EMLSAG00000000011, EMLSAG00000000011-682777 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000011
Unique NameEMLSAG00000000011-682777
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:chinmo "Chronologically inappropriate morphogenesis" species:7227 "Drosophila melanogaster" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0016319 "mushroom body development" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP] InterPro:IPR000210 InterPro:IPR007087 InterPro:IPR013069 Pfam:PF00651 PROSITE:PS00028 PROSITE:PS50097 PROSITE:PS50157 SMART:SM00225 InterPro:IPR015880 EMBL:AE014134 GO:GO:0046872 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 SMART:SM00355 GO:GO:0007476 RefSeq:NP_001188680.1 RefSeq:NP_722717.2 UniGene:Dm.3973 PaxDb:Q7KU09 GeneID:33343 KEGG:dme:Dmel_CG31666 UCSC:CG31666-RB CTD:33343 FlyBase:FBgn0086758 eggNOG:NOG144947 InParanoid:Q7KU09 OMA:NNGSANE OrthoDB:EOG7V49ZH ChiTaRS:chinmo GenomeRNAi:33343 NextBio:783113 Bgee:Q7KU09 Uniprot:Q7KU09)

HSP 1 Score: 126.331 bits (316), Expect = 3.228e-29
Identity = 58/136 (42.65%), Postives = 82/136 (60.29%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXAS 169
            +++ LKW+ + +N+   F  L +S+ L+DV L C+G  FKAH+L+LAACS  F  LF     N PTN Q  +IL+ T  D++  LL FMY+GE ++  + +NS LK+AE LQVKGLS     +       HM   S
Sbjct:    5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFE----NTPTNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHMGDLS 136          

HSP 2 Score: 113.235 bits (282), Expect = 6.022e-25
Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            G KL+C +C+R YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+ 
Sbjct:  514 GKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQ 570          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:ttk "tramtrack" species:7227 "Drosophila melanogaster" [GO:0005634 "nucleus" evidence=NAS;IDA] [GO:0000978 "RNA polymerase II core promoter proximal region sequence-specific DNA binding" evidence=IDA] [GO:0007422 "peripheral nervous system development" evidence=TAS] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0000980 "RNA polymerase II distal enhancer sequence-specific DNA binding" evidence=IDA] [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=NAS] [GO:0045467 "R7 cell development" evidence=IMP;TAS] [GO:0005700 "polytene chromosome" evidence=IDA] [GO:0042803 "protein homodimerization activity" evidence=IDA;IPI] [GO:0005515 "protein binding" evidence=IPI] [GO:0046843 "dorsal appendage formation" evidence=IMP] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0001709 "cell fate determination" evidence=TAS] [GO:0017053 "transcriptional repressor complex" evidence=IPI] [GO:0003682 "chromatin binding" evidence=IDA] [GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IDA] [GO:0045892 "negative regulation of transcription, DNA-templated" evidence=IGI;IDA] [GO:0030707 "ovarian follicle cell development" evidence=IMP] [GO:0007298 "border follicle cell migration" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0048666 "neuron development" evidence=IMP] [GO:0060446 "branching involved in open tracheal system development" evidence=IMP] [GO:0016476 "regulation of embryonic cell shape" evidence=IMP] [GO:0035151 "regulation of tube size, open tracheal system" evidence=IMP] [GO:0040003 "chitin-based cuticle development" evidence=IMP] [GO:0035147 "branch fusion, open tracheal system" evidence=IMP] [GO:0007426 "tracheal outgrowth, open tracheal system" evidence=IMP] [GO:0035001 "dorsal trunk growth, open tracheal system" evidence=IMP] [GO:0001964 "startle response" evidence=IMP] [GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP] [GO:0048854 "brain morphogenesis" evidence=IMP] [GO:0002121 "inter-male aggressive behavior" evidence=IMP] [GO:0008360 "regulation of cell shape" evidence=IMP] [GO:0042675 "compound eye cone cell differentiation" evidence=IMP] [GO:0048053 "R1/R6 development" evidence=IMP] [GO:0048750 "compound eye corneal lens morphogenesis" evidence=IMP] [GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP] [GO:0031208 "POZ domain binding" evidence=IDA] [GO:0003677 "DNA binding" evidence=IDA] [GO:0042682 "regulation of compound eye cone cell fate specification" evidence=IGI;IMP] [GO:0043388 "positive regulation of DNA binding" evidence=IDA] Pfam:PF00096 InterPro:IPR000210 InterPro:IPR007087 InterPro:IPR013069 InterPro:IPR013087 InterPro:IPR017956 Pfam:PF00651 PROSITE:PS00028 PROSITE:PS50097 PROSITE:PS50157 SMART:SM00225 SMART:SM00384 InterPro:IPR015880 EMBL:AE014297 GO:GO:0017053 GO:GO:0042803 GO:GO:0046872 GO:GO:0035151 GO:GO:0045467 GO:GO:0001078 GO:GO:0045944 GO:GO:0007422 GO:GO:0003682 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 GO:GO:0000980 GO:GO:0000978 GeneTree:ENSGT00530000064321 GO:GO:0007298 GO:GO:0048813 SMART:SM00355 Gene3D:3.30.160.60 GO:GO:0002121 GO:GO:0005700 GO:GO:0040003 GO:GO:0007476 GO:GO:0016476 GO:GO:0046843 GO:GO:0035147 GO:GO:0001709 GO:GO:0042675 GO:GO:0048854 GO:GO:0043388 GO:GO:0031987 GO:GO:0001964 GO:GO:0007426 GO:GO:0031208 GO:GO:0035001 KO:K09237 EMBL:X71626 EMBL:Z11723 EMBL:BT025183 PIR:S36018 RefSeq:NP_001189329.1 RefSeq:NP_733443.1 RefSeq:NP_733444.1 RefSeq:NP_733445.1 UniGene:Dm.1526 ProteinModelPortal:P42282 SMR:P42282 BioGrid:71315 IntAct:P42282 MINT:MINT-282844 PaxDb:P42282 EnsemblMetazoa:FBtr0085825 EnsemblMetazoa:FBtr0085827 EnsemblMetazoa:FBtr0085829 EnsemblMetazoa:FBtr0303227 GeneID:48317 KEGG:dme:Dmel_CG1856 CTD:7272 FlyBase:FBgn0003870 eggNOG:NOG150336 InParanoid:P42282 OMA:VHLPTIL OrthoDB:EOG780RMM PhylomeDB:P42282 SignaLink:P42282 GenomeRNAi:48317 NextBio:839310 Bgee:P42282 GO:GO:0048750 GO:GO:0048053 GO:GO:0042682 Uniprot:P42282)

HSP 1 Score: 114.775 bits (286), Expect = 2.056e-25
Identity = 53/122 (43.44%), Postives = 80/122 (65.57%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            KM S+++ L+W+ +++N+L+ F  LL +ET +DVTL  EGQ  KAH++VL+ACS +F +LF   P   P      VIL      D++ LL FMYRGE  +  +R+ + L+ AE L++KGL+E
Sbjct:    2 KMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHP-----IVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTE 118          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:bab2 "bric a brac 2" species:7227 "Drosophila melanogaster" [GO:0005515 "protein binding" evidence=IPI] [GO:0006351 "transcription, DNA-templated" evidence=IEP] [GO:0008585 "female gonad development" evidence=IGI;IMP] [GO:0005634 "nucleus" evidence=IDA;TAS] [GO:0007455 "eye-antennal disc morphogenesis" evidence=ISS] [GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IGI;IMP] [GO:0003677 "DNA binding" evidence=NAS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=TAS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=TAS] [GO:0005700 "polytene chromosome" evidence=IDA] [GO:0003680 "AT DNA binding" evidence=IDA] [GO:0005701 "polytene chromosome chromocenter" evidence=IDA] [GO:0061040 "female gonad morphogenesis" evidence=IMP] InterPro:IPR000210 InterPro:IPR007889 InterPro:IPR009057 InterPro:IPR013069 Pfam:PF00651 Pfam:PF05225 PROSITE:PS50097 PROSITE:PS50960 SMART:SM00225 GO:GO:0005634 EMBL:AE014296 GO:GO:0003700 GO:GO:0006351 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 SUPFAM:SSF46689 GeneTree:ENSGT00530000064321 GO:GO:0005700 GO:GO:0007455 OrthoDB:EOG7X9G71 GO:GO:0003680 GO:GO:0007478 EMBL:AJ252173 EMBL:BT009963 EMBL:U14399 RefSeq:NP_523879.2 UniGene:Dm.3003 ProteinModelPortal:Q9W0K4 SMR:Q9W0K4 BioGrid:68922 DIP:DIP-20101N IntAct:Q9W0K4 MINT:MINT-749966 PaxDb:Q9W0K4 EnsemblMetazoa:FBtr0072639 GeneID:44254 KEGG:dme:Dmel_CG9102 CTD:44254 FlyBase:FBgn0025525 eggNOG:NOG319284 InParanoid:Q9W0K4 OMA:LAHSHAM PhylomeDB:Q9W0K4 ChiTaRS:bab2 GenomeRNAi:44254 NextBio:837022 Bgee:Q9W0K4 GO:GO:0061040 Uniprot:Q9W0K4)

