EMLSAG00000000008, EMLSAG00000000008-682774 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000008
Unique NameEMLSAG00000000008-682774
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:dhx16 "putative RNA splicing factor" species:44689 "Dictyostelium discoideum" [GO:0005634 "nucleus" evidence=IEA;ISS] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0008380 "RNA splicing" evidence=IEA;ISS] [GO:0006397 "mRNA processing" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0004386 "helicase activity" evidence=IEA] [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0003724 "RNA helicase activity" evidence=ISS] [GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA] [GO:0008026 "ATP-dependent helicase activity" evidence=IEA] [GO:0006200 "ATP catabolic process" evidence=IEA] [GO:0003676 "nucleic acid binding" evidence=IEA] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR002483 InterPro:IPR003593 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF01480 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00382 SMART:SM00490 SMART:SM00847 dictyBase:DDB_G0285937 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0005634 GO:GO:0008380 GO:GO:0006200 GO:GO:0006397 GO:GO:0003676 EMBL:AAFI02000082 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 eggNOG:COG1643 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 Gene3D:1.20.1390.10 KO:K12813 GO:GO:0003724 RefSeq:XP_638017.1 STRING:44689.DDBDRAFT_0186761 EnsemblProtists:DDB0233398 GeneID:8625368 KEGG:ddi:DDB_G0285937 OMA:AHISERS Uniprot:Q54MH3)

HSP 1 Score: 70.8626 bits (172), Expect = 6.142e-13
Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV--IXCAXPRRLAANALA 166
            IQ  +K LP+Y +R Q+ D V+ Y V I+V +TGSGK+T +PQ+LH+        I C  PRR+AA ++A
Sbjct:  460 IQEVRKSLPVYPYREQLIDAVREYQVLIIVGETGSGKTTQIPQYLHEAGFSKTGKIGCTQPRRVAAMSVA 529          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:AN5827.2 "mRNA splicing factor RNA helicase (Cdc28), putative (AFU_orthologue AFUA_2G07710)" species:227321 "Aspergillus nidulans FGSC A4" [GO:0005575 "cellular_component" evidence=ND] [GO:0008150 "biological_process" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0006200 GO:GO:0003676 EMBL:BN001301 EMBL:AACD01000100 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 eggNOG:COG1643 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OMA:IEIESKW OrthoDB:EOG7M98QW RefSeq:XP_663431.1 ProteinModelPortal:Q5B0V3 STRING:162425.CADANIAP00007219 EnsemblFungi:CADANIAT00007219 GeneID:2871194 KEGG:ani:AN5827.2 Uniprot:Q5B0V3)

HSP 1 Score: 70.4774 bits (171), Expect = 8.647e-13
Identity = 41/108 (37.96%), Postives = 61/108 (56.48%), Query Frame = 0
Query:   62 TLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            T+  Q+      M + QR +QE L   E       + I+  +K LPIY+FR QI   V ++ V I+V +TGSGK+T LPQ+LH+     +   + C  PRR+AA ++A
Sbjct:  441 TMDAQMKGTRKLMTQEQRMLQEKLDQAEQKA----QTIEDTRKKLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQLPQYLHEAGYTKNGMKVGCTQPRRVAAMSVA 544          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:AN5827 species:162425 "Aspergillus nidulans" [GO:0003676 "nucleic acid binding" evidence=IEA] [GO:0008026 "ATP-dependent helicase activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0008150 "biological_process" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0006200 GO:GO:0003676 EMBL:BN001301 EMBL:AACD01000100 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 eggNOG:COG1643 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OMA:IEIESKW OrthoDB:EOG7M98QW RefSeq:XP_663431.1 ProteinModelPortal:Q5B0V3 STRING:162425.CADANIAP00007219 EnsemblFungi:CADANIAT00007219 GeneID:2871194 KEGG:ani:AN5827.2 Uniprot:Q5B0V3)

HSP 1 Score: 70.4774 bits (171), Expect = 8.647e-13
Identity = 41/108 (37.96%), Postives = 61/108 (56.48%), Query Frame = 0
Query:   62 TLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            T+  Q+      M + QR +QE L   E       + I+  +K LPIY+FR QI   V ++ V I+V +TGSGK+T LPQ+LH+     +   + C  PRR+AA ++A
Sbjct:  441 TMDAQMKGTRKLMTQEQRMLQEKLDQAEQKA----QTIEDTRKKLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQLPQYLHEAGYTKNGMKVGCTQPRRVAAMSVA 544          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:An05g00290 "Similarity to the Prp2" species:425011 "Aspergillus niger CBS 513.88" [GO:0005575 "cellular_component" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0006200 GO:GO:0003676 EMBL:AM270101 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OrthoDB:EOG7M98QW RefSeq:XP_001390603.1 STRING:5061.CADANGAP00004681 EnsemblFungi:CADANGAT00004777 GeneID:4980765 KEGG:ang:ANI_1_40044 Uniprot:A2QKI0)

HSP 1 Score: 69.707 bits (169), Expect = 1.359e-12
Identity = 37/96 (38.54%), Postives = 58/96 (60.42%), Query Frame = 0
Query:   74 MEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            M + QR++QE +   E    K  + ++  +K LPIY+FR QI   V ++ V I+V +TGSGK+T +PQ+LH+         + C  PRR+AA ++A
Sbjct:  452 MTQEQRRLQEQIDAAE----KKAQSMEDTRKSLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQIPQYLHEAGFTKGGMKVGCTQPRRVAAMSVA 543          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:An05g00290 species:5061 "Aspergillus niger" [GO:0045292 "mRNA cis splicing, via spliceosome" evidence=IEA] [GO:0003676 "nucleic acid binding" evidence=IEA] [GO:0008026 "ATP-dependent helicase activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0006200 GO:GO:0003676 EMBL:AM270101 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OrthoDB:EOG7M98QW RefSeq:XP_001390603.1 STRING:5061.CADANGAP00004681 EnsemblFungi:CADANGAT00004777 GeneID:4980765 KEGG:ang:ANI_1_40044 Uniprot:A2QKI0)

HSP 1 Score: 69.707 bits (169), Expect = 1.359e-12
Identity = 37/96 (38.54%), Postives = 58/96 (60.42%), Query Frame = 0
Query:   74 MEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            M + QR++QE +   E    K  + ++  +K LPIY+FR QI   V ++ V I+V +TGSGK+T +PQ+LH+         + C  PRR+AA ++A
Sbjct:  452 MTQEQRRLQEQIDAAE----KKAQSMEDTRKSLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQIPQYLHEAGFTKGGMKVGCTQPRRVAAMSVA 543          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:AFUA_2G07710 "mRNA splicing factor RNA helicase (Cdc28), putative" species:330879 "Aspergillus fumigatus Af293" [GO:0005575 "cellular_component" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR002483 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 EMBL:AAHF01000001 GO:GO:0006200 GO:GO:0006397 GO:GO:0003676 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 Gene3D:1.20.1390.10 HOGENOM:HOG000175261 KO:K12813 OrthoDB:EOG7M98QW OMA:GYSAIMI RefSeq:XP_755106.1 STRING:5085.CADAFUAP00004662 EnsemblFungi:CADAFUAT00004662 GeneID:3513502 KEGG:afm:AFUA_2G07710 Uniprot:Q4X247)

HSP 1 Score: 69.3218 bits (168), Expect = 1.877e-12
Identity = 39/92 (42.39%), Postives = 55/92 (59.78%), Query Frame = 0
Query:   78 QRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            QR +QE L   E    K    I+  +K LPIY+FR QI   V ++ V I+V +TGSGK+T +PQ+LH+     +   I C  PRR+AA ++A
Sbjct:  448 QRLLQEKLDAAE----KKAASIEETRKSLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQIPQYLHEAGFTKNGMKIGCTQPRRVAAMSVA 535          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:Afu2g07710 species:746128 "Aspergillus fumigatus" [GO:0045292 "mRNA cis splicing, via spliceosome" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0003676 "nucleic acid binding" evidence=IEA] [GO:0008026 "ATP-dependent helicase activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR002483 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 EMBL:AAHF01000001 GO:GO:0006200 GO:GO:0006397 GO:GO:0003676 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 Gene3D:1.20.1390.10 HOGENOM:HOG000175261 KO:K12813 OrthoDB:EOG7M98QW OMA:GYSAIMI RefSeq:XP_755106.1 STRING:5085.CADAFUAP00004662 EnsemblFungi:CADAFUAT00004662 GeneID:3513502 KEGG:afm:AFUA_2G07710 Uniprot:Q4X247)

