ +T +   YA K +VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP+YEF  D +V+
Sbjct:   24 GALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRYSHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|52001457|sp|P20788.2|UCRI_RAT (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Liver regeneration-related protein LRRGT00195; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 275.404 bits (703), Expect = 6.645e-92
Identity = 136/253 (53.75%), Postives = 180/253 (71.15%), Query Frame = 0
Query:   14 GSLSRATSQAVPSLTGSSVTHHSAPI----SESIPQATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKE-DILVVG 261
            G+L      AVP+ +   V     P     S S   AT   + +  +N     ++R  H+D++VPDFS YRR+   D T  + +++  RK F+Y+V+ +T +   YA K  VS+F++SM+ +ADVLA++KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI+ E  V+V+ LR P+ D ER +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF   D++VVG
Sbjct:   24 GALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATVGLN--VPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG 274          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036563|sp|Q69BK5.1|UCRI_PANTR (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor >gi|54036564|sp|Q69BK6.1|UCRI_PANPA RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 275.018 bits (702), Expect = 7.912e-92
Identity = 122/193 (63.21%), Postives = 155/193 (80.31%), Query Frame = 0
Query:   68 HSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            H+DV+VPDFS YRR    D T  + +++  RK F+Y+V+G T +   YA K  V++F++SM+ +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIR GPAPLNLEVPTYEF  D +V+
Sbjct:   80 HTDVKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036562|sp|Q69BK4.1|UCRI_GORGO (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 274.633 bits (701), Expect = 1.224e-91
Identity = 121/193 (62.69%), Postives = 155/193 (80.31%), Query Frame = 0
Query:   68 HSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            H+D++VPDFS YRR    D T  + +++  RK F+Y+V+G T +   YA K  V++F++SM+ +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIR GPAPLNLEVPTYEF  D +V+
Sbjct:   80 HTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|54036561|sp|Q69BK3.1|UCRI_PONPY (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 274.633 bits (701), Expect = 1.293e-91
Identity = 121/193 (62.69%), Postives = 155/193 (80.31%), Query Frame = 0
Query:   68 HSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            H+DV+VPDFS YRR    D T  + +++  RK F+Y+V+G T +   YA K +V++F++SM+ +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIR GPAPLNLEVP YEF  D +V+
Sbjct:   80 HTDVRVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNVVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPIYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|143811471|sp|P47985.2|UCRI_HUMAN (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Cytochrome b-c1 complex subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Contains: RecName: Full=Cytochrome b-c1 complex subunit 11; AltName: Full=Complex III subunit IX; AltName: Full=Ubiquinol-cytochrome c reductase 8 kDa protein; Flags: Precursor)

HSP 1 Score: 274.633 bits (701), Expect = 1.321e-91
Identity = 121/193 (62.69%), Postives = 155/193 (80.31%), Query Frame = 0
Query:   68 HSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            H+D++VPDFS YRR    D T  + +++  RK F+Y+V+G T +   YA K  V++F++SM+ +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EIE E  V+++ LR P+ D +R +  +W++++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIR GPAPLNLEVPTYEF  D +V+
Sbjct:   80 HTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVI 272          
BLAST of EMLSAG00000000007 vs. SwissProt
Match: gi|75571417|sp|Q5ZLR5.1|UCRI_CHICK (RecName: Full=Cytochrome b-c1 complex subunit Rieske, mitochondrial; AltName: Full=Complex III subunit 5; AltName: Full=Rieske iron-sulfur protein; Short=RISP; AltName: Full=Ubiquinol-cytochrome c reductase iron-sulfur subunit; Flags: Precursor)

HSP 1 Score: 274.248 bits (700), Expect = 1.522e-91
Identity = 121/200 (60.50%), Postives = 160/200 (80.00%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            ++R +H+DV VPDFS YRR    D T+ +  ++ +RK F+Y+V+ +  +   YA K +V++FI+S++ +ADVLAL+KIEIK+SDIPEGKN+ FKWRGKP+FVRHRT  EI  E  VDV+ LR P+ D +R +  +W+++VGVC HLGCVPIAN+G+FGGYYCPCHGSHYDASGRIRKGPAP NLEVPTY+F  +D++VVG
Sbjct:   73 SVRYVHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG 272          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: EAA14787.4 (AGAP008955-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 297.36 bits (760), Expect = 4.750e-101
Identity = 143/266 (53.76%), Postives = 193/266 (72.56%), Query Frame = 0
Query:    3 MMQNLAKAAGNGSLSRATSQAV-PSLTGSSVTHHSAPISES-IPQATSGCMTSFSMNQAT----TWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            M+ NLAK +    +S++ +  + P++ G++ T   + ++   IP  ++  + S ++   +       IRC H+D++VPDFS YRR   K P + ND +A +R  F Y++ G  A+   Y  K +VS F++SM+ +ADVLA++KIEIK++DIPEGK+M FKWRGKP+F+RHRTS EIE E +V VA+LR P+ D+ER Q  +WLVV+GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF ED +L+VG
Sbjct:    1 MLTNLAKLSAVRGVSQSVTNGLKPAVVGAAKTEGKSVVAAGPIPVVSAAGLPSNNVRVVSGVTGATQIRCAHTDIRVPDFSDYRRDQVKRPNAKND-SADDRAAFTYLLVGGAAVSTAYVAKSLVSTFVSSMSASADVLAMSKIEIKLADIPEGKSMTFKWRGKPLFIRHRTSAEIEAEQSVAVATLRDPQNDAERVQKPEWLVVIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPHYEFPEDGLLIVG 265          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: EFX88639.1 (hypothetical protein DAPPUDRAFT_304712 [Daphnia pulex])