HSP 1 Score: 114.005 bits (284), Expect = 3.972e-25
Identity = 49/118 (41.53%), Postives = 78/118 (66.10%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            +++ L+W+ Y++N+   F  LL+SE+  DVTL CEG + KAH++VL+ACS +F++LF   P   P      +I+      DL+ L+ FMY+GE  +  D+IN +LK AE L+++GL+E
Sbjct:  196 QQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNPCQHP-----IIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAE 308          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:lolal "lola like" species:7227 "Drosophila melanogaster" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS] [GO:0006342 "chromatin silencing" evidence=IMP] [GO:0016458 "gene silencing" evidence=IMP] [GO:0005515 "protein binding" evidence=IPI] [GO:0031519 "PcG protein complex" evidence=IPI] [GO:0007435 "salivary gland morphogenesis" evidence=IMP] [GO:0007426 "tracheal outgrowth, open tracheal system" evidence=IMP] [GO:0042803 "protein homodimerization activity" evidence=IDA] [GO:0003677 "DNA binding" evidence=IDA] [GO:0031208 "POZ domain binding" evidence=IDA] InterPro:IPR000210 InterPro:IPR013069 Pfam:PF00651 PROSITE:PS50097 SMART:SM00225 EMBL:AE013599 GO:GO:0045893 GO:GO:0042803 GO:GO:0001700 GO:GO:0003677 GO:GO:0007435 GO:GO:0003700 GO:GO:0006357 GO:GO:0006351 GO:GO:0016568 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 GeneTree:ENSGT00530000064321 GO:GO:0000794 GO:GO:0006342 GO:GO:0005700 GO:GO:0031519 GO:GO:0007426 GO:GO:0031208 EMBL:AF308476 EMBL:AY060364 EMBL:BT099722 RefSeq:NP_001163186.1 RefSeq:NP_001246402.1 RefSeq:NP_001246403.1 RefSeq:NP_524778.1 RefSeq:NP_725756.1 RefSeq:NP_725757.1 RefSeq:NP_725758.1 UniGene:Dm.1712 ProteinModelPortal:Q7KRI2 SMR:Q7KRI2 BioGrid:69215 IntAct:Q7KRI2 PaxDb:Q7KRI2 PRIDE:Q7KRI2 EnsemblMetazoa:FBtr0086776 EnsemblMetazoa:FBtr0086777 EnsemblMetazoa:FBtr0086778 EnsemblMetazoa:FBtr0086779 EnsemblMetazoa:FBtr0300483 EnsemblMetazoa:FBtr0300484 EnsemblMetazoa:FBtr0305270 GeneID:44703 KEGG:dme:Dmel_CG5738 CTD:44703 FlyBase:FBgn0022238 eggNOG:NOG147729 InParanoid:Q7KRI2 OMA:DVPFSHL OrthoDB:EOG7RZ5RT PhylomeDB:Q7KRI2 GenomeRNAi:44703 NextBio:837561 Bgee:Q7KRI2 Uniprot:Q7KRI2)

HSP 1 Score: 104.76 bits (260), Expect = 7.818e-25
Identity = 51/124 (41.13%), Postives = 82/124 (66.13%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIE 157
            +++ LKW+ ++TN++T+F  L + ++ +DVTL CEGQT KAH++VL+ACS +F++L    P   P      +IL       LQ +L FMY GE  +  +++ + LKTA+ L+VKGL+E P +I+
Sbjct:    6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP-----IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIK 124          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:bab1 "bric a brac 1" species:7227 "Drosophila melanogaster" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS] [GO:0006351 "transcription, DNA-templated" evidence=IEP;ISS] [GO:0007548 "sex differentiation" evidence=IGI;IMP;TAS] [GO:0048071 "sex-specific pigmentation" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI] [GO:0046660 "female sex differentiation" evidence=TAS] [GO:0048092 "negative regulation of male pigmentation" evidence=NAS] [GO:0005634 "nucleus" evidence=IDA] [GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IGI;IMP] [GO:0008585 "female gonad development" evidence=IGI;IMP] [GO:0007455 "eye-antennal disc morphogenesis" evidence=IEP] [GO:0003677 "DNA binding" evidence=NAS] [GO:0048070 "regulation of developmental pigmentation" evidence=TAS] [GO:0048086 "negative regulation of developmental pigmentation" evidence=TAS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=TAS] [GO:0003680 "AT DNA binding" evidence=IDA] InterPro:IPR000210 InterPro:IPR007889 InterPro:IPR009057 InterPro:IPR013069 Pfam:PF00651 Pfam:PF05225 PROSITE:PS50097 PROSITE:PS50960 SMART:SM00225 GO:GO:0005634 EMBL:AE014296 GO:GO:0003700 GO:GO:0006351 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 SUPFAM:SSF46689 GeneTree:ENSGT00530000064321 GO:GO:0007455 EMBL:AJ252082 EMBL:AY122075 EMBL:U01333 RefSeq:NP_728565.1 RefSeq:NP_995951.1 UniGene:Dm.14837 ProteinModelPortal:Q9W0K7 SMR:Q9W0K7 BioGrid:63665 DIP:DIP-18590N IntAct:Q9W0K7 PaxDb:Q9W0K7 EnsemblMetazoa:FBtr0072642 GeneID:38116 KEGG:dme:Dmel_CG9097 CTD:38116 FlyBase:FBgn0004870 eggNOG:NOG258497 InParanoid:Q9W0K7 OMA:KMMENSH OrthoDB:EOG7X9G71 PhylomeDB:Q9W0K7 SignaLink:Q9W0K7 GenomeRNAi:38116 NextBio:807056 Bgee:Q9W0K7 GO:GO:0003680 GO:GO:0046660 GO:GO:0007478 GO:GO:0048092 GO:GO:0048071 Uniprot:Q9W0K7)

HSP 1 Score: 112.464 bits (280), Expect = 1.326e-24
Identity = 47/118 (39.83%), Postives = 79/118 (66.95%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            +++ L+W+ Y+TN+ T F  LL++E   DVTL C+G++ KAH++VL+ACS +F++L +  P   P      VI+      DL+ ++ FMYRGE  +  D+I  +L+ AE+L+V+GL++
Sbjct:  100 QQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPCQHP-----IVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLAD 212          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:BtbVII "BTB-protein-VII" species:7227 "Drosophila melanogaster" [GO:0003677 "DNA binding" evidence=IEA;NAS] InterPro:IPR000210 InterPro:IPR013069 Pfam:PF00651 PROSITE:PS50097 SMART:SM00225 EMBL:AE014296 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 UniGene:Dm.4448 GeneID:38376 KEGG:dme:Dmel_CG43365 CTD:38376 FlyBase:FBgn0263108 GenomeRNAi:38376 RefSeq:NP_647774.2 IntAct:Q9VZU5 MINT:MINT-887900 PRIDE:Q9VZU5 UCSC:CG14956-RA InParanoid:Q9VZU5 OMA:EPSPAHA PhylomeDB:Q9VZU5 NextBio:808319 Bgee:Q9VZU5 Uniprot:Q9VZU5)

HSP 1 Score: 108.612 bits (270), Expect = 2.085e-23
Identity = 48/125 (38.40%), Postives = 82/125 (65.60%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRN 155
            M  +++ L+W+ ++ N ++    LL + TL DVTL  EG+  +AH++VL+ACS++F++LF+  P   P      VIL   + DDL+ ++ FMY GE  +  +++  +LKTAE+L++KGL+E P +
Sbjct:    1 MSVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP-----IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTD 120          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:ab "abrupt" species:7227 "Drosophila melanogaster" [GO:0016203 "muscle attachment" evidence=IMP] [GO:0005634 "nucleus" evidence=ISS;IDA] [GO:0007423 "sensory organ development" evidence=IMP] [GO:0008039 "synaptic target recognition" evidence=IMP] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0016198 "axon choice point recognition" evidence=TAS] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0003676 "nucleic acid binding" evidence=IEA] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0007517 "muscle organ development" evidence=IMP] [GO:0048666 "neuron development" evidence=IMP] [GO:0007298 "border follicle cell migration" evidence=IMP] [GO:0016319 "mushroom body development" evidence=IMP] InterPro:IPR000210 InterPro:IPR007087 InterPro:IPR013069 Pfam:PF00651 PROSITE:PS00028 PROSITE:PS50097 PROSITE:PS50157 SMART:SM00225 InterPro:IPR015880 GO:GO:0005634 EMBL:AE014134 GO:GO:0007423 GO:GO:0046872 GO:GO:0003677 GO:GO:0003700 GO:GO:0006351 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 EMBL:U43733 EMBL:BT001583 EMBL:BT003807 RefSeq:NP_001162952.1 RefSeq:NP_001260379.1 RefSeq:NP_476562.1 RefSeq:NP_476563.1 UniGene:Dm.1729 ProteinModelPortal:Q24174 SMR:Q24174 BioGrid:60620 DIP:DIP-19247N MINT:MINT-987262 STRING:7227.FBpp0079793 PaxDb:Q24174 EnsemblMetazoa:FBtr0332558 GeneID:34560 KEGG:dme:Dmel_CG43860 UCSC:CG4807-RA CTD:34560 FlyBase:FBgn0264442 eggNOG:NOG150395 GeneTree:ENSGT00530000064321 InParanoid:Q24174 OMA:GLTIEPI OrthoDB:EOG7R8326 PhylomeDB:Q24174 GenomeRNAi:34560 NextBio:789065 PRO:PR:Q24174 Bgee:Q24174 GO:GO:0016198 GO:GO:0007298 GO:GO:0048813 GO:GO:0016203 GO:GO:0016319 GO:GO:0008039 SMART:SM00355 Uniprot:Q24174)