HSP 1 Score: 69.3218 bits (168), Expect = 1.877e-12
Identity = 39/92 (42.39%), Postives = 55/92 (59.78%), Query Frame = 0
Query:   78 QRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            QR +QE L   E    K    I+  +K LPIY+FR QI   V ++ V I+V +TGSGK+T +PQ+LH+     +   I C  PRR+AA ++A
Sbjct:  448 QRLLQEKLDAAE----KKAASIEETRKSLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQIPQYLHEAGFTKNGMKIGCTQPRRVAAMSVA 535          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:ESP3 "AT1G32490" species:3702 "Arabidopsis thaliana" [GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS] [GO:0005634 "nucleus" evidence=ISM] [GO:0009793 "embryo development ending in seed dormancy" evidence=NAS] [GO:0008380 "RNA splicing" evidence=NAS] [GO:0035194 "posttranscriptional gene silencing by RNA" evidence=IMP] [GO:0016020 "membrane" evidence=IDA] [GO:0006306 "DNA methylation" evidence=RCA] [GO:0006342 "chromatin silencing" evidence=RCA] [GO:0007267 "cell-cell signaling" evidence=RCA] [GO:0009616 "virus induced gene silencing" evidence=RCA] [GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA] [GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 EMBL:CP002684 GO:GO:0005524 GO:GO:0016020 GO:GO:0008380 GO:GO:0006200 GO:GO:0003676 GO:GO:0035194 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 eggNOG:COG1643 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OMA:IEIESKW EMBL:AY074318 EMBL:AY133872 RefSeq:NP_174527.2 UniGene:At.40132 STRING:3702.AT1G32490.1-P EnsemblPlants:AT1G32490.1 GeneID:840143 KEGG:ath:AT1G32490 TAIR:At1g32490 InParanoid:Q8VY00 ProtClustDB:CLSN2685836 BioCyc:ARA:GQT-451-MONOMER BioCyc:ARA:GQT-452-MONOMER PRO:PR:Q8VY00 Genevestigator:Q8VY00 Uniprot:Q8VY00)

HSP 1 Score: 68.9366 bits (167), Expect = 2.097e-12
Identity = 29/71 (40.85%), Postives = 48/71 (67.61%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            E+Q  ++ LPIY +R Q+   V+ + V ++V DTGSGK+T +PQ+LH+  +  +  + C  PRR+AA ++A
Sbjct:  396 ELQEVRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPRRVAAMSVA 466          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:DHX16 "Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16" species:9606 "Homo sapiens" [GO:0003724 "RNA helicase activity" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IDA] [GO:0006397 "mRNA processing" evidence=IEA] [GO:0008026 "ATP-dependent helicase activity" evidence=IEA] [GO:0008380 "RNA splicing" evidence=IEA] [GO:0044822 "poly(A) RNA binding" evidence=IDA] [GO:0005730 "nucleolus" evidence=IDA] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0005634 EMBL:BA000025 GO:GO:0008380 GO:GO:0006200 GO:GO:0006397 GO:GO:0003676 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 EMBL:AL845353 eggNOG:COG1643 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OMA:IEIESKW GO:GO:0003724 HOVERGEN:HBG039428 EMBL:AB001601 EMBL:AB011149 EMBL:BC008825 EMBL:BC009392 RefSeq:NP_001157711.1 RefSeq:NP_003578.2 UniGene:Hs.485060 ProteinModelPortal:O60231 SMR:O60231 BioGrid:114027 IntAct:O60231 MINT:MINT-5003862 STRING:9606.ENSP00000390938 PhosphoSite:O60231 PaxDb:O60231 PRIDE:O60231 DNASU:8449 Ensembl:ENST00000376442 Ensembl:ENST00000383577 Ensembl:ENST00000417308 Ensembl:ENST00000421095 Ensembl:ENST00000424672 Ensembl:ENST00000451456 Ensembl:ENST00000458094 GeneID:8449 KEGG:hsa:8449 UCSC:uc003nqz.3 CTD:8449 GeneCards:GC06M030620 GeneCards:GC06Mj30610 GeneCards:GC06Mk30611 GeneCards:GC06Ml30665 GeneCards:GC06Mm30699 GeneCards:GC06Mn30610 GeneCards:GC06Mo30612 HGNC:HGNC:2739 HPA:HPA051455 MIM:603405 neXtProt:NX_O60231 PharmGKB:PA27205 InParanoid:O60231 PhylomeDB:O60231 TreeFam:TF313473 GeneWiki:DHX16 GenomeRNAi:8449 NextBio:31614 PRO:PR:O60231 ArrayExpress:O60231 Bgee:O60231 CleanEx:HS_DHX16 Genevestigator:O60231 Uniprot:O60231)

HSP 1 Score: 68.1662 bits (165), Expect = 4.510e-12
Identity = 46/145 (31.72%), Postives = 71/145 (48.97%), Query Frame = 0
Query:   30 EESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQ-----EILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            EE   W E   G  S +F     R+A        + QL+   +E  EF R  Q     E  A P +   + +  IQ  ++ LP++ FR ++   + N+ V I+  +TGSGK+T +PQ+L +    N    I C  PRR+AA ++A
Sbjct:  324 EEQRRWEEARLGAASLKF---GARDA---ASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVA 462          
BLAST of EMLSAG00000000008 vs. GO
Match: - (symbol:AO090011000924 "mRNA splicing factor ATP-dependent RNA helicase" species:510516 "Aspergillus oryzae RIB40" [GO:0005575 "cellular_component" evidence=ND] InterPro:IPR001650 InterPro:IPR002464 InterPro:IPR007502 InterPro:IPR011545 Pfam:PF00270 Pfam:PF00271 Pfam:PF04408 PROSITE:PS00690 PROSITE:PS51194 SMART:SM00490 SMART:SM00847 InterPro:IPR027417 SUPFAM:SSF52540 GO:GO:0005524 GO:GO:0006200 GO:GO:0003676 EMBL:AP007171 InterPro:IPR014001 SMART:SM00487 PROSITE:PS51192 InterPro:IPR011709 Pfam:PF07717 GO:GO:0008026 HOGENOM:HOG000175261 KO:K12813 OrthoDB:EOG7M98QW RefSeq:XP_001826484.1 ProteinModelPortal:Q2TZB4 STRING:5062.CADAORAP00005509 EnsemblFungi:CADAORAT00005610 GeneID:5998587 KEGG:aor:AOR_1_1560054 OMA:GYSAIMI Uniprot:Q2TZB4)