HSP 1 Score: 288.886 bits (738), Expect = 1.581e-97
Identity = 125/200 (62.50%), Postives = 165/200 (82.50%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
             +R  H+DV +PDFS YRRS  KD ++ N  +A +R+ F+Y++ GS A+ G YA K +V +F+ SM+ +ADVLALAKIE+K++DIPEGKN+ FKWRGKP+F+RHRT++EI+ E+ VD+++LR P++DS+R Q  +WLV++GVC HLGCVPIAN+GEFGGYYCPCHGSHYDASGRIRKGPAPLNLE+P + F  E+ LVVG
Sbjct:   74 QVRFAHTDVSIPDFSAYRRSNLKDSSADNKSSAPSRQGFSYLIVGSGAVGGAYAAKTVVGEFVGSMSASADVLALAKIEVKLNDIPEGKNVTFKWRGKPLFIRHRTAEEIDTESKVDMSTLRDPQLDSDRAQRPEWLVLLGVCTHLGCVPIANSGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEIPIHTFVDENTLVVG 273          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: gb|EFA01233.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial-like Protein [Tribolium castaneum])

HSP 1 Score: 278.485 bits (711), Expect = 1.548e-93
Identity = 123/209 (58.85%), Postives = 162/209 (77.51%), Query Frame = 0
Query:   54 FSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
             S   A +  +R  H+D+ VPD+S YRR   K PT+ +  +   RK+F Y+++G+  +   YA K +V +F++SM+ +ADVLALAKIEIK+ +IPEGK++ FKWRGKP+F+RHRT++EI  E  V+V+SLR P+ D++R +  +WLV++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF +D  LVVG
Sbjct:   60 ISSGPAVSTQVRWAHTDINVPDWSHYRRDPVKAPTAKSTDSEEGRKSFTYLIAGAGTVTAAYAAKAVVGQFVSSMSASADVLALAKIEIKLGEIPEGKSVTFKWRGKPLFIRHRTAEEIATEQGVNVSSLRDPQHDNDRVKKPEWLVILGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPYYEFPDDTTLVVG 268          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: gb|KFM63457.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial, partial [Stegodyphus mimosarum])

HSP 1 Score: 277.33 bits (708), Expect = 4.518e-93
Identity = 130/215 (60.47%), Postives = 157/215 (73.02%), Query Frame = 0
Query:   48 SGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            +GC+ + S        +R  H+DVQ PDF FYRR   KDPT  + ++   RK  +Y+V     I   YA K  V+KFI SM  +ADVLALAKIEIK+SDIPEGKNM FKWRGKP+FVRHRT  EI+ E  VDV+SLR P+ D+ER  + +WLVV+GVC HLGCVP+   G++GGY+CPCHGSHYDASGRIRKGPAPLNLEVP YE+  +D LVVG
Sbjct:   67 TGCVGALS-------QVRLAHTDVQAPDFDFYRRKEVKDPTKSSRESEDYRKASSYMVMAVGGIGAAYATKNTVTKFIASMAASADVLALAKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTPDEIQKEATVDVSSLRDPQSDAERATNPEWLVVIGVCTHLGCVPLPGVGDYGGYFCPCHGSHYDASGRIRKGPAPLNLEVPPYEYTTDDTLVVG 274          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: XP_006557566.1 (PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Apis mellifera])

HSP 1 Score: 270.396 bits (690), Expect = 2.268e-90
Identity = 118/196 (60.20%), Postives = 152/196 (77.55%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            R  H+D+Q PDFS YR  A +DP S + +N+++RK+F YV++ ++ I G Y  K  +   + + + +ADVLALAKIEIK+  IPEGK+ +FKWRGKP+FVRHR+ +EIE E  VD+  LR P+VD +R +  +WL+V+GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP Y+F +D  VV
Sbjct:   77 RLAHTDIQWPDFSDYRHEAVQDPRSKSKENSSSRKSFAYVMTAASGITGAYIAKSAIHDLVATFSASADVLALAKIEIKLDAIPEGKSAVFKWRGKPIFVRHRSKKEIEKEAAVDIKILRDPQVDLDRVKQPQWLIVLGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPPYDFIDDNTVV 272          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: AGB92413.1 (rieske iron-sulfur protein, isoform D [Drosophila melanogaster])

HSP 1 Score: 263.848 bits (673), Expect = 2.232e-88
Identity = 129/198 (65.15%), Postives = 158/198 (79.80%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            R  H+D+QVPDFS YRR + KD    ND  A  RK F+Y++ G+ A+ G YA K +V+ FI SM+ +A+VLA+AKIEIK+SDIPEGK++ FKWRGKP+F+RHRT+ EIE E NV  ++LR PE D +R    +WLVV+GVC HLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAPLNLEVPT+EF  E +LVVG
Sbjct:   34 RQAHTDLQVPDFSAYRRESVKDSRRRND-TAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: AAF51354.3 (rieske iron-sulfur protein, isoform B [Drosophila melanogaster])