HSP 1 Score: 104.76 bits (260), Expect = 3.418e-22
Identity = 48/116 (41.38%), Postives = 74/116 (63.79%), Query Frame = 0
Query:   36 YKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            Y LKW+ ++++IL++F  L + E   DVTL C+ ++F AH++VL+ACS +F  L    P   P      VIL   R DD++ LL FMY GE  + H+++   LKTA +LQ++GL++
Sbjct:   78 YALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHP-----IVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD 188          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:br "broad" species:7227 "Drosophila melanogaster" [GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP] [GO:0005634 "nucleus" evidence=NAS;IDA] [GO:0007458 "progression of morphogenetic furrow involved in compound eye morphogenesis" evidence=IMP] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=NAS] [GO:0007552 "metamorphosis" evidence=NAS;TAS] [GO:0035071 "salivary gland cell autophagic cell death" evidence=NAS] [GO:0035070 "salivary gland histolysis" evidence=NAS;IMP] [GO:0001752 "compound eye photoreceptor fate commitment" evidence=IMP] [GO:0035072 "ecdysone-mediated induction of salivary gland cell autophagic cell death" evidence=NAS] [GO:0006914 "autophagy" evidence=IMP] [GO:0008219 "cell death" evidence=TAS] [GO:0040034 "regulation of development, heterochronic" evidence=IMP;TAS] [GO:0009608 "response to symbiont" evidence=IMP] [GO:0035075 "response to ecdysone" evidence=IMP] [GO:0035193 "larval central nervous system remodeling" evidence=IMP] [GO:0003677 "DNA binding" evidence=IDA] [GO:0007562 "eclosion" evidence=IEP] [GO:0071390 "cellular response to ecdysone" evidence=IMP] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048747 "muscle fiber development" evidence=IGI] [GO:0042332 "gravitaxis" evidence=IMP] [GO:0048477 "oogenesis" evidence=IMP] [GO:0048808 "male genitalia morphogenesis" evidence=IMP] [GO:0010629 "negative regulation of gene expression" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] InterPro:IPR000210 InterPro:IPR007087 InterPro:IPR013069 Pfam:PF00651 PROSITE:PS00028 PROSITE:PS50097 PROSITE:PS50157 SMART:SM00225 InterPro:IPR015880 GO:GO:0005634 GO:GO:0006914 GO:GO:0046872 EMBL:AE014298 GO:GO:0045944 GO:GO:0048477 GO:GO:0003700 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 GO:GO:0048813 SMART:SM00355 GO:GO:0048747 GO:GO:0000977 GO:GO:0010629 GO:GO:0040034 GO:GO:0048808 GO:GO:0001752 EMBL:AL009146 UniGene:Dm.20757 BioGrid:69091 GeneID:44505 KEGG:dme:Dmel_CG11491 CTD:103946 FlyBase:FBgn0000210 KO:K02174 ChiTaRS:br GenomeRNAi:44505 NextBio:837335 GO:GO:0071390 GO:GO:0035072 GO:GO:0007562 GO:GO:0042332 GO:GO:0007458 GO:GO:0009608 EMBL:U51585 EMBL:AY069756 RefSeq:NP_001138144.1 RefSeq:NP_001259134.1 RefSeq:NP_726751.2 RefSeq:NP_726752.1 RefSeq:NP_726753.1 ProteinModelPortal:Q24206 SMR:Q24206 DIP:DIP-18557N IntAct:Q24206 MINT:MINT-302688 EnsemblMetazoa:FBtr0070261 EnsemblMetazoa:FBtr0070263 EnsemblMetazoa:FBtr0300427 EnsemblMetazoa:FBtr0300428 EnsemblMetazoa:FBtr0332293 InParanoid:Q24206 PhylomeDB:Q24206 SignaLink:Q24206 Bgee:Q24206 Uniprot:Q24206)

HSP 1 Score: 103.99 bits (258), Expect = 7.320e-22
Identity = 48/119 (40.34%), Postives = 72/119 (60.50%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++ + L+W+ Y+++I +AF  L + E   DVTL CEG++ KAHR+VL+ACS +F  L    P   P      ++L      DL  L+ F+Y GE  +H   + S LKTAEVL+V GL++
Sbjct:    4 TQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPV-----ILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQ 117          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:lov "jim lovell" species:7227 "Drosophila melanogaster" [GO:0003677 "DNA binding" evidence=ISS;NAS] [GO:0042332 "gravitaxis" evidence=IMP] [GO:0007418 "ventral midline development" evidence=IMP] [GO:0048477 "oogenesis" evidence=IMP] [GO:0008346 "larval walking behavior" evidence=IMP] [GO:0048060 "negative gravitaxis" evidence=IMP] [GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP] [GO:0008049 "male courtship behavior" evidence=IMP] [GO:0030536 "larval feeding behavior" evidence=IMP] InterPro:IPR000210 InterPro:IPR007889 InterPro:IPR009057 InterPro:IPR013069 Pfam:PF00651 Pfam:PF05225 PROSITE:PS50097 PROSITE:PS50960 SMART:SM00225 EMBL:AE013599 GO:GO:0005634 GO:GO:0003677 GO:GO:0048477 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 SUPFAM:SSF46689 GeneTree:ENSGT00530000064321 GO:GO:0008049 GO:GO:0031987 GO:GO:0007418 GO:GO:0030536 EMBL:AJ252174 EMBL:AY122101 EMBL:U14400 PIR:A27041 RefSeq:NP_001014554.1 RefSeq:NP_523865.2 RefSeq:NP_611994.3 RefSeq:NP_665704.1 UniGene:Dm.38988 UniGene:Dm.6651 ProteinModelPortal:P14083 SMR:P14083 IntAct:P14083 MINT:MINT-5227398 PRIDE:P14083 EnsemblMetazoa:FBtr0072457 EnsemblMetazoa:FBtr0072458 EnsemblMetazoa:FBtr0100126 GeneID:38007 KEGG:dme:Dmel_CG16778 FlyBase:FBgn0266129 eggNOG:NOG145987 InParanoid:P14083 OrthoDB:EOG715Q48 PhylomeDB:P14083 GenomeRNAi:38007 NextBio:806518 Bgee:P14083 GO:GO:0008346 GO:GO:0048060 Uniprot:P14083)

HSP 1 Score: 100.138 bits (248), Expect = 1.310e-20
Identity = 44/118 (37.29%), Postives = 73/118 (61.86%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            + Y L+W+ ++ +IL AF  LL+++TL DVTL C   + +AH++VL+ACS  F+ +F+  P   P      ++L   R   +Q ++ FMYRGE  +   R+ ++++  E LQV+GL E
Sbjct:  113 DHYSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPV-----IVLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVE 225          
BLAST of EMLSAG00000000011 vs. GO
Match: - (symbol:CG3726 species:7227 "Drosophila melanogaster" [GO:0003677 "DNA binding" evidence=IEA;NAS] InterPro:IPR000210 InterPro:IPR007889 InterPro:IPR009057 InterPro:IPR013069 InterPro:IPR017956 Pfam:PF00651 PROSITE:PS50097 PROSITE:PS50960 SMART:SM00225 SMART:SM00384 GO:GO:0003677 EMBL:AE014298 Gene3D:3.30.710.10 InterPro:IPR011333 SUPFAM:SSF54695 SUPFAM:SSF46689 GeneTree:ENSGT00530000064321 EMBL:AY095035 RefSeq:NP_572279.1 UniGene:Dm.12969 SMR:Q8SWW7 MINT:MINT-311134 STRING:7227.FBpp0070823 EnsemblMetazoa:FBtr0070858 GeneID:31525 KEGG:dme:Dmel_CG3726 UCSC:CG3726-RA FlyBase:FBgn0029824 eggNOG:NOG324528 InParanoid:Q8SWW7 OMA:GEINVEH OrthoDB:EOG7NKKMN ChiTaRS:CG3726 GenomeRNAi:31525 NextBio:774060 Uniprot:Q8SWW7)

HSP 1 Score: 99.7525 bits (247), Expect = 1.321e-20
Identity = 47/121 (38.84%), Postives = 74/121 (61.16%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            M  ++Y L+W  + +N+ T F  LL+     DVTL CEGQ  +AHR+VL ACST F+++ S    N  +     +I+      +++ L+ FMY+GE  + H  + S+LKTA+ L++KGL+E
Sbjct:    1 MLPQQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQLIRAHRVVLCACSTFFDAVLS----NYASERDPIIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKGLAE 117          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592762759|gb|GAXK01191654.1| (TSA: Calanus finmarchicus comp41427_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 188.348 bits (477), Expect = 1.305e-49
Identity = 88/123 (71.54%), Postives = 101/123 (82.11%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEG 152
            KMG+++Y L+W+ YETNIL+ F GLL+SE LSDVTLFCEG++FKAHRLVLAACS+HF  LFS    N+  N Q  VILDGTR  DLQILL FMYRG AYLH DRI SVL+TAEVLQVKGLS+G
Sbjct:  672 KMGNDQYCLRWNSYETNILSTFEGLLDSEALSDVTLFCEGESFKAHRLVLAACSSHFSKLFS----NSSLNGQLIVILDGTRHQDLQILLQFMYRGVAYLHQDRIESVLRTAEVLQVKGLSDG 1028          