HSP 1 Score: 68.1662 bits (165), Expect = 4.663e-12
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 0
Query:   74 MEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            M + QR  QE L   E    K    I+  +K LPIY+FR +I   V ++ V I+V +TGSGK+T +PQ+LH+     +   + C  PRR+AA ++A
Sbjct:  444 MSQEQRIFQEKLDAAE----KKAASIEDTRKSLPIYQFREEIIQAVHDHQVLIIVGETGSGKTTQIPQYLHEAGFTKNGMKVGCTQPRRVAAMSVA 535          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592854938|gb|GAXK01102606.1| (TSA: Calanus finmarchicus comp61615_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 49.6766 bits (117), Expect = 1.454e-6
Identity = 20/49 (40.82%), Postives = 32/49 (65.31%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN 147
            ++  K+ LP++ FR  + D V  + V I+  +TGSGK+T +PQFLH+  
Sbjct: 1232 MKEVKESLPVFPFRQDLIDAVNEHQVLIIEGETGSGKTTQIPQFLHESG 1378          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592791138|gb|GAXK01163430.1| (TSA: Calanus finmarchicus comp218412_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 45.0542 bits (105), Expect = 4.752e-5
Identity = 18/42 (42.86%), Postives = 27/42 (64.29%), Query Frame = 0
Query:  102 FKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFL 143
            F++ LP Y  R ++   V+N  V +L  +TG GK+T +PQFL
Sbjct: 1006 FRRKLPSYAMREEVVQLVRNNQVVVLTGETGCGKTTQVPQFL 1131          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592869517|gb|GAXK01088045.1| (TSA: Calanus finmarchicus comp158133_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 45.0542 bits (105), Expect = 4.989e-5
Identity = 21/55 (38.18%), Postives = 33/55 (60.00%), Query Frame = 0
Query:   97 REIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV 151
            R+++  +  LPI  ++ +I   VQ   V I+  DTG GKST +PQ+L D   K++
Sbjct: 1049 RKLRAGQAALPIAEYKEEILTKVQENQVVIVAGDTGCGKSTQVPQYLLDAGYKNI 1213          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592809271|gb|GAXK01145297.1| (TSA: Calanus finmarchicus comp58731_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 44.2838 bits (103), Expect = 8.806e-5
Identity = 20/50 (40.00%), Postives = 33/50 (66.00%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLH 144
            LQRE    ++ LP++  R +    +  + V +L+A+TGSGK+T +PQFL+
Sbjct:  233 LQRE----RRQLPMWGAREKFLSEIGRHSVVVLLAETGSGKTTQVPQFLY 370          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592838681|gb|GAXK01118863.1| (TSA: Calanus finmarchicus comp193524_c5_seq4 transcribed RNA sequence)

HSP 1 Score: 42.3578 bits (98), Expect = 1.327e-4
Identity = 24/84 (28.57%), Postives = 43/84 (51.19%), Query Frame = 0
Query:   72 DEMEEFQRKIQEILAYPENMMPKLQREIQ------------TFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFL 143
            D  +  QR  ++ LA  EN   K+ RE+              F++ LP Y+ R ++  ++ +  V ++  +TG GK+T +PQF+
Sbjct:  223 DRSKGVQRGHRQFLAGGEN--KKIDRELSEAAVRTRAGQMARFRETLPSYKLRKEVLASISSNQVLVVSGETGCGKTTQVPQFI 468          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592780312|gb|GAXK01174256.1| (TSA: Calanus finmarchicus comp231781_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 43.5134 bits (101), Expect = 1.376e-4
Identity = 28/97 (28.87%), Postives = 51/97 (52.58%), Query Frame = 0
Query:   49 MLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD 145
            ML  +E + +     +EQ      +M E  R+++    Y +N +     ++ T +K LP ++ R++I D ++   V ++   TG GKST +PQF+ D
Sbjct: 1351 MLGAKEKEGQMKQKFKEQ----ERKMLEVNRRLRS--RYQQNKVSGDVNKMMTVRKSLPAWKERTRIIDLLRKNQVVVISGMTGCGKSTQVPQFILD 1623          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592807052|gb|GAXK01147516.1| (TSA: Calanus finmarchicus comp43805_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 43.5134 bits (101), Expect = 1.459e-4
Identity = 18/45 (40.00%), Postives = 30/45 (66.67%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN 147
            ++ LP+Y  R Q+   +++  V I+V +TGSGK+T L Q+LH+  
Sbjct: 1586 REFLPVYAVRQQLLQLIRDNSVIIVVGETGSGKTTQLTQYLHEDG 1720          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592769888|gb|GAXK01184680.1| (TSA: Calanus finmarchicus comp135016_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 43.1282 bits (100), Expect = 1.814e-4
Identity = 15/41 (36.59%), Postives = 29/41 (70.73%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFL 143
            ++ LPI+  R ++ D +++  V ++  DTGSGK+T +PQ++
Sbjct: 3524 RRQLPIWGHRREVVDAIRSSPVVLVTGDTGSGKTTQIPQYV 3646          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592884187|gb|GAXK01074188.1| (TSA: Calanus finmarchicus comp122393_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 43.1282 bits (100), Expect = 1.921e-4
Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN 147
            ++Q  +  LPIY  + +    V+   V I+V +TGSGKST +PQ++ D  
Sbjct: 1887 KLQELRCSLPIYPQKEEFLSLVRQNQVVIVVGETGSGKSTQMPQYIRDGG 2036          
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Match: gi|592884188|gb|GAXK01074187.1| (TSA: Calanus finmarchicus comp122393_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 43.1282 bits (100), Expect = 2.269e-4
Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN 147
            ++Q  +  LPIY  + +    V+   V I+V +TGSGKST +PQ++ D  
Sbjct: 1887 KLQELRCSLPIYPQKEEFLSLVRQNQVVIVVGETGSGKSTQMPQYIRDGG 2036          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000000008 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:2749:3432:-1 gene:EMLSAG00000000008 transcript:EMLSAT00000000008 description:"maker-LSalAtl2s1003-augustus-gene-0.17")

HSP 1 Score: 357.066 bits (915), Expect = 7.515e-127
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = 0
Query:    1 MTTFQALLTELRTQFQHENEEIKNKIKDVEESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALADYTTDCL 173
            MTTFQALLTELRTQFQHENEEIKNKIKDVEESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALADYTTDCL
Sbjct:    1 MTTFQALLTELRTQFQHENEEIKNKIKDVEESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALADYTTDCL 173          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000001982 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1352:76602:86940:1 gene:EMLSAG00000001982 transcript:EMLSAT00000001982 description:"maker-LSalAtl2s1352-snap-gene-0.20")

HSP 1 Score: 326.25 bits (835), Expect = 1.469e-114
Identity = 156/173 (90.17%), Postives = 162/173 (93.64%), Query Frame = 0
Query:    1 MTTFQALLTELRTQFQHENEEIKNKIKDVEESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALADYTTDCL 173
            MTTFQALLT+LRTQFQ ENEEIKNKIK VEESL+WNEVP GRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQR +QEIL  PENM+PKL REIQTFKKHLPIYRFRSQI DTVQNYDVTILVADTGSGKSTLLPQFLHDHN+KHVI CA PRRLAANALADYT +CL
Sbjct:    1 MTTFQALLTDLRTQFQRENEEIKNKIKGVEESLQWNEVPSGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRTLQEILTNPENMVPKLHREIQTFKKHLPIYRFRSQIMDTVQNYDVTILVADTGSGKSTLLPQFLHDHNEKHVIYCAQPRRLAANALADYTRECL 173          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000012177 (pep:novel supercontig:LSalAtl2s:LSalAtl2s87:33379:41665:1 gene:EMLSAG00000012177 transcript:EMLSAT00000012177 description:"snap_masked-LSalAtl2s87-processed-gene-0.14")

HSP 1 Score: 124.405 bits (311), Expect = 9.999e-33
Identity = 68/131 (51.91%), Postives = 88/131 (67.18%), Query Frame = 0
Query:   45 KEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEI--LAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALADYTTDCL 173
            + F   + +E K++TI+ L+ +L     EMEEFQ +I EI  L  P N   KL  EI  F KHLPIYRFRS I ++++  DVTILVA+TGSGKSTL+ QFLH +++  VI C  PR+LAAN L +YT  CL
Sbjct:   40 RNFLSKSLKERKVETINALQAELETKLIEMEEFQSRILEISSLNTP-NKEEKLNLEIDIFSKHLPIYRFRSTILESIEKNDVTILVAETGSGKSTLVTQFLHTNDEDIVIYCCQPRKLAANGLMEYTNTCL 169          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000012656 (pep:novel supercontig:LSalAtl2s:LSalAtl2s95:1052970:1062187:-1 gene:EMLSAG00000012656 transcript:EMLSAT00000012656 description:"maker-LSalAtl2s95-augustus-gene-10.21")