HSP 1 Score: 263.848 bits (673), Expect = 2.232e-88
Identity = 129/198 (65.15%), Postives = 158/198 (79.80%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            R  H+D+QVPDFS YRR + KD    ND  A  RK F+Y++ G+ A+ G YA K +V+ FI SM+ +A+VLA+AKIEIK+SDIPEGK++ FKWRGKP+F+RHRT+ EIE E NV  ++LR PE D +R    +WLVV+GVC HLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAPLNLEVPT+EF  E +LVVG
Sbjct:   34 RQAHTDLQVPDFSAYRRESVKDSRRRND-TAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: AAF51353.2 (rieske iron-sulfur protein, isoform E [Drosophila melanogaster])

HSP 1 Score: 263.848 bits (673), Expect = 2.232e-88
Identity = 129/198 (65.15%), Postives = 158/198 (79.80%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            R  H+D+QVPDFS YRR + KD    ND  A  RK F+Y++ G+ A+ G YA K +V+ FI SM+ +A+VLA+AKIEIK+SDIPEGK++ FKWRGKP+F+RHRT+ EIE E NV  ++LR PE D +R    +WLVV+GVC HLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAPLNLEVPT+EF  E +LVVG
Sbjct:   34 RQAHTDLQVPDFSAYRRESVKDSRRRND-TAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: gb|EEZ97735.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial-like Protein [Tribolium castaneum])

HSP 1 Score: 261.151 bits (666), Expect = 1.202e-87
Identity = 122/198 (61.62%), Postives = 152/198 (76.77%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKE-DILVVG 261
            R  H+D+QVPDF+ YRR+   +P S +  +A +R    Y+VSG+   V +Y  K  V +++  M  +ADVLALAKIEIK+ DIPEGKN  FKWRGKP+F++HRT +EI+ E +VDVA+LRHPE DSER +D  WLVV+GVC HLGCVPIANAG++GGYYCPCHGSHYD+SGRIRKGPAP NLEVP Y F +   L+VG
Sbjct:   10 RFAHTDIQVPDFTPYRRNP--NPCSSSSSSAPSRHLVPYMVSGTAVTVALYGAKAEVIRYVEFMAASADVLALAKIEIKLEDIPEGKNATFKWRGKPLFIKHRTPEEIQTERSVDVATLRHPEHDSERVKDPAWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYDSSGRIRKGPAPTNLEVPEYHFPDAGTLIVG 205          
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Match: gb|KPM06264.1| (cytochrome b-c1 complex subunit Rieske, mitochondrial-like protein, partial [Sarcoptes scabiei])

HSP 1 Score: 244.202 bits (622), Expect = 3.919e-77
Identity = 106/196 (54.08%), Postives = 139/196 (70.92%), Query Frame = 0
Query:   65 RCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            R  H+DV++PDF+ YRR + KD +  + ++  +R+ F Y ++ +T + G    K +V   +N  +PA D LAL+K+E+ I +IPEGKN+  KWRGKPVF+R RT  EI  E  V++  LR PE D +R  + +WLVV+GVC HLGCVPI   G+FGGYYCPCHGSHYDASGRIRKGPAP NLEVP YEF  D L++
Sbjct:    5 RLAHTDVKIPDFTSYRRQSNKDISKTSSESGDDRRAFTYAITTATGVGGALVAKQMVHGLVNMFSPAKDCLALSKVEVNIGNIPEGKNVTVKWRGKPVFIRRRTESEIAAEKAVNLKDLRDPEADEKRAPNPEWLVVIGVCTHLGCVPIPGKGDFGGYYCPCHGSHYDASGRIRKGPAPANLEVPNYEFDGDKLII 200          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|225712136|gb|ACO11914.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Lepeophtheirus salmonis])

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 257/276 (93.12%), Postives = 258/276 (93.48%), Query Frame = 0
Query:    1 MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTW---------------NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG 261
            MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTW               +IRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGK IVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIE NVDVASLRHPEVDSERCQDEKWLVVVGVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG
Sbjct:    1 MMMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWKYGMTNISSGLGVSTSIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKSIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIEKNVDVASLRHPEVDSERCQDEKWLVVVGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG 276          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|225718980|gb|ACO15336.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Caligus clemensi])

HSP 1 Score: 440.654 bits (1132), Expect = 7.615e-155
Identity = 208/276 (75.36%), Postives = 231/276 (83.70%), Query Frame = 0
Query:    2 MMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTS-FSMNQATTW---------------NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVVG 261
            MMMQ+L KAAGNG+ SR TSQAVP+LT SSVTHH+API E+  QA     T+ + MNQA +W                +R LHSD QVPDF+FYRR ATKDPTSVN+KNAANRKTFNY VSG+ A+VGIY GK IVSKF+NSMNPAADVLALAKIEIKI+DIPEGKNMIFKWRGKPVFVRHRT+ EI+ E +VD+ASLR P+ D++RCQDEKWLVVVGVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP +EFKEDILVVG
Sbjct:    1 MMMQSLTKAAGNGAFSRVTSQAVPALTSSSVTHHNAPIPETPSQAVGAAYTTAYPMNQALSWKYGMTTITSGLGISTTVRSLHSDAQVPDFTFYRRGATKDPTSVNNKNAANRKTFNYAVSGTAAVVGIYGGKSIVSKFVNSMNPAADVLALAKIEIKITDIPEGKNMIFKWRGKPVFVRHRTATEIDAEKSVDLASLRDPQTDTDRCQDEKWLVVVGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPIHEFKEDILVVG 276          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|225718816|gb|ACO15254.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Caligus clemensi])