HSP 2 Score: 141.354 bits (355), Expect = 2.426e-34
Identity = 71/117 (60.68%), Postives = 82/117 (70.09%), Query Frame = 0
Query:  432 NNLETFRRL---AQQHARTLP-----IPVTLAQGFSASDYVRLASHVRDPE------NGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            +NL T ++L    Q     LP     +P+T   G  ASD  R+A  V DP       +GTGTKL+CPFCERTYGYETNLRAHIRQRHQGIRV CP+C R+FTRNNTVRRH+AREHRH
Sbjct: 2199 SNLATIQKLEMFQQSREAFLPPGGFSVPLTAPLGIPASDLARIAQTVPDPAGNGEATSGTGTKLKCPFCERTYGYETNLRAHIRQRHQGIRVPCPFCHRSFTRNNTVRRHIAREHRH 2549          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592762760|gb|GAXK01191653.1| (TSA: Calanus finmarchicus comp41427_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 188.348 bits (477), Expect = 1.536e-49
Identity = 88/123 (71.54%), Postives = 101/123 (82.11%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEG 152
            KMG+++Y L+W+ YETNIL+ F GLL+SE LSDVTLFCEG++FKAHRLVLAACS+HF  LFS    N+  N Q  VILDGTR  DLQILL FMYRG AYLH DRI SVL+TAEVLQVKGLS+G
Sbjct:  730 KMGNDQYCLRWNSYETNILSTFEGLLDSEALSDVTLFCEGESFKAHRLVLAACSSHFSKLFS----NSSLNGQLIVILDGTRHQDLQILLQFMYRGVAYLHQDRIESVLRTAEVLQVKGLSDG 1086          

HSP 2 Score: 141.354 bits (355), Expect = 2.753e-34
Identity = 71/117 (60.68%), Postives = 82/117 (70.09%), Query Frame = 0
Query:  432 NNLETFRRL---AQQHARTLP-----IPVTLAQGFSASDYVRLASHVRDPE------NGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            +NL T ++L    Q     LP     +P+T   G  ASD  R+A  V DP       +GTGTKL+CPFCERTYGYETNLRAHIRQRHQGIRV CP+C R+FTRNNTVRRH+AREHRH
Sbjct: 2257 SNLATIQKLEMFQQSREAFLPPGGFSVPLTAPLGIPASDLARIAQTVPDPAGNGEATSGTGTKLKCPFCERTYGYETNLRAHIRQRHQGIRVPCPFCHRSFTRNNTVRRHIAREHRH 2607          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592762757|gb|GAXK01191656.1| (TSA: Calanus finmarchicus comp41427_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 141.354 bits (355), Expect = 2.555e-34
Identity = 71/117 (60.68%), Postives = 82/117 (70.09%), Query Frame = 0
Query:  432 NNLETFRRL---AQQHARTLP-----IPVTLAQGFSASDYVRLASHVRDPE------NGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            +NL T ++L    Q     LP     +P+T   G  ASD  R+A  V DP       +GTGTKL+CPFCERTYGYETNLRAHIRQRHQGIRV CP+C R+FTRNNTVRRH+AREHRH
Sbjct: 2013 SNLATIQKLEMFQQSREAFLPPGGFSVPLTAPLGIPASDLARIAQTVPDPAGNGEATSGTGTKLKCPFCERTYGYETNLRAHIRQRHQGIRVPCPFCHRSFTRNNTVRRHIAREHRH 2363          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592762758|gb|GAXK01191655.1| (TSA: Calanus finmarchicus comp41427_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 141.354 bits (355), Expect = 2.757e-34
Identity = 71/117 (60.68%), Postives = 82/117 (70.09%), Query Frame = 0
Query:  432 NNLETFRRL---AQQHARTLP-----IPVTLAQGFSASDYVRLASHVRDPE------NGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            +NL T ++L    Q     LP     +P+T   G  ASD  R+A  V DP       +GTGTKL+CPFCERTYGYETNLRAHIRQRHQGIRV CP+C R+FTRNNTVRRH+AREHRH
Sbjct: 2071 SNLATIQKLEMFQQSREAFLPPGGFSVPLTAPLGIPASDLARIAQTVPDPAGNGEATSGTGTKLKCPFCERTYGYETNLRAHIRQRHQGIRVPCPFCHRSFTRNNTVRRHIAREHRH 2421          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592858476|gb|GAXK01099086.1| (TSA: Calanus finmarchicus comp238511_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 116.701 bits (291), Expect = 4.772e-28
Identity = 55/124 (44.35%), Postives = 79/124 (63.71%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            KM S+++ LKW+ Y+ NI+ A   L   E   DVTL CEG+T KAH+++L+ACS +F+++F   P   P      VIL   R  DL+ L+ +MY G+ Y+  D++   LKTAE LQ+KGL+E P
Sbjct:  537 KMTSDQFCLKWNNYQANIVCALGNLKLDEDFVDVTLSCEGRTIKAHKVILSACSAYFKNVFKENPCQHPV-----VILKDVRHADLESLVKYMYAGQVYIKQDQLGRFLKTAEALQIKGLAEHP 893          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592903314|gb|GAXK01055061.1| (TSA: Calanus finmarchicus comp84534_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 118.242 bits (295), Expect = 7.683e-27
Identity = 55/123 (44.72%), Postives = 75/123 (60.98%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            +  +KY L+W  Y  ++L  F  L E E   DVTL CE   + AH++VL+ACS +F  L    P   P      VIL   R DDL++LL+FMY+GE  +  DRIN+ L+TAE LQ+KGL++ P
Sbjct:  242 VADQKYNLRWPDYHNSVLATFRSLKEEEDFIDVTLSCEETQYSAHKVVLSACSPYFRKLLKSNPCQHP-----IVILRDVREDDLRLLLNFMYQGEVQVEQDRINTFLRTAETLQIKGLTDHP 595          

HSP 2 Score: 35.4242 bits (80), Expect = 7.311e-1
Identity = 18/57 (31.58%), Postives = 27/57 (47.37%), Query Frame = 0
Query:  483 CPFCERTYGYETNLRAHIRQRHQ---GIRVSCPYCPRTFTRNNTVRRHVAREHRHLS 536
            CP C + Y     LR H+  +H    G R  C  C       N++  H++R+HR +S
Sbjct: 1286 CPKCGKIYRSAHTLRTHMEDKHTICPGYR--CVLCGTVAKSRNSLHSHMSRQHRGIS 1450          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592787700|gb|GAXK01166868.1| (TSA: Calanus finmarchicus comp1193_c26_seq242 transcribed RNA sequence)

HSP 1 Score: 109.768 bits (273), Expect = 4.840e-26
Identity = 53/141 (37.59%), Postives = 82/141 (58.16%), Query Frame = 0
Query:   13 RESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            +E    F  V  R+   KM SEK+ L+W+ +E+NI  AF  L + +   DVTL C+ +  +AH+++L+ACS  F ++    P   P      + L G +  D+Q +L+FMY GE  +  + +NS L  AE L+VKGL++GP
Sbjct:    7 QEIKVKFEKVSERNESVKMSSEKFCLRWNDFESNISVAFRELRDDKDFFDVTLACDDEQIQAHKVILSACSPFFRNILRRNPHQHP-----LLYLKGVKYSDIQSVLNFMYHGEVNVAQEELNSFLAVAEELRVKGLTQGP 414          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592787874|gb|GAXK01166694.1| (TSA: Calanus finmarchicus comp1193_c26_seq68 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 5.580e-25
Identity = 53/141 (37.59%), Postives = 82/141 (58.16%), Query Frame = 0
Query:   13 RESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            +E    F  V  R+   KM SEK+ L+W+ +E+NI  AF  L + +   DVTL C+ +  +AH+++L+ACS  F ++    P   P      + L G +  D+Q +L+FMY GE  +  + +NS L  AE L+VKGL++GP
Sbjct:    7 QEIKVKFEKVSERNESVKMSSEKFCLRWNDFESNISVAFRELRDDKDFFDVTLACDDEQIQAHKVILSACSPFFRNILRRNPHQHP-----LLYLKGVKYSDIQSVLNFMYHGEVNVAQEELNSFLAVAEELRVKGLTQGP 414          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592787888|gb|GAXK01166680.1| (TSA: Calanus finmarchicus comp1193_c26_seq54 transcribed RNA sequence)