HSP 1 Score: 118.627 bits (296), Expect = 1.040e-30
Identity = 68/148 (45.95%), Postives = 94/148 (63.51%), Query Frame = 0
Query:    8 LTELRTQFQHENEEIKNKIKDVEESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAY-PENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXC 154
            L ++  QF  + +EI+++I+ +   L+      G+  K F   + RE KL TI+ L+ +L     EMEEFQ +I EIL+  P N   KL  EI  F KHLPIYRFRS I ++++  DVTILVA+TGSGKSTL+ QFLH +++  VI C
Sbjct:    7 LNDVSVQFMEDRKEIEDRIEKLSLELK----ATGKKKKNFLSKSLREMKLGTINALQAKLRTKLFEMEEFQSRILEILSLNPPNKEKKLHLEIDIFSKHLPIYRFRSTILESIEKNDVTILVAETGSGKSTLVTQFLHTNDEDIVIYC 150          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000000842 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1142:167553:175470:1 gene:EMLSAG00000000842 transcript:EMLSAT00000000842 description:"maker-LSalAtl2s1142-augustus-gene-1.32")

HSP 1 Score: 59.3066 bits (142), Expect = 7.213e-11
Identity = 29/80 (36.25%), Postives = 47/80 (58.75%), Query Frame = 0
Query:   90 NMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            N   K +  I+  KK LP+Y FR  + + +  + V I+  +TGSGK+T +PQ+L++     D   I C  PRR+AA +++
Sbjct:  347 NETQKKRMSIEETKKSLPVYPFRKSLIEAINEHQVLIIEGETGSGKTTQIPQYLYEAGFTKDGKKIGCTQPRRVAAMSVS 426          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000009944 (pep:novel supercontig:LSalAtl2s:LSalAtl2s64:495820:499248:-1 gene:EMLSAG00000009944 transcript:EMLSAT00000009944 description:"maker-LSalAtl2s64-augustus-gene-5.22")

HSP 1 Score: 58.5362 bits (140), Expect = 1.310e-10
Identity = 27/71 (38.03%), Postives = 45/71 (63.38%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALADYTTD 171
            ++ LPI+  R Q+ + +++  V I+V +TGSGK+T L Q+LH+  +    +I C  PRR+AA ++A    D
Sbjct:  400 REFLPIFAVRQQLLNIIRDNSVIIIVGETGSGKTTQLTQYLHEDGYTKYGIIGCTQPRRVAAMSVAKRVAD 470          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000008555 (pep:novel supercontig:LSalAtl2s:LSalAtl2s527:255308:263399:1 gene:EMLSAG00000008555 transcript:EMLSAT00000008555 description:"maker-LSalAtl2s527-augustus-gene-1.59")

HSP 1 Score: 57.3806 bits (137), Expect = 3.687e-10
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 0
Query:   88 PENMMPKLQREIQTFKKH--LPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKH--VIXCAXPRRLAANALA 166
            P + +P   R  + F+K   LP++ +R +  D +  +    LV +TGSGK+T +PQ+  ++  K    + C  PRR+AA ++A
Sbjct:   33 PHSALPYTPRYFELFRKRITLPVWEYRDKFLDLLGQHQCICLVGETGSGKTTQIPQWCAEYASKERKSVACTQPRRVAAMSVA 115          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000009033 (pep:novel supercontig:LSalAtl2s:LSalAtl2s566:265163:268669:-1 gene:EMLSAG00000009033 transcript:EMLSAT00000009033 description:"maker-LSalAtl2s566-augustus-gene-2.40")

HSP 1 Score: 54.299 bits (129), Expect = 3.427e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALAD 167
            + +LPI  +R++I  ++    V I+  DTG GKST +PQFL +   +  I C  PRRLA  ALA+
Sbjct:  142 QSNLPISGYRNEIIQSLVQKQVVIIAGDTGCGKSTQVPQFLLEAGYEK-IACTQPRRLACIALAN 205          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000002448 (pep:novel supercontig:LSalAtl2s:LSalAtl2s146:214653:221407:1 gene:EMLSAG00000002448 transcript:EMLSAT00000002448 description:"maker-LSalAtl2s146-augustus-gene-2.13")

HSP 1 Score: 48.9062 bits (115), Expect = 1.762e-7
Identity = 27/70 (38.57%), Postives = 39/70 (55.71%), Query Frame = 0
Query:  106 LPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXC----AXPRRLAANALADYTTD 171
            LPI R R  I   ++   VTI+   TG GK+T +PQF+ DH   + + C      PRR+AA+++A    D
Sbjct:  126 LPIDRERDHIIKQIEANKVTIITGLTGCGKTTRVPQFIFDHCFSNNMYCNIIVTQPRRIAAHSVARRICD 195          
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Match: EMLSAP00000008236 (pep:novel supercontig:LSalAtl2s:LSalAtl2s497:66849:78231:1 gene:EMLSAG00000008236 transcript:EMLSAT00000008236 description:"augustus_masked-LSalAtl2s497-processed-gene-0.3")

HSP 1 Score: 48.1358 bits (113), Expect = 3.018e-7
Identity = 26/76 (34.21%), Postives = 39/76 (51.32%), Query Frame = 0
Query:   96 QREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFL---HDHNDKHV-IXCAXPRRLAANALAD 167
            Q  IQ   + LPI+ F+  I  ++  + V ++   TG GK+T +PQ+L         HV I C  PRR A  + A+
Sbjct:  162 QSYIQETTQKLPIHNFKDLIMSSIDTHQVCLVTGPTGCGKTTQIPQYLLECASDTQNHVRIVCTEPRRFAVLSTAE 237          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|74996806|sp|Q54MH3.1|DHX16_DICDI (RecName: Full=Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; AltName: Full=DEAH-box protein 16)

HSP 1 Score: 70.8626 bits (172), Expect = 1.514e-13
Identity = 32/70 (45.71%), Postives = 46/70 (65.71%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV--IXCAXPRRLAANALA 166
            IQ  +K LP+Y +R Q+ D V+ Y V I+V +TGSGK+T +PQ+LH+        I C  PRR+AA ++A
Sbjct:  460 IQEVRKSLPVYPYREQLIDAVREYQVLIIVGETGSGKTTQIPQYLHEAGFSKTGKIGCTQPRRVAAMSVA 529          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|75331116|sp|Q8VY00.1|ESP3_ARATH (RecName: Full=Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1; AltName: Full=DEAH RNA helicase homolog PRP2; AltName: Full=Protein EMBRYO DEFECTIVE 2733; AltName: Full=Protein ENHANCED SILENCING PHENOTYPE 3)

HSP 1 Score: 68.9366 bits (167), Expect = 5.653e-13
Identity = 29/71 (40.85%), Postives = 48/71 (67.61%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            E+Q  ++ LPIY +R Q+   V+ + V ++V DTGSGK+T +PQ+LH+  +  +  + C  PRR+AA ++A
Sbjct:  396 ELQEVRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPRRVAAMSVA 466          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|26006959|sp|O60231.2|DHX16_HUMAN (RecName: Full=Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; AltName: Full=ATP-dependent RNA helicase #3; AltName: Full=DEAH-box protein 16)

HSP 1 Score: 68.1662 bits (165), Expect = 1.277e-12
Identity = 46/145 (31.72%), Postives = 71/145 (48.97%), Query Frame = 0
Query:   30 EESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQ-----EILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            EE   W E   G  S +F     R+A        + QL+   +E  EF R  Q     E  A P +   + +  IQ  ++ LP++ FR ++   + N+ V I+  +TGSGK+T +PQ+L +    N    I C  PRR+AA ++A
Sbjct:  324 EEQRRWEEARLGAASLKF---GARDA---ASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVA 462          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|38502930|sp|Q7YR39.1|DHX16_PANTR (RecName: Full=Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; AltName: Full=ATP-dependent RNA helicase #3; AltName: Full=DEAH-box protein 16)

HSP 1 Score: 68.1662 bits (165), Expect = 1.302e-12
Identity = 46/145 (31.72%), Postives = 71/145 (48.97%), Query Frame = 0
Query:   30 EESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQ-----EILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            EE   W E   G  S +F     R+A        + QL+   +E  EF R  Q     E  A P +   + +  IQ  ++ LP++ FR ++   + N+ V I+  +TGSGK+T +PQ+L +    N    I C  PRR+AA ++A
Sbjct:  327 EEQRRWEEARLGAASLKF---GARDA---ASQEPKYQLVLEEEETIEFVRATQLQGNEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVA 465          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|19862987|sp|Q10752.2|CDC28_SCHPO (RecName: Full=Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28; AltName: Full=Pre-mRNA-processing protein 8)