HSP 1 Score: 414.461 bits (1064), Expect = 1.518e-144
Identity = 195/260 (75.00%), Postives = 217/260 (83.46%), Query Frame = 0
Query:    2 MMMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTS-FSMNQATTW---------------NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLN 245
            MMMQ+L KAAGNG+ SR TSQAVP+LT SSVTHH+API E+  QA     T+ +SMNQA +W                +R LHSD QVPDF+FYRR ATKDPTSVN+KNAANRKTFNY VSG+ A+VGIY GK IVSKF+NSMNPAADVLALAKIEIKI+DIPEGKNMIFKWRGKPVFVRHRT+ EI+ E +VD+ASLR P+ D++RCQDEKWLVVVGVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLN
Sbjct:    1 MMMQSLTKAAGNGAFSRVTSQAVPALTSSSVTHHNAPIPETPSQAVGAAYTTAYSMNQALSWKYGMTTITSGLGVSTTVRSLHSDAQVPDFTFYRRGATKDPTSVNNKNAANRKTFNYAVSGTAAVVGIYGGKSIVSKFVNSMNPAADVLALAKIEIKITDIPEGKNMIFKWRGKPVFVRHRTATEIDAEKSVDLASLRDPQTDTDRCQDEKWLVVVGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLN 260          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|90819978|gb|ABD98746.1| (Rieske iron-sulfur protein 1 [Graphocephala atropunctata])

HSP 1 Score: 298.516 bits (763), Expect = 9.652e-99
Identity = 143/273 (52.38%), Postives = 190/273 (69.60%), Query Frame = 0
Query:    3 MMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQ-------------ATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFK-EDILVVG 261
            M+  ++K+A      +A+SQAV S     V     P   + P      +TS+++ +               T  +R  H+D++VPDFS YRR AT+DPTS N  +  +RK F Y++ G  A+   YA K +V + +++M+ +ADVLALAKIE+K+S IPEGK++ FKWRGKP+F+RHRT+QEIE+E  V +A LR P+ D +R Q  +WLV++GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLE+PTYEF+ ED+LVVG
Sbjct:    1 MINVVSKSANLSPYLKASSQAVASSVKPLVKPTVIPGKSTYPTPPVP-LTSYALTKLLPSNDIKVRTGPTVTTQVRWAHTDIEVPDFSAYRRKATRDPTSKNIDSDESRKAFTYLIVGGGAVATAYAAKTVVRQLVSTMSASADVLALAKIEVKLSAIPEGKSVTFKWRGKPLFIRHRTNQEIEVERGVPLAELRDPQHDDDRVQKPEWLVLIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEIPTYEFQTEDLLVVG 272          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|966641663|gb|KTF76577.1| (hypothetical protein cypCar_00045659 [Cyprinus carpio])

HSP 1 Score: 298.13 bits (762), Expect = 1.431e-98
Identity = 130/215 (60.47%), Postives = 171/215 (79.53%), Query Frame = 0
Query:   46 ATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            A SG   S S+N  +T  +R  H+D+++PDFS YRR    DP   +  +   R+ F+Y+++GSTA+VG+YA K +V++F++SM+ +ADVLAL+KIEIK+SDIPEGKNM FKWRGKP+FVRHRT +EI  E +V++A LR P+ D +R Q+  W++V+GVC HLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF++D  V+
Sbjct:   59 AKSGLAVSVSLNARST--VRFAHTDIKIPDFSDYRRPEVLDPKKSSQDSGETRRAFSYLITGSTAVVGVYAAKTVVTQFVSSMSASADVLALSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTEKEIASEADVNLAELRDPQHDRDRVQNPTWVIVIGVCTHLGCVPIANAGDYGGYYCPCHGSHYDASGRIRKGPAPLNLEVPYYEFQDDDTVI 271          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|158299624|ref|XP_319708.4| (AGAP008955-PA [Anopheles gambiae str. PEST] >gi|157013606|gb|EAA14787.4| AGAP008955-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 297.36 bits (760), Expect = 2.324e-98
Identity = 143/266 (53.76%), Postives = 193/266 (72.56%), Query Frame = 0
Query:    3 MMQNLAKAAGNGSLSRATSQAV-PSLTGSSVTHHSAPISES-IPQATSGCMTSFSMNQAT----TWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKED-ILVVG 261
            M+ NLAK +    +S++ +  + P++ G++ T   + ++   IP  ++  + S ++   +       IRC H+D++VPDFS YRR   K P + ND +A +R  F Y++ G  A+   Y  K +VS F++SM+ +ADVLA++KIEIK++DIPEGK+M FKWRGKP+F+RHRTS EIE E +V VA+LR P+ D+ER Q  +WLVV+GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF ED +L+VG
Sbjct:    1 MLTNLAKLSAVRGVSQSVTNGLKPAVVGAAKTEGKSVVAAGPIPVVSAAGLPSNNVRVVSGVTGATQIRCAHTDIRVPDFSDYRRDQVKRPNAKND-SADDRAAFTYLLVGGAAVSTAYVAKSLVSTFVSSMSASADVLAMSKIEIKLADIPEGKSMTFKWRGKPLFIRHRTSAEIEAEQSVAVATLRDPQNDAERVQKPEWLVVIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPHYEFPEDGLLIVG 265          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|961375894|gb|ALS04691.1| (ubiquinol-cytochrome C reductase [Pseudodiaptomus poplesia])