HSP 1 Score: 108.997 bits (271), Expect = 1.065e-24
Identity = 53/141 (37.59%), Postives = 82/141 (58.16%), Query Frame = 0
Query:   13 RESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            +E    F  V  R+   KM SEK+ L+W+ +E+NI  AF  L + +   DVTL C+ +  +AH+++L+ACS  F ++    P   P      + L G +  D+Q +L+FMY GE  +  + +NS L  AE L+VKGL++GP
Sbjct:    7 QEIKVKFEKVSERNESVKMSSEKFCLRWNDFESNISVAFRELRDDKDFFDVTLACDDEQIQAHKVILSACSPFFRNILRRNPHQHP-----LLYLKGVKYSDIQSVLNFMYHGEVNVAQEELNSFLAVAEELRVKGLTQGP 414          
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Match: gi|592910523|gb|GAXK01047852.1| (TSA: Calanus finmarchicus comp74949_c0_seq5 transcribed RNA sequence)

HSP 1 Score: 108.227 bits (269), Expect = 1.188e-24
Identity = 51/126 (40.48%), Postives = 80/126 (63.49%), Query Frame = 0
Query:   27 RMRKMGS-EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            R R MGS +++ L+W+ Y+++++TAF  LL+ +   DVTL  EG+   AH+++L+ACS +F  L    P   P      +IL   + DDL  LL FMY GE  +  D++NS LK+AE L+++GL++
Sbjct:   49 RARTMGSDQRFSLRWNNYQSHLVTAFESLLDEKDFIDVTLGVEGRKLPAHKMLLSACSPYFRELLKGNPCQHP-----IIILRDIKYDDLFSLLQFMYNGEVNVAQDQLNSFLKSAESLKIRGLTD 411          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000000011 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:80801:91923:-1 gene:EMLSAG00000000011 transcript:EMLSAT00000000011 description:"maker-LSalAtl2s1003-snap-gene-1.13")

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 550/550 (100.00%), Postives = 550/550 (100.00%), Query Frame = 0
Query:    1 MDDDWEYVSRNNRESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYYPREQFPMYRLPTFAGXPVEAVAAAAXAAAAASSGSNNLPSSSSPFNHKASPSPCGGGERYSKMIRGGSASPHRPPSVSKREEEDDHYVRSSPMIRPSSNKAEDYEDVPPPPRGMGNSSSPQPPVSGLSKHQSFPSDSTTTELNSGPSGLLSRAYKERLRRESEHCEPESNTNNDDLTHQTKFPDFRNSREEISRLNDITPPRNPSGLNDEDVRXXANNLETFRRLAQQHARTLPIPVTLAQGFSASDYVRLASHVRDPENGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRHLSLVFSQTSLEIHKTD 550
            MDDDWEYVSRNNRESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYYPREQFPMYRLPTFAGXPVEAVAAAAXAAAAASSGSNNLPSSSSPFNHKASPSPCGGGERYSKMIRGGSASPHRPPSVSKREEEDDHYVRSSPMIRPSSNKAEDYEDVPPPPRGMGNSSSPQPPVSGLSKHQSFPSDSTTTELNSGPSGLLSRAYKERLRRESEHCEPESNTNNDDLTHQTKFPDFRNSREEISRLNDITPPRNPSGLNDEDVRXXANNLETFRRLAQQHARTLPIPVTLAQGFSASDYVRLASHVRDPENGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRHLSLVFSQTSLEIHKTD
Sbjct:    1 MDDDWEYVSRNNRESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYYPREQFPMYRLPTFAGXPVEAVAAAAXAAAAASSGSNNLPSSSSPFNHKASPSPCGGGERYSKMIRGGSASPHRPPSVSKREEEDDHYVRSSPMIRPSSNKAEDYEDVPPPPRGMGNSSSPQPPVSGLSKHQSFPSDSTTTELNSGPSGLLSRAYKERLRRESEHCEPESNTNNDDLTHQTKFPDFRNSREEISRLNDITPPRNPSGLNDEDVRXXANNLETFRRLAQQHARTLPIPVTLAQGFSASDYVRLASHVRDPENGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRHLSLVFSQTSLEIHKTD 550          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000006827 (pep:novel supercontig:LSalAtl2s:LSalAtl2s385:122699:145346:1 gene:EMLSAG00000006827 transcript:EMLSAT00000006827 description:"maker-LSalAtl2s385-augustus-gene-1.13")

HSP 1 Score: 117.472 bits (293), Expect = 2.526e-28
Identity = 52/121 (42.98%), Postives = 81/121 (66.94%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            M SE++ LKW+ Y++NI++A   L   E   DVTL CEG+T KAH+++L+ACS +F  +F   P N P      +IL  T+  DL+ L+ ++Y+G+ Y+  + ++S LKTA+ LQ+KGL+E
Sbjct:    1 MTSEQFCLKWNNYQSNIVSALGNLKLDEDFVDVTLSCEGRTIKAHKVILSACSLYFRDVFRETPCNHP-----IIILKDTQYSDLESLVKYVYQGQXYISQENLSSFLKTADALQIKGLAE 116          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000009541 (pep:novel supercontig:LSalAtl2s:LSalAtl2s613:57802:64681:-1 gene:EMLSAG00000009541 transcript:EMLSAT00000009541 description:"maker-LSalAtl2s613-snap-gene-0.15")

HSP 1 Score: 111.694 bits (278), Expect = 8.130e-27
Identity = 55/118 (46.61%), Postives = 83/118 (70.34%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++Y LKW+ ++TN+L  F+ LL SE  +DV L  EG+T + H++VL+ACS++FE LFS    +    NQ  VIL  T+ DDL  ++ FMY+GE  +  ++++S+LKTAE L+VKGL+E
Sbjct:   11 QQYCLKWNNHQTNLLKVFNRLLGSEQFTDVLLAAEGRTLRGHKVVLSACSSYFEQLFS----SFNEKNQ-IVILKDTKFDDLAAIIEFMYKGEISIIQEQLSSLLKTAENLKVKGLAE 123          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000001548 (pep:novel supercontig:LSalAtl2s:LSalAtl2s126:209647:210033:1 gene:EMLSAG00000001548 transcript:EMLSAT00000001548 description:"augustus_masked-LSalAtl2s126-processed-gene-2.5")

HSP 1 Score: 104.76 bits (260), Expect = 1.998e-26
Identity = 49/124 (39.52%), Postives = 81/124 (65.32%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIE 157
            +++ L+W+ ++TN++++F  L + ++ +DVTL C+GQT KAH++VL+ACS +F++L    P   P      +IL       L  +L FMY GE  +  D++ + LKTAE L+VKGL+E P+ I+
Sbjct:    8 QQFCLRWNDFQTNMVSSFKHLRDEKSFTDVTLACDGQTCKAHKMVLSACSPYFKALLEENPAKHP-----IIILKDVPFQHLTAILEFMYAGEVNVAQDQLPAFLKTAERLKVKGLAEAPQTIK 126          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000011119 (pep:novel supercontig:LSalAtl2s:LSalAtl2s753:172698:206363:1 gene:EMLSAG00000011119 transcript:EMLSAT00000011119 description:"augustus_masked-LSalAtl2s753-processed-gene-1.0")

HSP 1 Score: 99.7525 bits (247), Expect = 5.264e-24
Identity = 50/117 (42.74%), Postives = 68/117 (58.12%), Query Frame = 0
Query:   35 KYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            K +LKW +Y  +++ +F  L E E   DVTL C  Q F AH++VL+ACS +F  L    P + P      +IL      D++ LL FMY GE  +  DRI   LKTAE LQ++GL+E
Sbjct:   42 KLRLKWDQYPQSLVNSFRDLKEEEDFVDVTLACNSQQFNAHKVVLSACSPYFRKLLKSNPCHHP-----IIILRDVVEIDIESLLKFMYNGEVQISEDRIKDFLKTAESLQIRGLAE 153          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000002455 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1471:52173:56863:1 gene:EMLSAG00000002455 transcript:EMLSAT00000002455 description:"maker-LSalAtl2s1471-snap-gene-0.12")

HSP 1 Score: 102.834 bits (255), Expect = 2.441e-23
Identity = 48/118 (40.68%), Postives = 74/118 (62.71%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++Y L+W+ ++ N+L+ F  LL  E   DVTL  EG   KAH++VL+ACS +F+S+  + P   P      V L   R  +++ LL FMYRGE  +  + ++S+LK AE L++KGL+E
Sbjct:    8 QQYCLRWNNHQHNLLSVFEDLLNHEAFVDVTLAVEGLQLKAHKMVLSACSPYFQSMLYNTPDRHP-----IVFLRDVRYSEMKALLEFMYRGEVSVDQENLSSLLKVAEGLKIKGLAE 120          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000007481 (pep:novel supercontig:LSalAtl2s:LSalAtl2s42:537429:544881:1 gene:EMLSAG00000007481 transcript:EMLSAT00000007481 description:"maker-LSalAtl2s42-augustus-gene-5.9")

HSP 1 Score: 99.3673 bits (246), Expect = 2.774e-22
Identity = 48/123 (39.02%), Postives = 78/123 (63.41%), Query Frame = 0
Query:   31 MGSEK-YKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEG 152
            MG+E+ + LKW+ + + IL+ F  LLE E+L DVTL  EGQ  +AH+++L+ACS +F  +F  A    P      + +     ++L+ L+ +MY+GEA +    + S ++TAE LQ++GL+EG
Sbjct:    1 MGTEQQFCLKWNNHRSTILSVFDTLLEEESLVDVTLTAEGQFLRAHKVILSACSPYFRIMFRAANEKHPV-----IYMQNVDFENLKALVEYMYKGEANVPQHMLPSFIRTAESLQIRGLAEG 118          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000008770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s543:274592:275849:1 gene:EMLSAG00000008770 transcript:EMLSAT00000008770 description:"augustus-LSalAtl2s543-processed-gene-1.2")