HSP 1 Score: 67.781 bits (164), Expect = 1.594e-12
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 0
Query:   94 KLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            K+++ +++ +K LP+Y+++  +   +  Y V ++VA+TGSGK+T LPQFLH+         I C  PRR+AA ++A
Sbjct:  406 KVEKSLESSRKSLPVYQYKDDLLKAINEYQVLLIVAETGSGKTTQLPQFLHEAGYTKGNKKICCTQPRRVAAMSVA 481          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|961512555|sp|F4IJV4.1|DEAH6_ARATH (RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6; AltName: Full=DEAH RNA helicase homolog PRP2; AltName: Full=Protein MATERNAL EFFECT EMBRYO ARREST 29)

HSP 1 Score: 65.0846 bits (157), Expect = 1.225e-11
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV--IXCAXPRRLAANALA 166
            +Q  +K LPIY +R Q+ + V+++ V I+V +TGSGK+T +PQ+LH+     +  + C  PRR+AA ++A
Sbjct:  397 LQEDRKALPIYTYRDQLLNAVKDHQVLIIVGETGSGKTTQIPQYLHEAGYTKLGKVGCTQPRRVAAMSVA 466          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|961512556|sp|F4JRJ6.1|DEAH9_ARATH (RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9; AltName: Full=DEAH RNA helicase homolog DDX35)

HSP 1 Score: 62.003 bits (149), Expect = 1.458e-10
Identity = 29/71 (40.85%), Postives = 47/71 (66.20%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD---HNDKHVIXCAXPRRLAANALA 166
            I+  ++ LP+Y++R++I   V+N+  TI+V +TGSGK+T +PQ+L +        VI C  PRRLA  A++
Sbjct:   41 IEKQRQRLPVYKYRTEILYLVENHATTIIVGETGSGKTTQIPQYLKEAGWAEGGRVIACTQPRRLAVQAVS 111          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|961512557|sp|F4KGU4.1|DEAHC_ARATH (RecName: Full=ATP-dependent RNA helicase DEAH12, chloroplastic; Flags: Precursor)

HSP 1 Score: 62.003 bits (149), Expect = 1.746e-10
Identity = 31/75 (41.33%), Postives = 43/75 (57.33%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN--DKHVIXCAXPRRLAANALAD 167
            ++RE +  +  LPIY +R QI   +    + +L+ +TGSGKST L QFL D        I C  PR++AA  LAD
Sbjct:  295 IRRECRRLEDGLPIYAYRRQILKKIHREQIMVLIGETGSGKSTQLVQFLADSGVAASESIVCTQPRKIAAMTLAD 369          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|75072475|sp|Q767K6.1|DHX16_PIG (RecName: Full=Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; AltName: Full=DEAH-box protein 16)

HSP 1 Score: 61.2326 bits (147), Expect = 3.226e-10
Identity = 46/145 (31.72%), Postives = 72/145 (49.66%), Query Frame = 0
Query:   30 EESLEWNEVPRGRGSKEFRMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQ-----EILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHV-IXCAXPRRLAANALA 166
            EE   W E   G  S +F     R+A        + QL+   +E  EF R  Q     E  A P     + +  IQ  ++ LP++ FR ++   V N+ + I+  +TGSGK+T +PQ+L +  +  K + I C  PRR+AA ++A
Sbjct:  328 EEQRRWEEARLGAASLKF---GARDA---ASQEPKYQLVLEEEETIEFVRATQLQGDEEPAAPPAPTQAQQKESIQAVRRSLPVFPFREELLAAVANHQILIIEGETGSGKTTQIPQYLFEEGYTQKGMKIACTQPRRVAAMSVA 466          
BLAST of EMLSAG00000000008 vs. SwissProt
Match: gi|3915519|sp|O45244.2|DHX16_CAEEL (RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4; AltName: Full=Masculinization of germline protein 4; AltName: Full=Sex determination protein mog-4)

HSP 1 Score: 59.3066 bits (142), Expect = 1.212e-9
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 0
Query:   94 KLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALADYTTD 171
            K +  I+  +K LP+Y FR    + V+ + V I+  +TGSGK+T LPQ+L++         I C  PRR+AA ++A    D
Sbjct:  352 KKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVAD 432          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: EEB16180.1 (ATP-dependent RNA helicase, putative [Pediculus humanus corporis])

HSP 1 Score: 70.8626 bits (172), Expect = 6.474e-14
Identity = 33/72 (45.83%), Postives = 48/72 (66.67%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            +I+  KK LPI+RFR  +   V+ Y V I+  +TGSGK+T +PQ+LH+    ND  +I C  PRR+AA ++A
Sbjct:  227 DIEETKKSLPIFRFREDLIAAVKEYQVLIIEGETGSGKTTQIPQYLHEAGYTNDGKIIGCTQPRRVAAMSVA 298          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: gb|EFA03526.1| (putative ATP-dependent RNA helicase spindle-E-like Protein [Tribolium castaneum])

HSP 1 Score: 67.0106 bits (162), Expect = 1.508e-12
Identity = 32/72 (44.44%), Postives = 47/72 (65.28%), Query Frame = 0
Query:   98 EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            +IQ  KK+LP+Y FR  +   V+ + V I+  +TGSGK+T +PQ+LH+    ND   I C  PRR+AA ++A
Sbjct:  242 DIQETKKNLPVYPFRDDLIQAVREHQVLIIEGETGSGKTTQIPQYLHEAGFTNDNKKIGCTQPRRVAAMSVA 313          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: gb|KFM75516.1| (putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, partial [Stegodyphus mimosarum])

HSP 1 Score: 66.2402 bits (160), Expect = 2.566e-12
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            IQ  +K LPIY FR  +   ++N+ V I+  +TGSGK+T +PQ+L++     DK  I C  PRR+AA ++A
Sbjct:  289 IQETRKSLPIYPFRDDLLQAIKNHHVLIIEGETGSGKTTQIPQYLYEAGYTKDKKRIGCTQPRRVAAMSVA 359          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: gb|KFM66123.1| (hypothetical protein X975_02723, partial [Stegodyphus mimosarum])

HSP 1 Score: 65.855 bits (159), Expect = 3.519e-12
Identity = 46/152 (30.26%), Postives = 79/152 (51.97%), Query Frame = 0
Query:   24 NKIKDVEESLEWNEVPRGRGSKEF--RMLNTREAKLKTIHTLREQLINNADEMEEFQRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN--DKH-VIXCAXPRRLAANALADYTT 170
            NK ++    L+ + +P+  G+KE     LN    +  T      ++IN  ++ +     ++  L   ++++ +  RE   F   LPIY  ++ I   ++ + VTI+ A+TGSGKST L Q++       KH VI C  PR++AA +LA Y +
Sbjct:  826 NKHQEEVSKLKKSPIPQVPGAKEVLSEKLNEMNEQKVTFLNFTSEIINKLNKADICSENLEHCL---DDILREYSRECNCFSSALPIYAKKNTILKKIKKHQVTIIRAETGSGKSTQLTQYVWGEQILSKHGVIMCTQPRKIAAISLAKYVS 974          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: XP_016771430.1 (PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Apis mellifera])

HSP 1 Score: 63.929 bits (154), Expect = 1.816e-11
Identity = 33/84 (39.29%), Postives = 52/84 (61.90%), Query Frame = 0
Query:   86 AYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALA 166
            A P   +  LQ  IQ  KK LPIY F++ +   ++++ V I+  +TGSGK+T +PQ+L++     D  +I C  PRR+AA ++A
Sbjct:  221 ASPPPQVKALQ-TIQETKKSLPIYPFKNDLIQAIKDHQVLIIEGETGSGKTTQIPQYLYEAGFAEDNKIIGCTQPRRVAAMSVA 303          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: XP_016769256.1 (PREDICTED: pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [Apis mellifera])

HSP 1 Score: 63.1586 bits (152), Expect = 3.259e-11
Identity = 28/77 (36.36%), Postives = 48/77 (62.34%), Query Frame = 0
Query:   97 REIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKH--VIXCAXPRRLAANALADYTTD 171
            R IQ  ++ LP++  R ++ + ++   V ++V +TGSGK+T L Q+LH+    H  +I C  PRR+AA ++A   +D
Sbjct:  434 RSIQYQRRSLPVFAVRQELLNVIRENSVVVIVGETGSGKTTQLTQYLHEDGYSHYGIIGCTQPRRVAAMSVAKRVSD 510          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: gb|EEZ97709.1| (benign gonial cell neoplasm [Tribolium castaneum])