HSP 1 Score: 296.204 bits (757), Expect = 4.453e-98
Identity = 131/208 (62.98%), Postives = 169/208 (81.25%), Query Frame = 0
Query:   56 MNQATTWNIRCLHS-DVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFK-EDILVVG 261
            +  A +  +R LH+ +V VPDFS+YRRS TKDPT+ +DK   +R++F+Y+++    + G Y+ K +VS+FI+S +P+ DVLA+A+IEIK+ DIPEGKNM FKWRGKP+F+RHRT +EI+ E  VDV++LR P+ D ER Q+ +WLV++GVC HLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVP +EFK E  L+VG
Sbjct:   42 IQPAVSTQVRSLHAGNVDVPDFSYYRRSGTKDPTTKSDKGMESRQSFSYILADGLGVTGAYSAKAVVSQFISSWSPSQDVLAMAQIEIKLDDIPEGKNMTFKWRGKPLFIRHRTPEEIDQERAVDVSTLRDPQTDEERVQNAEWLVILGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPVHEFKDEGTLLVG 249          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|966712667|gb|KTG44905.1| (hypothetical protein cypCar_00017312 [Cyprinus carpio])

HSP 1 Score: 296.975 bits (759), Expect = 4.657e-98
Identity = 129/215 (60.00%), Postives = 171/215 (79.53%), Query Frame = 0
Query:   46 ATSGCMTSFSMNQATTWNIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            A SG   S S+N  +   +R  H+D+++PDFS YRR    DP   + ++   R+ F+Y+++GSTA+VG+YA K IV++F++SM+ +ADVLAL+KIE+K+SDIPEGKNM FKWRGKP+FVRHRT +EI  E +V++A LR P+ D +R Q+  W++V+GVC HLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF++D  V+
Sbjct:   59 AKSGLAVSVSLNARSL--VRFAHTDIKIPDFSDYRRPEVLDPKKSSQESGDTRRAFSYLITGSTAVVGVYAAKTIVTQFVSSMSASADVLALSKIEVKLSDIPEGKNMTFKWRGKPLFVRHRTEKEIAAEADVNLAELRDPQHDKDRVQNPTWVIVIGVCTHLGCVPIANAGDYGGYYCPCHGSHYDASGRIRKGPAPLNLEVPYYEFQDDDTVI 271          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|1022778174|gb|KZS21668.1| (Cytochrome b-c1 complex subunit Rieske, mitochondrial [Daphnia magna])

HSP 1 Score: 296.204 bits (757), Expect = 7.613e-98
Identity = 141/273 (51.65%), Postives = 197/273 (72.16%), Query Frame = 0
Query:    3 MMQNLAKAAGNGSLSRATSQAVPSLTGSSVTHHSAPISESIPQATSGCMTSFSMNQATTWN-------------IRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEF-KEDILVVG 261
            M+  +A++A   S++ A +Q V + T +     S  I  ++       +T+ S+  +   N             +R  H+D+QVPDFS YRRS+ KD T+    +AA+R+ F+Y++ GS A+ G YA K +V +F++SM+ +ADVLALAKIE+K++DIPEGKN+ FKWRGKP+F+RHRT+ EI+ E+NVD++SLR P++DS+R Q  +WLV++GVC HLGCVPIAN+G+FGGYYCPCHGSHYD+SGRIRKGPAPLNLE+PT+ F  E+ LVVG
Sbjct:    1 MLSFVARSANASSVTVAATQTVANGTKALCPAVSIQIERTLVPPAPQKLTTNSLTASLPKNPIRAAASLGGPIQVRFAHTDIQVPDFSAYRRSSVKDNTADTRSSAASRQGFSYLIVGSGAVGGAYAAKSVVGEFVSSMSASADVLALAKIEVKLNDIPEGKNVTFKWRGKPLFIRHRTAAEIDAESNVDLSSLRDPQLDSDRAQRPEWLVLLGVCTHLGCVPIANSGDFGGYYCPCHGSHYDSSGRIRKGPAPLNLEIPTHTFVDENTLVVG 273          
BLAST of EMLSAG00000000007 vs. nr
Match: gi|37811697|gb|AAR03847.1| (rieske iron-sulfur protein [Tigriopus californicus])

HSP 1 Score: 293.508 bits (750), Expect = 2.185e-97
Identity = 128/198 (64.65%), Postives = 161/198 (81.31%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
             IR  H+D++VPDF++YRRS+TKD T+ N ++ ANR  F Y+++   AI  +Y     V+ FI++++P+ DVLA+AKIE+K+SDIPEGKNM FKWRGKP+FVRHRTS EI+ EN VD  SLR P+ D ER +D K+L+V+GVC HLGCVPIANAG+FGGYYCPCHGSHYDASGRIRKGPAPLNLEVP YEF E+ +V+
Sbjct:   28 QIRLAHTDMEVPDFTYYRRSSTKDSTAKNRESHANRNGFAYLMTAGAAIPSVYGATKFVNVFISNLSPSRDVLAMAKIEVKLSDIPEGKNMTFKWRGKPLFVRHRTSAEIDTENKVDATSLRDPQTDEERVKDPKFLIVIGVCTHLGCVPIANAGQFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPEYEFPEEGMVI 225          
BLAST of EMLSAG00000000007 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold571_size134521-snap-gene-0.15 (protein:Tk11008 transcript:maker-scaffold571_size134521-snap-gene-0.15-mRNA-1 annotation:"rieske iron-sulfur protein")