HSP 1 Score: 93.9745 bits (232), Expect = 2.618e-21
Identity = 49/124 (39.52%), Postives = 71/124 (57.26%), Query Frame = 0
Query:   31 MGS-EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGP 153
            MGS E+  L+W++YE+N    F  L E+E L DVTL    +  KAH+++L+ACS  F S+ + API         + L G   D L++LL FMY GE  +  + ++  +  AE  Q+KGLS  P
Sbjct:    1 MGSLERLCLRWNEYESNFKQGFSDLRENEELFDVTLISGSKIIKAHKVILSACSPIFRSIIASAPIQTHP----LIYLRGINFDHLELLLSFMYHGEVKVIQEELDDFISIAEEFQIKGLSNDP 120          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000003038 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1728:22097:26590:1 gene:EMLSAG00000003038 transcript:EMLSAT00000003038 description:"maker-LSalAtl2s1728-augustus-gene-0.10")

HSP 1 Score: 96.2857 bits (238), Expect = 3.231e-21
Identity = 41/120 (34.17%), Postives = 75/120 (62.50%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            M  + Y L+W+ ++ ++L+AF  LL++E L D TL CE  + +AH++VL+ACS +F+ +F+      P      ++L   +  + Q ++ FMY+GE  +   ++ S++K AE L+V+GL+
Sbjct:    1 MAXQHYSLRWNNHQXHVLSAFDTLLQNEALVDCTLVCEDTSVRAHKVVLSACSPYFQKIFTDNVCKHP-----IIVLKDIKGWEAQCIVDFMYKGETSVPESQLTSLIKAAESLKVRGLT 115          
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Match: EMLSAP00000010252 (pep:novel supercontig:LSalAtl2s:LSalAtl2s67:813352:817116:1 gene:EMLSAG00000010252 transcript:EMLSAT00000010252 description:"maker-LSalAtl2s67-augustus-gene-8.26")

HSP 1 Score: 90.8929 bits (224), Expect = 7.386e-20
Identity = 46/138 (33.33%), Postives = 78/138 (56.52%), Query Frame = 0
Query:   28 MRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQ-TFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMH 164
            ++   S++Y LKW+ +  N+      L   E   DVTLF   Q + K H+++L+A S + E + S+ P + PT     ++L     +DL++L+ FMY GE ++  D +  +L  A+VL++KGL EG    + NN +M+
Sbjct:    3 VQAFKSQQYCLKWNNHNKNVSGFLERLRTLEQFVDVTLFTADQKSIKCHKILLSASSVYLEDILSNNPSDHPT-----IVLSQIYYNDLKLLIDFMYAGEVFVEQDCLVKLLDAAKVLKIKGLYEGSSTNDENNNDMN 135          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|75027304|sp|Q9VQ30.3|CHNMO_DROME (RecName: Full=Zinc finger protein chinmo; AltName: Full=Protein chronologically inappropriate morphogenesis)

HSP 1 Score: 125.561 bits (314), Expect = 2.834e-29
Identity = 58/136 (42.65%), Postives = 82/136 (60.29%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXAS 169
            +++ LKW+ + +N+   F  L +S+ L+DV L C+G  FKAH+L+LAACS  F  LF     N PTN Q  +IL+ T  D++  LL FMY+GE ++  + +NS LK+AE LQVKGLS     +       HM   S
Sbjct:    5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFE----NTPTNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHMGDLS 136          

HSP 2 Score: 112.849 bits (281), Expect = 4.186e-25
Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            G KL+C +C+R YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+ 
Sbjct:  514 GKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQ 570          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|20455517|sp|P17789.2|TTKB_DROME (RecName: Full=Protein tramtrack, beta isoform; AltName: Full=Repressor protein fushi tarazu; AltName: Full=Tramtrack p69)

HSP 1 Score: 114.39 bits (285), Expect = 1.290e-25
Identity = 53/122 (43.44%), Postives = 80/122 (65.57%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            KM S+++ L+W+ +++N+L+ F  LL +ET +DVTL  EGQ  KAH++VL+ACS +F +LF   P   P      VIL      D++ LL FMYRGE  +  +R+ + L+ AE L++KGL+E
Sbjct:    2 KMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHP-----IVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTE 118          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|47117851|sp|P42282.3|TTKA_DROME (RecName: Full=Protein tramtrack, alpha isoform; AltName: Full=Repressor protein fushi tarazu; AltName: Full=Tramtrack p88)

HSP 1 Score: 114.775 bits (286), Expect = 1.545e-25
Identity = 53/122 (43.44%), Postives = 80/122 (65.57%), Query Frame = 0
Query:   30 KMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            KM S+++ L+W+ +++N+L+ F  LL +ET +DVTL  EGQ  KAH++VL+ACS +F +LF   P   P      VIL      D++ LL FMYRGE  +  +R+ + L+ AE L++KGL+E
Sbjct:    2 KMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHP-----IVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTE 118          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|73621174|sp|Q7KRI2.1|LOLAL_DROME (RecName: Full=Longitudinals lacking protein-like; Short=Lola-like protein; AltName: Full=Protein Batman)

HSP 1 Score: 104.76 bits (260), Expect = 1.774e-25
Identity = 51/124 (41.13%), Postives = 82/124 (66.13%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIE 157
            +++ LKW+ ++TN++T+F  L + ++ +DVTL CEGQT KAH++VL+ACS +F++L    P   P      +IL       LQ +L FMY GE  +  +++ + LKTA+ L+VKGL+E P +I+
Sbjct:    6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP-----IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIK 124          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|29428067|sp|Q9W0K4.2|BAB2_DROME (RecName: Full=Protein bric-a-brac 2)

HSP 1 Score: 114.005 bits (284), Expect = 2.999e-25
Identity = 49/118 (41.53%), Postives = 78/118 (66.10%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            +++ L+W+ Y++N+   F  LL+SE+  DVTL CEG + KAH++VL+ACS +F++LF   P   P      +I+      DL+ L+ FMY+GE  +  D+IN +LK AE L+++GL+E
Sbjct:  196 QQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNPCQHP-----IIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAE 308          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|29428068|sp|Q9W0K7.2|BAB1_DROME (RecName: Full=Protein bric-a-brac 1)

HSP 1 Score: 112.464 bits (280), Expect = 9.901e-25
Identity = 47/118 (39.83%), Postives = 79/118 (66.95%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            +++ L+W+ Y+TN+ T F  LL++E   DVTL C+G++ KAH++VL+ACS +F++L +  P   P      VI+      DL+ ++ FMYRGE  +  D+I  +L+ AE+L+V+GL++
Sbjct:  100 QQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAETPCQHP-----IVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLAD 212          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|27923726|sp|Q24174.2|ABRU_DROME (RecName: Full=Protein abrupt; AltName: Full=Protein clueless)

HSP 1 Score: 104.76 bits (260), Expect = 2.487e-22
Identity = 48/116 (41.38%), Postives = 74/116 (63.79%), Query Frame = 0
Query:   36 YKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            Y LKW+ ++++IL++F  L + E   DVTL C+ ++F AH++VL+ACS +F  L    P   P      VIL   R DD++ LL FMY GE  + H+++   LKTA +LQ++GL++
Sbjct:   78 YALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHP-----IVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD 188          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|13124701|sp|Q01295.2|BRC1_DROME (RecName: Full=Broad-complex core protein isoforms 1/2/3/4/5)

HSP 1 Score: 104.375 bits (259), Expect = 2.869e-22
Identity = 48/119 (40.34%), Postives = 72/119 (60.50%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++ + L+W+ Y+++I +AF  L + E   DVTL CEG++ KAHR+VL+ACS +F  L    P   P      ++L      DL  L+ F+Y GE  +H   + S LKTAEVL+V GL++
Sbjct:    4 TQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPV-----ILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQ 117          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|13123979|sp|Q24206.2|BRC4_DROME (RecName: Full=Broad-complex core protein isoform 6)

HSP 1 Score: 103.99 bits (258), Expect = 5.322e-22
Identity = 48/119 (40.34%), Postives = 72/119 (60.50%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++ + L+W+ Y+++I +AF  L + E   DVTL CEG++ KAHR+VL+ACS +F  L    P   P      ++L      DL  L+ F+Y GE  +H   + S LKTAEVL+V GL++
Sbjct:    4 TQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPV-----ILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQ 117          
BLAST of EMLSAG00000000011 vs. SwissProt
Match: gi|73621294|sp|P14083.2|LOV_DROME (RecName: Full=Protein jim lovell; AltName: Full=Protein TKR; AltName: Full=Tyrosine kinase-related; Short=dTKR)

HSP 1 Score: 100.138 bits (248), Expect = 9.563e-21
Identity = 44/118 (37.29%), Postives = 73/118 (61.86%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            + Y L+W+ ++ +IL AF  LL+++TL DVTL C   + +AH++VL+ACS  F+ +F+  P   P      ++L   R   +Q ++ FMYRGE  +   R+ ++++  E LQV+GL E
Sbjct:  113 DHYSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPV-----IVLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVE 225          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: XP_006557561.1 (PREDICTED: protein abrupt isoform X1 [Apis mellifera])