HSP 1 Score: 62.3882 bits (150), Expect = 5.535e-11
Identity = 32/84 (38.10%), Postives = 48/84 (57.14%), Query Frame = 0
Query:   88 PENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD----HNDKHVIXCAXPRRLAANALAD 167
            P    P+L  +I  F+K LPIY  R  I   V+   V I+ ++TGSGK+T +PQF+ D      +   I C  PRR++A ++A+
Sbjct:  146 PPVTAPRLTPQIAAFRKQLPIYDLRQVIVSKVRKNRVLIVSSETGSGKTTQIPQFIMDDALQRGEPCRILCTQPRRISAVSVAE 229          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: XP_006561315.1 (PREDICTED: probable ATP-dependent RNA helicase YTHDC2 isoform X1 [Apis mellifera])

HSP 1 Score: 62.003 bits (149), Expect = 8.824e-11
Identity = 31/82 (37.80%), Postives = 51/82 (62.20%), Query Frame = 0
Query:   92 MPKLQR--EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV----IXCAXPRRLAANALAD 167
            +P+L+   ++  ++K LPI+ FR  I D + N  V I+  +TGSGK+T +PQF+ +H  +      I C  PRRL+A ++A+
Sbjct:  150 IPQLKTNFDVLNYRKALPIFNFREDILDALNNNQVVIIGGETGSGKTTQVPQFILEHCQQRQQPCRIICTQPRRLSAVSVAE 231          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: XP_392558.3 (PREDICTED: probable ATP-dependent RNA helicase YTHDC2 isoform X2 [Apis mellifera])

HSP 1 Score: 62.003 bits (149), Expect = 9.079e-11
Identity = 31/82 (37.80%), Postives = 51/82 (62.20%), Query Frame = 0
Query:   92 MPKLQR--EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHV----IXCAXPRRLAANALAD 167
            +P+L+   ++  ++K LPI+ FR  I D + N  V I+  +TGSGK+T +PQF+ +H  +      I C  PRRL+A ++A+
Sbjct:  148 IPQLKTNFDVLNYRKALPIFNFREDILDALNNNQVVIIGGETGSGKTTQVPQFILEHCQQRQQPCRIICTQPRRLSAVSVAE 229          
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Match: AHN59907.1 (uncharacterized protein Dmel_CG32533, isoform B [Drosophila melanogaster])

HSP 1 Score: 61.6178 bits (148), Expect = 9.881e-11
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 0
Query:   97 REIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHNDKHVIXCAXPRRLAANALA 166
            R+++  +++LPI RFR  +++ +    V I+  DTG GKST +PQ+L+D   +  I C  PRRLA  +L 
Sbjct:  137 RKLRQTQRNLPIARFRKDLREALDTSRVVIVAGDTGCGKSTQVPQYLYDFGYRS-IACTQPRRLACVSLC 205          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|367039109|ref|XP_003649935.1| (hypothetical protein THITE_2109083 [Thielavia terrestris NRRL 8126] >gi|346997196|gb|AEO63599.1| hypothetical protein THITE_2109083 [Thielavia terrestris NRRL 8126])

HSP 1 Score: 76.2554 bits (186), Expect = 4.512e-13
Identity = 41/97 (42.27%), Postives = 55/97 (56.70%), Query Frame = 0
Query:   78 QRKIQEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALADYTTD 171
            QR +QE +   E    K  R IQ  +K LP+Y +R    D V+ Y V ILV +TGSGK+T +PQ+LH+     D   I C  PRR+AA ++A    D
Sbjct:  163 QRILQEKIEAAE----KAARTIQEVRKSLPVYAYRDAFLDAVKEYQVLILVGETGSGKTTQIPQYLHEAGFTKDGMKIACTQPRRVAAMSVAARVAD 255          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|367026071|ref|XP_003662320.1| (hypothetical protein MYCTH_2302831 [Thermothelomyces thermophila ATCC 42464] >gi|347009588|gb|AEO57075.1| hypothetical protein MYCTH_2302831 [Thermothelomyces thermophila ATCC 42464])

HSP 1 Score: 75.8702 bits (185), Expect = 5.293e-13
Identity = 39/93 (41.94%), Postives = 53/93 (56.99%), Query Frame = 0
Query:   82 QEILAYPENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALADYTTD 171
            Q IL    +   K Q+ IQ  +K LP+Y +R    D V+ Y V ILV +TGSGK+T +PQ+LH+     D   I C  PRR+AA ++A    D
Sbjct:  262 QRILKEKIDAAEKAQKTIQEVRKSLPVYAYRDAFLDAVKEYQVLILVGETGSGKTTQIPQYLHEAGFTKDGMKIACTQPRRVAAMSVAARVAD 354          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|1002292189|ref|XP_015650435.1| (PREDICTED: pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 [Oryza sativa Japonica Group])

HSP 1 Score: 75.0998 bits (183), Expect = 1.043e-12
Identity = 33/74 (44.59%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPIY+FR ++   V+ Y V ++V +TGSGK+T +PQ+LH+  +  K  + C  PRR+AA ++A
Sbjct:  400 LKRELQDERKTLPIYKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVA 473          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|573954113|ref|XP_006659312.1| (PREDICTED: pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1-like [Oryza brachyantha])

HSP 1 Score: 75.0998 bits (183), Expect = 1.053e-12
Identity = 33/74 (44.59%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPIY+FR ++   V+ Y V ++V +TGSGK+T +PQ+LH+  +  K  + C  PRR+AA ++A
Sbjct:  401 LKRELQDERKTLPIYKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVA 474          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|670394434|ref|XP_008677648.1| (PREDICTED: uncharacterized protein LOC100383864 isoform X1 [Zea mays])

HSP 1 Score: 74.7146 bits (182), Expect = 1.514e-12
Identity = 33/74 (44.59%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPI++FR ++   V+ Y V ++V +TGSGK+T +PQFLH+  +  K  + C  PRR+AA ++A
Sbjct:  385 LKRELQDERKTLPIFKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQFLHESGYTAKGKVACTQPRRVAAMSVA 458          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|1026957165|ref|XP_016603295.1| (protein of unknown function DUF1605 [Penicillium expansum] >gi|700474797|gb|KGO62775.1| protein of unknown function DUF1605 [Penicillium expansum])

HSP 1 Score: 74.7146 bits (182), Expect = 1.698e-12
Identity = 36/72 (50.00%), Postives = 46/72 (63.89%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALADYTTD 171
            +K LPIY+FR QI D V  Y V I+V +TGSGK+T LPQ+LH+     D   I C  PRR+AA ++A    D
Sbjct:  474 RKSLPIYQFREQILDAVAKYQVLIIVGETGSGKTTQLPQYLHEAGYTKDGLKIGCTQPRRVAAMSVAARVAD 545          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|594148808|emb|CCW66889.1| (unnamed protein product [Phytomonas sp. isolate Hart1])

HSP 1 Score: 74.3294 bits (181), Expect = 2.384e-12
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 0
Query:   88 PENMMPKLQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN--DKHVIXCAXPRRLAANALA 166
            P   +P   +++Q  ++ LPIYR R++I   V  + VTILV +TGSGK+T +PQ+L +H    K +I C  PRR+AA  LA
Sbjct:  378 PHFGIPPSTQDLQRQRRSLPIYRKRAEIIQYVDTHSVTILVGETGSGKTTQIPQYLEEHGYAKKGIICCTQPRRVAAETLA 458          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|514747054|ref|XP_004961277.1| (PREDICTED: putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [Setaria italica])

HSP 1 Score: 73.9442 bits (180), Expect = 2.647e-12
Identity = 32/74 (43.24%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPIY+FR ++   V+ Y V ++V +TGSGK+T +PQ+LH+  +  K  + C  PRR+AA +++
Sbjct:  400 LKRELQDERKTLPIYKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVS 473          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|992169995|gb|KXG30390.1| (hypothetical protein SORBI_004G174200 [Sorghum bicolor] >gi|992169997|gb|KXG30392.1| hypothetical protein SORBI_004G174200 [Sorghum bicolor])