HSP 1 Score: 284.263 bits (726), Expect = 2.521e-97
Identity = 120/198 (60.61%), Postives = 161/198 (81.31%), Query Frame = 0
Query:   63 NIRCLHSDVQVPDFSFYRRSATKDPTSVNDKNAANRKTFNYVVSGSTAIVGIYAGKXIVSKFINSMNPAADVLALAKIEIKISDIPEGKNMIFKWRGKPVFVRHRTSQEIEIENNVDVASLRHPEVDSERCQDEKWLVVVGVCXHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFKEDILVV 260
            ++R  H+D++ PDF++YRRSA KD T+ N  + A R  F+Y+++ + A+  +Y    +V+ FI +++P+ DVLA+AKIE+ ++DIPEGKNM FKWRGKP+F+RHRT  EI+ E +VD+A+LR P+ D+ER +DEK+L+V+GVC HLGCVPIANAGEFGGYYCPCHGSHYDA GRIRKGPAPLNLEVP YEF E+ +V+
Sbjct:   41 HVRLNHTDMEAPDFTYYRRSANKDSTARNRDSVAQRNGFSYLMTAAAAMPTVYGASSLVNSFIVNLSPSKDVLAMAKIEVSVADIPEGKNMTFKWRGKPLFIRHRTQAEIDKEKSVDMAALRDPQTDTERVKDEKFLIVIGVCTHLGCVPIANAGEFGGYYCPCHGSHYDACGRIRKGPAPLNLEVPEYEFMEEGMVI 238          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000007 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-1.290e-9559.53symbol:uqcrfs1 "ubiquinol-cytochrome c reductase, ... [more]
-2.068e-9253.41symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]
-6.602e-9261.50symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]
-4.174e-9153.41symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]
-3.172e-9053.75symbol:Uqcrfs1 "Cytochrome b-c1 complex subunit Ri... [more]
-3.172e-9053.75symbol:Uqcrfs1 "ubiquinol-cytochrome c reductase, ... [more]
-6.280e-9062.69symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]
-7.239e-9060.50symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]
-1.034e-8961.50symbol:Uqcrfs1 "ubiquinol-cytochrome c reductase, ... [more]
-4.334e-8959.05symbol:UQCRFS1 "Cytochrome b-c1 complex subunit Ri... [more]

Pages

back to top
BLAST of EMLSAG00000000007 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 8
Match NameE-valueIdentityDescription
gi|592779429|gb|GAXK01175139.1|4.952e-9255.60TSA: Calanus finmarchicus comp2304_c3_seq6 transcr... [more]
gi|592779431|gb|GAXK01175137.1|5.631e-9155.60TSA: Calanus finmarchicus comp2304_c3_seq4 transcr... [more]
gi|592779425|gb|GAXK01175143.1|9.635e-9157.31TSA: Calanus finmarchicus comp2304_c3_seq10 transc... [more]
gi|592779430|gb|GAXK01175138.1|1.280e-8957.31TSA: Calanus finmarchicus comp2304_c3_seq5 transcr... [more]
gi|592780785|gb|GAXK01173783.1|1.296e-5671.32TSA: Calanus finmarchicus comp5719031_c0_seq1 tran... [more]
gi|592869649|gb|GAXK01087913.1|1.435e-1244.30TSA: Calanus finmarchicus comp6570314_c0_seq1 tran... [more]
gi|592915635|gb|GAXK01042740.1|1.715e-652.27TSA: Calanus finmarchicus comp6519066_c0_seq1 tran... [more]
gi|592878436|gb|GAXK01079465.1|8.651e-555.56TSA: Calanus finmarchicus comp3091676_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000000007 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000070.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:2093... [more]
back to top
BLAST of EMLSAG00000000007 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|54036555|sp|Q69BJ7.1|UCRI_SAISC1.936e-9563.00RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|54036557|sp|Q69BJ9.1|UCRI_AOTAZ2.867e-9562.63RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|54036556|sp|Q69BJ8.1|UCRI_LAGLA1.381e-9462.00RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|1351360|sp|P13272.3|UCRI_BOVIN8.637e-9353.41RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|52001457|sp|P20788.2|UCRI_RAT6.645e-9253.75RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|54036563|sp|Q69BK5.1|UCRI_PANTR7.912e-9263.21RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|54036562|sp|Q69BK4.1|UCRI_GORGO1.224e-9162.69RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|54036561|sp|Q69BK3.1|UCRI_PONPY1.293e-9162.69RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|143811471|sp|P47985.2|UCRI_HUMAN1.321e-9162.69RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]
gi|75571417|sp|Q5ZLR5.1|UCRI_CHICK1.522e-9160.50RecName: Full=Cytochrome b-c1 complex subunit Ries... [more]

Pages

back to top
BLAST of EMLSAG00000000007 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 16
Match NameE-valueIdentityDescription
EAA14787.44.750e-10153.76AGAP008955-PA [Anopheles gambiae str. PEST][more]
EFX88639.11.581e-9762.50hypothetical protein DAPPUDRAFT_304712 [Daphnia pu... [more]
gb|EFA01233.1|1.548e-9358.85Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gb|KFM63457.1|4.518e-9360.47Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
XP_006557566.12.268e-9060.20PREDICTED: cytochrome b-c1 complex subunit Rieske,... [more]
AGB92413.12.232e-8865.15rieske iron-sulfur protein, isoform D [Drosophila ... [more]
AAF51354.32.232e-8865.15rieske iron-sulfur protein, isoform B [Drosophila ... [more]
AAF51353.22.232e-8865.15rieske iron-sulfur protein, isoform E [Drosophila ... [more]
gb|EEZ97735.1|1.202e-8761.62Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gb|KPM06264.1|3.919e-7754.08cytochrome b-c1 complex subunit Rieske, mitochondr... [more]