HSP 1 Score: 139.428 bits (350), Expect = 1.525e-34
Identity = 70/149 (46.98%), Postives = 95/149 (63.76%), Query Frame = 0
Query:    2 DDDWEYVSRNNRESTATFSVVEGRDRMRKMGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            D + +Y+    R+       VE R  +     +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS
Sbjct:   35 DQEGKYLLEGGRDRGGEGHGVEPRGGIMDSHQQQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLS 180          

HSP 2 Score: 110.923 bits (276), Expect = 6.909e-25
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            G KL+CP CE+ YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+
Sbjct:  481 GKKLKCPDCEKLYGYETNLRAHIRQRHQGIRVPCPFCQRTFTRNNTVRRHIAREHK 536          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: XP_623488.3 (PREDICTED: protein abrupt isoform X2 [Apis mellifera])

HSP 1 Score: 136.732 bits (343), Expect = 8.698e-34
Identity = 64/117 (54.70%), Postives = 84/117 (71.79%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS
Sbjct:    6 QQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLS 119          

HSP 2 Score: 110.923 bits (276), Expect = 4.090e-25
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            G KL+CP CE+ YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+
Sbjct:  420 GKKLKCPDCEKLYGYETNLRAHIRQRHQGIRVPCPFCQRTFTRNNTVRRHIAREHK 475          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: XP_006557563.1 (PREDICTED: protein abrupt isoform X2 [Apis mellifera])

HSP 1 Score: 136.732 bits (343), Expect = 8.698e-34
Identity = 64/117 (54.70%), Postives = 84/117 (71.79%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS
Sbjct:    6 QQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLS 119          

HSP 2 Score: 110.923 bits (276), Expect = 4.090e-25
Identity = 46/56 (82.14%), Postives = 51/56 (91.07%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            G KL+CP CE+ YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+
Sbjct:  420 GKKLKCPDCEKLYGYETNLRAHIRQRHQGIRVPCPFCQRTFTRNNTVRRHIAREHK 475          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: EEB17412.1 (zinc finger protein and BTB domain-containing protein, putative [Pediculus humanus corporis])

HSP 1 Score: 135.191 bits (339), Expect = 1.824e-33
Identity = 68/147 (46.26%), Postives = 95/147 (64.63%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINS 180
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAH+L+LAACS HF+ LF  AP +        VILDGT + ++  LL FMY+GE ++  + ++S LK AE LQVKGLS     IE     M     S+ +   SP++S
Sbjct:    5 QQFCLKWNSFGSNLATAFGNLFKSESLADVTLFCEGVTFKAHKLILAACSKHFQDLFEGAPFSP----SVLVILDGTSSSNMSALLEFMYKGEVHVSQEHLSSFLKAAECLQVKGLS-----IEHEKLAMVHTQHSSPTSHESPLDS 142          

HSP 2 Score: 119.398 bits (298), Expect = 4.248e-28
Identity = 62/102 (60.78%), Postives = 71/102 (69.61%), Query Frame = 0
Query:  449 PIPVTLAQGFSASDYVR-LASHVRDPENGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR-HLSL-VFSQTSLEIH 547
            P  V +   + AS  V+ L+SH        G KL+CPFCER YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+  LSL  F Q  +  H
Sbjct:  368 PDIVQVGSMWDASSAVKPLSSH-------KGKKLKCPFCERLYGYETNLRAHIRQRHQGIRVPCPFCSRTFTRNNTVRRHIAREHKTELSLKAFQQNQVHNH 462          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: gb|KFM58812.1| (Protein bric-a-brac 2, partial [Stegodyphus mimosarum])

HSP 1 Score: 128.642 bits (322), Expect = 6.415e-32
Identity = 58/119 (48.74%), Postives = 83/119 (69.75%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            S+++ LKW+ + TN+L+ F G   SETL DVTL CEG+  KAH+LVL+ACS +F++LFS  P   P      VI++G R  D++ +L FMY+GE  + HD +++ LK AE L+VKGL+E
Sbjct:    2 SQQFCLKWNSHTTNLLSVFKGFQSSETLVDVTLSCEGRNMKAHKLVLSACSPYFQNLFSENPCKHP-----IVIINGMRFTDIKAILDFMYKGEVNVSHDELSAFLKAAEALKVKGLTE 115          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: gb|KYB27564.1| (hypothetical protein TcasGA2_TC033042 [Tribolium castaneum])

HSP 1 Score: 132.88 bits (333), Expect = 8.521e-32
Identity = 61/130 (46.92%), Postives = 86/130 (66.15%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNM 163
            +++ LKW+ + TN+ T+F  L +SETL+DVTLFC+G TFKAH+L+LAACS H   LF      +P +    +ILDGT A ++  LL FMY+GE ++  D ++S LK AE LQVKGLS     + +   +M
Sbjct:  114 QQFCLKWNSFGTNLATSFSNLFKSETLADVTLFCDGVTFKAHKLILAACSKHLADLFE----TSPPHQNLIIILDGTSASNMSALLEFMYKGEVHVSQDCLSSFLKAAECLQVKGLSIEHEKLAVAQSHM 239          

HSP 2 Score: 116.316 bits (290), Expect = 1.981e-26
Identity = 51/61 (83.61%), Postives = 55/61 (90.16%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR-HLSL 537
            G KL+CPFCER YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+  LSL
Sbjct:  460 GKKLKCPFCERLYGYETNLRAHIRQRHQGIRVPCPFCSRTFTRNNTVRRHIAREHKAELSL 520          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: gb|KFM71876.1| (Protein bric-a-brac 1, partial [Stegodyphus mimosarum])

HSP 1 Score: 125.176 bits (313), Expect = 1.659e-30
Identity = 56/119 (47.06%), Postives = 81/119 (68.07%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            S+++ LKW+ + TN+L  F  LL +E L DVTL C+G + KAH++VL+ACS  F+SLF   P   P      VI+   R  DL+ ++ FMYRGE  + HD+++++LKTAE L+VKGL+E
Sbjct:    2 SQQFCLKWNNHTTNMLQVFENLLSTEALVDVTLACDGLSLKAHKMVLSACSPFFQSLFLENPCKHP-----IVIMKDMRYSDLKAIIDFMYRGEVNVSHDQLSALLKTAETLKVKGLAE 115          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: gb|EEC14389.1| (zinc finger protein, putative [Ixodes scapularis])

HSP 1 Score: 126.331 bits (316), Expect = 1.885e-30
Identity = 57/121 (47.11%), Postives = 83/121 (68.60%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            MGS+++ LKW+ +++N+L  F  LL +E L DVTL CEG + KAHR+VL+ACS  F++LF   P   P      VIL   R  DL+ ++ FMY+GE  +  D+++++LKTAE L+VKGL+E
Sbjct:    1 MGSQQFCLKWNNHQSNMLVVFEQLLSNEALVDVTLACEGHSLKAHRMVLSACSPFFQALFVENPCQHP-----IVILKDMRYMDLKAIVEFMYKGEVNVSQDQLSALLKTAEALKVKGLAE 116          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: ADV36931.1 (chronologically inappropriate morphogenesis, isoform E [Drosophila melanogaster])

HSP 1 Score: 126.331 bits (316), Expect = 1.235e-29
Identity = 58/136 (42.65%), Postives = 82/136 (60.29%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXAS 169
            +++ LKW+ + +N+   F  L +S+ L+DV L C+G  FKAH+L+LAACS  F  LF     N PTN Q  +IL+ T  D++  LL FMY+GE ++  + +NS LK+AE LQVKGLS     +       HM   S
Sbjct:    5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFE----NTPTNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHMGDLS 136          

HSP 2 Score: 113.235 bits (282), Expect = 2.182e-25
Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            G KL+C +C+R YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+ 
Sbjct:  514 GKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQ 570          
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Match: AAF51351.3 (chronologically inappropriate morphogenesis, isoform F [Drosophila melanogaster])

HSP 1 Score: 126.331 bits (316), Expect = 1.235e-29
Identity = 58/136 (42.65%), Postives = 82/136 (60.29%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXAS 169
            +++ LKW+ + +N+   F  L +S+ L+DV L C+G  FKAH+L+LAACS  F  LF     N PTN Q  +IL+ T  D++  LL FMY+GE ++  + +NS LK+AE LQVKGLS     +       HM   S
Sbjct:    5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFE----NTPTNGQCVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGLSTETGRLAAQQAQQHMGDLS 136          

HSP 2 Score: 113.235 bits (282), Expect = 2.182e-25
Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH 534
            G KL+C +C+R YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+ 
Sbjct:  514 GKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQ 570          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|755966584|ref|XP_011305548.1| (PREDICTED: transcription regulator protein BACH2 isoform X2 [Fopius arisanus] >gi|755966587|ref|XP_011305549.1| PREDICTED: transcription regulator protein BACH2 isoform X2 [Fopius arisanus] >gi|755966590|ref|XP_011305550.1| PREDICTED: transcription regulator protein BACH2 isoform X2 [Fopius arisanus])