HSP 1 Score: 73.559 bits (179), Expect = 3.848e-12
Identity = 32/74 (43.24%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPI++FR ++   V+ Y V ++V +TGSGK+T +PQ+LH+  +  K  + C  PRR+AA ++A
Sbjct:  395 LKRELQDERKTLPIFKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVA 468          
BLAST of EMLSAG00000000008 vs. nr
Match: gi|992169996|gb|KXG30391.1| (hypothetical protein SORBI_004G174200 [Sorghum bicolor])

HSP 1 Score: 73.559 bits (179), Expect = 3.960e-12
Identity = 32/74 (43.24%), Postives = 52/74 (70.27%), Query Frame = 0
Query:   95 LQREIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHD--HNDKHVIXCAXPRRLAANALA 166
            L+RE+Q  +K LPI++FR ++   V+ Y V ++V +TGSGK+T +PQ+LH+  +  K  + C  PRR+AA ++A
Sbjct:  394 LKRELQDERKTLPIFKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVA 467          
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold40_size501252-snap-gene-2.13 (protein:Tk06161 transcript:maker-scaffold40_size501252-snap-gene-2.13-mRNA-1 annotation:"atp-dependent rna helicase kurz")

HSP 1 Score: 56.225 bits (134), Expect = 5.839e-10
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 0
Query:   88 PENMMPKLQR-EIQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN---DKHVIXCAXPRRLAANALADYTTD 171
            P   M   +R EIQ  ++ LPI      I + +Q + V IL  +TGSGK+T +PQFL++     +  +I    PRR+AA ++A    D
Sbjct:  244 PSKFMSVARRPEIQAQREKLPIIAEEQAIMEAIQAHPVVILAGETGSGKTTQVPQFLYEAGFTKNGQLIGVTEPRRVAAMSMAQRVGD 331          
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold169_size292178-processed-gene-0.0 (protein:Tk07929 transcript:snap_masked-scaffold169_size292178-processed-gene-0.0-mRNA-1 annotation:"pre-mrna-splicing factor atp-dependent rna helicase dhx16-like")

HSP 1 Score: 55.0694 bits (131), Expect = 1.507e-9
Identity = 25/71 (35.21%), Postives = 44/71 (61.97%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            I+  +K LP+Y FR  +   ++ + V I+  +TGSGK+T +PQ+L+     ++   I C  PRR+AA +++
Sbjct:  373 IEETQKSLPVYPFRDSLLAAIEQHQVLIIEGETGSGKTTQIPQYLYQGGYTSEGRKIGCTQPRRVAAMSVS 443          
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold382_size189932-processed-gene-0.10 (protein:Tk03701 transcript:snap_masked-scaffold382_size189932-processed-gene-0.10-mRNA-1 annotation:"pre-mrna-splicing factor atp-dependent rna helicase dhx16-like")

HSP 1 Score: 55.0694 bits (131), Expect = 1.507e-9
Identity = 25/71 (35.21%), Postives = 44/71 (61.97%), Query Frame = 0
Query:   99 IQTFKKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDH---NDKHVIXCAXPRRLAANALA 166
            I+  +K LP+Y FR  +   ++ + V I+  +TGSGK+T +PQ+L+     ++   I C  PRR+AA +++
Sbjct:  373 IEETQKSLPVYPFRDSLLAAIEQHQVLIIEGETGSGKTTQIPQYLYQGGYTSEGRKIGCTQPRRVAAMSVS 443          
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold495_size155559-processed-gene-0.2 (protein:Tk09236 transcript:snap_masked-scaffold495_size155559-processed-gene-0.2-mRNA-1 annotation:"probable atp-dependent rna helicase dhx35-like isoform x1")

HSP 1 Score: 53.1434 bits (126), Expect = 6.761e-9
Identity = 27/68 (39.71%), Postives = 41/68 (60.29%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN----DKHVIXCAXPRRLAANALA 166
            ++ LPI+R R  I   ++ + V I+V +TGSGKST +PQ+L +      +  +I    PRR+AA  LA
Sbjct:   73 RQKLPIFRTRDHILYMLEKFQVVIVVGETGSGKSTQIPQYLIEAGWCQEEGQMIGITEPRRVAATTLA 140          
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1335_size46909-snap-gene-0.12 (protein:Tk00652 transcript:maker-scaffold1335_size46909-snap-gene-0.12-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_302589")

HSP 1 Score: 48.9062 bits (115), Expect = 1.826e-7
Identity = 23/66 (34.85%), Postives = 38/66 (57.58%), Query Frame = 0
Query:  103 KKHLPIYRFRSQIKDTVQNYDVTILVADTGSGKSTLLPQFLHDHN--DKHVIXCAXPRRLAANALA 166
            ++ LP+   R++  + V  +   IL+ +TG GK+T +PQFLH+        I    PRR+AA ++A
Sbjct:   67 RRSLPMAAARTRFLEEVSRHPTVILIGETGCGKTTQIPQFLHEARLEGGQAIGVTQPRRVAAISIA 132          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000008 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-6.142e-1345.71symbol:dhx16 "putative RNA splicing factor" specie... [more]
-8.647e-1337.96symbol:AN5827.2 "mRNA splicing factor RNA helicase... [more]
-8.647e-1337.96symbol:AN5827 species:162425 "Aspergillus nidulans... [more]
-1.359e-1238.54symbol:An05g00290 "Similarity to the Prp2" species... [more]
-1.359e-1238.54symbol:An05g00290 species:5061 "Aspergillus niger"... [more]
-1.877e-1242.39symbol:AFUA_2G07710 "mRNA splicing factor RNA heli... [more]
-1.877e-1242.39symbol:Afu2g07710 species:746128 "Aspergillus fumi... [more]
-2.097e-1240.85symbol:ESP3 "AT1G32490" species:3702 "Arabidopsis ... [more]
-4.510e-1231.72symbol:DHX16 "Putative pre-mRNA-splicing factor AT... [more]
-4.663e-1239.58symbol:AO090011000924 "mRNA splicing factor ATP-de... [more]