Pages

back to top
BLAST of EMLSAG00000000007 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|225712136|gb|ACO11914.1|0.000e+093.12Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gi|225718980|gb|ACO15336.1|7.615e-15575.36Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gi|225718816|gb|ACO15254.1|1.518e-14475.00Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gi|90819978|gb|ABD98746.1|9.652e-9952.38Rieske iron-sulfur protein 1 [Graphocephala atropu... [more]
gi|966641663|gb|KTF76577.1|1.431e-9860.47hypothetical protein cypCar_00045659 [Cyprinus car... [more]
gi|158299624|ref|XP_319708.4|2.324e-9853.76AGAP008955-PA [Anopheles gambiae str. PEST] >gi|15... [more]
gi|961375894|gb|ALS04691.1|4.453e-9862.98ubiquinol-cytochrome C reductase [Pseudodiaptomus ... [more]
gi|966712667|gb|KTG44905.1|4.657e-9860.00hypothetical protein cypCar_00017312 [Cyprinus car... [more]
gi|1022778174|gb|KZS21668.1|7.613e-9851.65Cytochrome b-c1 complex subunit Rieske, mitochondr... [more]
gi|37811697|gb|AAR03847.1|2.185e-9764.65rieske iron-sulfur protein [Tigriopus californicus... [more]

Pages

back to top
BLAST of EMLSAG00000000007 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold571_size134521-snap-gene-0.152.521e-9760.61protein:Tk11008 transcript:maker-scaffold571_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:209319..213491 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteCytochrome b-c1 complex subunit Rieske, mitochondrial
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1003-snap-gene-1.12
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000007 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000007EMLSAT00000000007-695854Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:209319..213491+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000007-682773 ID=EMLSAG00000000007-682773|Name=EMLSAG00000000007|organism=Lepeophtheirus salmonis|type=gene|length=4173bp|location=Sequence derived from alignment at LSalAtl2s1003:209319..213491+ (Lepeophtheirus salmonis)
GTCGTTCCCTTATGAACCACTGTCGCAAATCAGCTGCTTCTCTTCATCCA TCTTCGTAATTACAAAGTGACTTACTAATCAGACTTCATCCTTTGAAAGA TTCACGATGATGATGATGCAAAACTTGGCCAAGGCTGCAGGTAATGGATC TTTATCCAGAGCTACATCCCAAGCTGTKCCTTCACTCACGGGATCCTCCG TTACTCACCATTCAGCCCCCATCTCCGAGTCTATTCCTCGTAAGATCCAT CAAATACAATTTATTTGTATCTTTTTGTGTATAATTTATTTTATTTGTTT TTCAGAGGCAACCAGTGGTTGCATGACTTCATTTTCTATGAACCAAGCTA CGACGTGGAAGTACGGAATGACGAATATTTCTTCGGGTCTTGGTGGTAAG TTAACATTTAGGGATGCAGCAGGCAGGCAATTCCATAGGCAGCCTTTGCA TTATATCTCACGTCATATATTCCATCATAATTGAAGGAGACACATCTTGG GAGCTCAAATTTGATATTTTTTACGTCATAAAATACTCAAATTTCTCTAT AAATCTTCATGAAACATCATCAAATGTCTTTAAAAAAAAAAATGACTGAG CAACCGCATTGAATACTACTTGATGTCAGTGATATTTGATTTAAATCTAA GAAYTATGTACTGAAAATCCTTTAAAATGTAGCCATTTTTACGAATTTTG GTTCCCTTTTGATCGATTAGGGACGAGAAAAGTAGACATAGCCTCATATT AAAACAATTAACAACATTAATAAGTTAATGATATGTAATGAATTACATGT TTTGATTACTAATTGCGCAACATTTCCTTTTCTAAATTATTTCTTGATTA ATTGTTTCCCAGCAATGTATCGAATATTTTCACTGATGTCATTAATTGCA TCATAATTGAGGAAGACGCATTTTGTGGGCTTAAATTTCATATTTTTACA ACATAAAATGGACGAATTTGCAATAGATCTTCATGCAACATCATCAAATG CCTTTAAGAATAAAAAAGACTTAACAAATTCAAGGAATACTACTTGATGC CCATTGAGAAACAGTGATATTTAAATATAATCAAAGTAATATGTACTAAA