Pages

back to top
BLAST of EMLSAG00000000008 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 22
Match NameE-valueIdentityDescription
gi|592854938|gb|GAXK01102606.1|1.454e-640.82TSA: Calanus finmarchicus comp61615_c1_seq1 transc... [more]
gi|592791138|gb|GAXK01163430.1|4.752e-542.86TSA: Calanus finmarchicus comp218412_c0_seq1 trans... [more]
gi|592869517|gb|GAXK01088045.1|4.989e-538.18TSA: Calanus finmarchicus comp158133_c1_seq1 trans... [more]
gi|592809271|gb|GAXK01145297.1|8.806e-540.00TSA: Calanus finmarchicus comp58731_c0_seq1 transc... [more]
gi|592838681|gb|GAXK01118863.1|1.327e-428.57TSA: Calanus finmarchicus comp193524_c5_seq4 trans... [more]
gi|592780312|gb|GAXK01174256.1|1.376e-428.87TSA: Calanus finmarchicus comp231781_c0_seq1 trans... [more]
gi|592807052|gb|GAXK01147516.1|1.459e-440.00TSA: Calanus finmarchicus comp43805_c1_seq1 transc... [more]
gi|592769888|gb|GAXK01184680.1|1.814e-436.59TSA: Calanus finmarchicus comp135016_c0_seq1 trans... [more]
gi|592884187|gb|GAXK01074188.1|1.921e-438.00TSA: Calanus finmarchicus comp122393_c0_seq2 trans... [more]
gi|592884188|gb|GAXK01074187.1|2.269e-438.00TSA: Calanus finmarchicus comp122393_c0_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000008 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 10
Match NameE-valueIdentityDescription
EMLSAP000000000087.515e-127100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:2749... [more]
EMLSAP000000019821.469e-11490.17pep:novel supercontig:LSalAtl2s:LSalAtl2s1352:7660... [more]
EMLSAP000000121779.999e-3351.91pep:novel supercontig:LSalAtl2s:LSalAtl2s87:33379:... [more]
EMLSAP000000126561.040e-3045.95pep:novel supercontig:LSalAtl2s:LSalAtl2s95:105297... [more]
EMLSAP000000008427.213e-1136.25pep:novel supercontig:LSalAtl2s:LSalAtl2s1142:1675... [more]
EMLSAP000000099441.310e-1038.03pep:novel supercontig:LSalAtl2s:LSalAtl2s64:495820... [more]
EMLSAP000000085553.687e-1032.53pep:novel supercontig:LSalAtl2s:LSalAtl2s527:25530... [more]
EMLSAP000000090333.427e-943.08pep:novel supercontig:LSalAtl2s:LSalAtl2s566:26516... [more]
EMLSAP000000024481.762e-738.57pep:novel supercontig:LSalAtl2s:LSalAtl2s146:21465... [more]
EMLSAP000000082363.018e-734.21pep:novel supercontig:LSalAtl2s:LSalAtl2s497:66849... [more]
back to top
BLAST of EMLSAG00000000008 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|74996806|sp|Q54MH3.1|DHX16_DICDI1.514e-1345.71RecName: Full=Putative pre-mRNA-splicing factor AT... [more]
gi|75331116|sp|Q8VY00.1|ESP3_ARATH5.653e-1340.85RecName: Full=Pre-mRNA-splicing factor ATP-depende... [more]
gi|26006959|sp|O60231.2|DHX16_HUMAN1.277e-1231.72RecName: Full=Putative pre-mRNA-splicing factor AT... [more]
gi|38502930|sp|Q7YR39.1|DHX16_PANTR1.302e-1231.72RecName: Full=Putative pre-mRNA-splicing factor AT... [more]
gi|19862987|sp|Q10752.2|CDC28_SCHPO1.594e-1238.16RecName: Full=Pre-mRNA-splicing factor ATP-depende... [more]
gi|961512555|sp|F4IJV4.1|DEAH6_ARATH1.225e-1141.43RecName: Full=Probable pre-mRNA-splicing factor AT... [more]
gi|961512556|sp|F4JRJ6.1|DEAH9_ARATH1.458e-1040.85RecName: Full=Probable pre-mRNA-splicing factor AT... [more]
gi|961512557|sp|F4KGU4.1|DEAHC_ARATH1.746e-1041.33RecName: Full=ATP-dependent RNA helicase DEAH12, c... [more]
gi|75072475|sp|Q767K6.1|DHX16_PIG3.226e-1031.72RecName: Full=Putative pre-mRNA-splicing factor AT... [more]
gi|3915519|sp|O45244.2|DHX16_CAEEL1.212e-937.04RecName: Full=Probable pre-mRNA-splicing factor AT... [more]

Pages

back to top
BLAST of EMLSAG00000000008 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB16180.16.474e-1445.83ATP-dependent RNA helicase, putative [Pediculus hu... [more]
gb|EFA03526.1|1.508e-1244.44putative ATP-dependent RNA helicase spindle-E-like... [more]
gb|KFM75516.1|2.566e-1243.66putative pre-mRNA-splicing factor ATP-dependent RN... [more]
gb|KFM66123.1|3.519e-1230.26hypothetical protein X975_02723, partial [Stegodyp... [more]
XP_016771430.11.816e-1139.29PREDICTED: putative pre-mRNA-splicing factor ATP-d... [more]
XP_016769256.13.259e-1136.36PREDICTED: pre-mRNA-splicing factor ATP-dependent ... [more]
gb|EEZ97709.1|5.535e-1138.10benign gonial cell neoplasm [Tribolium castaneum][more]
XP_006561315.18.824e-1137.80PREDICTED: probable ATP-dependent RNA helicase YTH... [more]
XP_392558.39.079e-1137.80PREDICTED: probable ATP-dependent RNA helicase YTH... [more]
AHN59907.19.881e-1140.00uncharacterized protein Dmel_CG32533, isoform B [D... [more]

Pages

back to top
BLAST of EMLSAG00000000008 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|367039109|ref|XP_003649935.1|4.512e-1342.27hypothetical protein THITE_2109083 [Thielavia terr... [more]
gi|367026071|ref|XP_003662320.1|5.293e-1341.94hypothetical protein MYCTH_2302831 [Thermothelomyc... [more]
gi|1002292189|ref|XP_015650435.1|1.043e-1244.59PREDICTED: pre-mRNA-splicing factor ATP-dependent ... [more]
gi|573954113|ref|XP_006659312.1|1.053e-1244.59PREDICTED: pre-mRNA-splicing factor ATP-dependent ... [more]
gi|670394434|ref|XP_008677648.1|1.514e-1244.59PREDICTED: uncharacterized protein LOC100383864 is... [more]
gi|1026957165|ref|XP_016603295.1|1.698e-1250.00protein of unknown function DUF1605 [Penicillium e... [more]
gi|594148808|emb|CCW66889.1|2.384e-1244.44unnamed protein product [Phytomonas sp. isolate Ha... [more]
gi|514747054|ref|XP_004961277.1|2.647e-1243.24PREDICTED: putative pre-mRNA-splicing factor ATP-d... [more]
gi|992169995|gb|KXG30390.1|3.848e-1243.24hypothetical protein SORBI_004G174200 [Sorghum bic... [more]
gi|992169996|gb|KXG30391.1|3.960e-1243.24hypothetical protein SORBI_004G174200 [Sorghum bic... [more]

Pages

back to top
BLAST of EMLSAG00000000008 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 5
Match NameE-valueIdentityDescription
maker-scaffold40_size501252-snap-gene-2.135.839e-1036.36protein:Tk06161 transcript:maker-scaffold40_size50... [more]
snap_masked-scaffold169_size292178-processed-gene-0.01.507e-935.21protein:Tk07929 transcript:snap_masked-scaffold169... [more]
snap_masked-scaffold382_size189932-processed-gene-0.101.507e-935.21protein:Tk03701 transcript:snap_masked-scaffold382... [more]
snap_masked-scaffold495_size155559-processed-gene-0.26.761e-939.71protein:Tk09236 transcript:snap_masked-scaffold495... [more]
maker-scaffold1335_size46909-snap-gene-0.121.826e-734.85protein:Tk00652 transcript:maker-scaffold1335_size... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:2749..3432 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NotePutative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1003-augustus-gene-0.17
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000008 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000008EMLSAT00000000008-695855Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:2749..3432-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000008-682774 ID=EMLSAG00000000008-682774|Name=EMLSAG00000000008|organism=Lepeophtheirus salmonis|type=gene|length=684bp|location=Sequence derived from alignment at LSalAtl2s1003:2749..3432- (Lepeophtheirus salmonis)
ATGACAACTTTTCAAGCATTACTAACAGAACTGAGAACTCAGTTTCAACA CGAAAATGAGGAAATTAAGAATAAGATCAAGGATGTGGAAGAATCCCTGG AATGGAATGAAGTTCCTAGGGGAAGAGGATCTAAGGAATTTCGAATGCTT AATACAAGGGAGGCTAAATTAAAGACAATCCATACCCTACGTGAACAATT AATTAACAATGCTGACGAAATGGAAGAGTTTCAAAGAAAAATCCAGGAAA TACTCGCCTATCCGGAGAATATGATGCCCAAGGTTGTTAATGATTTACTT TAAGTTGGTATAATAATATATTAAGATGTATATTTGATATTACAACAAAT TATCTATTCAATTGATCTAGTCTAAAATCCAATAGTTGTAGTATATATTA TACTAAATCATTATTCCTTTTTATATGTACATACTATCAATATGTAGTTG CAACGTGAGATCCAAACTTTTAAGAAGCATCTCCCGATTTATCGATTTCG GAGTCAAATCAAAGACACTGTTCAAAATTATGATGTGACTATTCTTGTTG CGGATACTGGATCAGGAAAATCCACATTATTGCCTCAATTCCTCCATGAT CACAATGATAAACATGTTATTTMCTGCGCACAMCCGCGAAGATTGGCTGC CAATGCTCTTGCTGATTATACAACGGACTGTTTA
back to top
Add to Basket