AATCCCTAAAAGTGGATAGATTTGTACAATTTTTGTTATGTTTTGGACCG ATTAGGGATGAGAAAAAGTCGGATAAAAAGATTGTATAACGATGTACTAA AATATTTTAATATATTTTATTTAAGATTTATTTGAAGATTTGACCCTGGT TTCGCTACTAAAAGTGTGAAAAAAATATTTAGGTTAGAAAATGAGCATTG AGAATTAAGTCTTTTCTGGGGTAAAAATGTCTGCAAATTATGATTTTTTT AAAGTTTGAATCCTGTATTTTTTGTCGTTTAGCCAAGAAATCTGAATTTG TGACTAATTTTACCTTAAAATGACTACTTTTGCGTGATTTTTTTTTTAAA TCCCAATTTCGTAGACATATGGAATCAACAATGTACATTTAAAGGAACAT TATTTATGTTAAAATGACAGATAATGTCAAGGACTTCATAATAAATTTGT CTGTTCAGTTGTTTCTTCCATAACTTTTGTGCATTGACCGTTTAAAGAAT ATGTCTCAAGTGACAAACGGGAATCATAAGTTGACACTTTTCCATAAATG CCTTGCATTAGTTAGCCAAATCTATTAATAAGAAAGGCCTAGAGGCTTGA TTTACCTATCATTTTATTGGTAATTTAATAAGCTTTAAATTGATAGCTAA TTGATACTATTTCTTATGGAAAAACATTTAAAAAATATTAGCCTTACTCC TTTATTTTATTGACGTGTGAAAAAATATCCCCTCATTAAAATGGATAGTA CATAAAACGTTTGGAGCTATATACTTGAAAATTTTATCGTTGTTACTTAA AATAGTATCATTTAGGCTTTGTCTAATTATTTCTTAGTAGGTGTAGTGTT CCCGAAATTTTAACTTCACGTGTTACGCATTTAAAATTTTGTGCAAAATT TCACATTACGAGAGGCCGTGACAAAAATTAGGAATGAGTGATATTCGTTA AAAGTTAATCAATTATGCCCAGGATATACTTCTAATGAAAATGATACCCA AAGTCAAAGTAATTGTCATTTCTGATTATTTATTTTATTTTACGAAGCAA CAGAAACTCGAATTTTGAACAAAATATCCATGTTTCGGAATGCGTTATAT TGCGTAATCAAATGACCAGTAGTTACTTGATATTGACTAAATCAAGGTCC AGTTTGTCACAATAAGACTAATGGTTCTCAAAACTACAGATGTTTAATTA TTTGATTTATTTGTAGAACTTCAAAATGCTAAAGAGATATTTTTATTTTG TCAGTTTAGACATACCTTTACAAAAATAAAATATCTAAATAAACATTAAA TATTTTCTATTTTTGACTTCAGATTTGAATTTACATAAAAATATGGATTA GAAAACATGTATTACTTAAAAAGATTTCGAAACTTGATAATTTCCCAATT TTGGCAGTGACACCGTGGTCGAATCTCAAACCACGTCATATACAATAAAA CTAGGTAATAAAGGGATAGTAAGAATTTAATACCTTATATTTGCTAGTCC CATTTCTACATCTAATAGTTAACTATTTTCCTTTATATTAATGAAAAAGG ATTTGTATTGTTTTAAAACTTGGTTGTTTATGCATAAAATGGCCAACGAT GCTGACGTCATGTAAAAATCCTCTTAAACTCAAGATTTCCTTTCATACCT CTCATAAAAAAGATGAGTTCTAATAGAGGGATATTTACTCCCAAATTTTA TCACTGTTATATATCTTATACAATTTTAGAGATTATGCAATATCCATAAT TTTCTAATATTTTAAAAGCAAAGTGATTTCGACAATAGCATGTTCAATTG CATTCAAATTTGTTATATTAGGAACGTAATTTCAATATTATGATTATAAT TTTTCTAAGTCTTAAAATGAAAATTGTATTTGGAATTATTAAGATGTGAA AACTACAAAATAACGCAGATATACTTAGATCTAATTCTAATTGATTTATA AATTTTCTTGTTATTTTTTTTTACCAAGAGATTGATATCAAAATGAAATA ATTAACATTTTTATTAAGATAAAATGACCAGTCTCTAGATATTGTATATA TGCATTATAATTTCTTATTTTAGTTTCAACCAGCATACGATGTCTTCACA GCGATGTACAGGTTCCTGACTTTAGTTTCTACCGAAGAAGTGCTACCAAG GATCCAACCTCTGTAAACGATAAAAATGCTGCAAATCGCAAAACTTTTAA TTATGTAGTGTCTGGTTCTACGGCTATTGTTGGTATTTATGCAGGCAAAA GWATTGTCAGTAAATTTATCAACTCCATGAACCCTGCTGCTGATGTATTG GCTTTGGCTAAAATCGAAATTAAAATTTCTGATATACCTGAAGGAAAGAA TATGATCTTCAAGTGGAGGGGAAAACCTGTTTTTGTTCGGCATAGGTAAG ATTGATTTAACATTTGCTTAATGTCATAAAGCTTAATTTTGTATTCAATA TTAGAACGTCCCAAGAAATAGAAATAGAAAATAATGTCGATGTTGCTTCT CTTCGTCATCCTGAAGTAGATAGTGAGAGATGTCAAGACGAAAAATGGCT TGTTGTTGTCGGTGTGTGCNCTCATTTGGGATGCGTACCCATTGCTAATG CCGGAGAATTTGGGGGATACTACTGTCCTTGTCACGGATCGCATTATGAT GCATCTGGACGTATTCGTAAAGGTCCTGCTCCTCTAAACTTGGAAGTCCC TACCTATGAATTTAAAGAAGATATACTCGTTGTTGGATAAAATGTTTGTC TCTTTTTAAAACTCACATAATTAAGTGAATTTATGTTATTTGAGTTGTAA TGTATTTGTCAAATATTTTATAGAAAAAAAAAGATATTTATTATTAATGA ATCATTTTTTTGTAACAAAGAAGGAATTTGGATATTCTTTATCCTACTAA AATTAGAATCTTAGCCATATCGTCTTTTTCGTTGGCTTTATTTTTTATTT TTTTTTCGTGGACGCTGAGTAATATTTGTTGTAGAATTTTGTCATGGTTC ATAATTKATTTATATCTTTGACGACCATCATCTTGGAAATAGATTAAATA GTTATTCGTTATTAAATATTTTA
back to top
Add to Basket