HSP 1 Score: 144.821 bits (364), Expect = 2.573e-34
Identity = 78/182 (42.86%), Postives = 112/182 (61.54%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYY 215
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS     + + ++  H+A  + SS   +  N+  +   P  + K+    +  P  SP P + +PN Y
Sbjct:    6 QQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLSIEHEKLAVAHR--HVAENNNSSAESASGNTEVLEAEPDRIMKR----EPTPAPSPAPNYVAPNIY 178          

HSP 2 Score: 117.857 bits (294), Expect = 5.703e-25
Identity = 51/67 (76.12%), Postives = 60/67 (89.55%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH-LSLVFSQTS 543
            G KL+CPFC+R YGYETNLRAH+RQRHQGIRVSCP+C RTFTRNNTVRRH+AREH++ +S+   QTS
Sbjct:  367 GKKLKCPFCDRLYGYETNLRAHVRQRHQGIRVSCPFCSRTFTRNNTVRRHIAREHKNEMSIKAFQTS 433          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|755966581|ref|XP_011305547.1| (PREDICTED: transcription regulator protein BACH2 isoform X1 [Fopius arisanus])

HSP 1 Score: 144.821 bits (364), Expect = 6.023e-34
Identity = 78/182 (42.86%), Postives = 112/182 (61.54%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYY 215
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS     + + ++  H+A  + SS   +  N+  +   P  + K+    +  P  SP P + +PN Y
Sbjct:   65 QQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLSIEHEKLAVAHR--HVAENNNSSAESASGNTEVLEAEPDRIMKR----EPTPAPSPAPNYVAPNIY 237          

HSP 2 Score: 118.242 bits (295), Expect = 7.577e-25
Identity = 51/67 (76.12%), Postives = 60/67 (89.55%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH-LSLVFSQTS 543
            G KL+CPFC+R YGYETNLRAH+RQRHQGIRVSCP+C RTFTRNNTVRRH+AREH++ +S+   QTS
Sbjct:  426 GKKLKCPFCDRLYGYETNLRAHVRQRHQGIRVSCPFCSRTFTRNNTVRRHIAREHKNEMSIKAFQTS 492          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|1058073346|gb|JAS40334.1| (hypothetical protein g.23533, partial [Cuerna arida])

HSP 1 Score: 137.887 bits (346), Expect = 6.320e-33
Identity = 61/117 (52.14%), Postives = 88/117 (75.21%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N+++AF  L +SE+L+DVTLFCEG TFKAH+++LAACS HF+ LF  AP + P+     VILDGT + ++  LL FMY+GE ++ H+ ++S LK AE LQVKGLS
Sbjct:   25 QQFCLKWNSFGSNLVSAFDNLFKSESLTDVTLFCEGVTFKAHKIILAACSKHFQDLFEAAP-HCPS---VLVILDGTSSTNMSALLEFMYKGEVHVKHESLSSFLKAAECLQVKGLS 137          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|970897024|ref|XP_015114047.1| (PREDICTED: uncharacterized protein LOC107039100 [Diachasma alloeum])

HSP 1 Score: 140.969 bits (354), Expect = 1.088e-32
Identity = 78/182 (42.86%), Postives = 112/182 (61.54%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPNYY 215
            +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + ++S LK AE LQVKGLS     + + ++  H+A  + SS   +   SG + +      +  +R+ +P    P P + SPN Y
Sbjct:   64 QQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAHNMASLLEFMYRGEVHVSQESLSSFLKAAECLQVKGLSIEHEKLAVAHR--HVAENNNSSTESA---SGNIEVLESDAERVMKREPTPAPTLP-PNYVSPNTY 236          

HSP 2 Score: 118.242 bits (295), Expect = 7.115e-25
Identity = 51/67 (76.12%), Postives = 60/67 (89.55%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRH-LSLVFSQTS 543
            G KL+CPFC+R YGYETNLRAH+RQRHQGIRVSCP+C RTFTRNNTVRRH+AREH++ +S+   QTS
Sbjct:  421 GKKLKCPFCDRLYGYETNLRAHVRQRHQGIRVSCPFCSRTFTRNNTVRRHIAREHKNEMSIKAFQTS 487          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|1058129263|gb|JAS68280.1| (hypothetical protein g.23535, partial [Cuerna arida])

HSP 1 Score: 138.658 bits (348), Expect = 1.426e-32
Identity = 61/117 (52.14%), Postives = 88/117 (75.21%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N+++AF  L +SE+L+DVTLFCEG TFKAH+++LAACS HF+ LF  AP + P+     VILDGT + ++  LL FMY+GE ++ H+ ++S LK AE LQVKGLS
Sbjct:   25 QQFCLKWNSFGSNLVSAFDNLFKSESLTDVTLFCEGVTFKAHKIILAACSKHFQDLFEAAP-HCPS---VLVILDGTSSTNMSALLEFMYKGEVHVKHESLSSFLKAAECLQVKGLS 137          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|985414467|ref|XP_015372661.1| (PREDICTED: protein tramtrack, beta isoform [Diuraphis noxia])

HSP 1 Score: 138.658 bits (348), Expect = 1.770e-32
Identity = 60/117 (51.28%), Postives = 87/117 (74.36%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N++TAF  L +SE+L+DV+LFCEG+TFKAH+L+LAACS HF+ +F   P+ +       VILDGT + ++  LL FMYRGE  +  +R++S LKTA+ LQVKGLS
Sbjct:    5 QQFCLKWNSFSSNLVTAFDNLFKSESLTDVSLFCEGKTFKAHKLILAACSKHFQEIFEATPLGS----SLIVILDGTSSTNMASLLEFMYRGEVQISQERLSSFLKTADNLQVKGLS 117          

HSP 2 Score: 94.3597 bits (233), Expect = 3.723e-17
Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 0
Query:  490 YGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+
Sbjct:  345 YGYETNLRAHIRQRHQGIRVPCPFCARTFTRNNTVRRHIAREHK 388          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|328703811|ref|XP_003242312.1| (PREDICTED: protein tramtrack, alpha isoform [Acyrthosiphon pisum])

HSP 1 Score: 138.658 bits (348), Expect = 1.897e-32
Identity = 60/117 (51.28%), Postives = 87/117 (74.36%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLS 150
            +++ LKW+ + +N++TAF  L +SE+L+DV+LFCEG+TFKAH+L+LAACS HF+ +F   P+ +       VILDGT + ++  LL FMYRGE  +  +R++S LKTA+ LQVKGLS
Sbjct:    5 QQFCLKWNSFSSNLVTAFDNLFKSESLTDVSLFCEGKTFKAHKLILAACSKHFQEIFEATPLGS----SLIVILDGTSSTNMASLLEFMYRGEVQISQERLSSFLKTADNLQVKGLS 117          

HSP 2 Score: 115.161 bits (287), Expect = 3.776e-24
Identity = 47/56 (83.93%), Postives = 52/56 (92.86%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            G KL+CP+CER YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+
Sbjct:  333 GKKLQCPYCERLYGYETNLRAHIRQRHQGIRVPCPFCARTFTRNNTVRRHIAREHK 388          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|1101349728|ref|XP_018900782.1| (PREDICTED: modifier of mdg4 isoform X2 [Bemisia tabaci])

HSP 1 Score: 139.813 bits (351), Expect = 2.053e-32
Identity = 63/131 (48.09%), Postives = 89/131 (67.94%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMH 164
            +++ LKW+ + +N++TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ +F  A +    N    VILDGT + ++  LL FMY+GE ++  ++++S LK AE LQVKGLS     +    Q  H
Sbjct:    5 QQFCLKWNSFGSNLVTAFDSLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQDIFESATLTQGVN--VVVILDGTSSSNMSALLEFMYKGEVHVSQEKLSSFLKAAEALQVKGLSIEHEKLAAAQQEHH 133          

HSP 2 Score: 115.546 bits (288), Expect = 4.078e-24
Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
Query:  478 GTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR-HLSL 537
            G KL+CP+CER YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+  LSL
Sbjct:  384 GKKLQCPYCERLYGYETNLRAHIRQRHQGIRVPCPFCTRTFTRNNTVRRHIAREHKTELSL 444          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|795045944|ref|XP_011868407.1| (PREDICTED: protein abrupt isoform X2 [Vollenhovia emeryi])

HSP 1 Score: 140.584 bits (353), Expect = 2.131e-32
Identity = 71/143 (49.65%), Postives = 92/143 (64.34%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSR 173
            M  +++ LKW+ + +N+ TAF  L +SE+L+DVTLFCEG TFKAH+L+LAACS HF+ LF   P   P+     VILDGT A ++  LL FMYRGE ++  + +NS LK AE LQVKGLS     I  +    H A   TS R
Sbjct:    1 MDHQQFCLKWNSFGSNLATAFSNLFKSESLTDVTLFCEGVTFKAHKLILAACSKHFQELFEGMP---PSPAGLIVILDGTSAQNMASLLEFMYRGEVHVSQESLNSFLKAAECLQVKGLS-----IREHENLAHAATTRTSVR 135          

HSP 2 Score: 119.783 bits (299), Expect = 2.682e-25
Identity = 50/58 (86.21%), Postives = 53/58 (91.38%), Query Frame = 0
Query:  476 GTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR 533
            G GTKL+CP CER YGYETNLRAH+RQRHQGIRV CPYC RTFTRNNTVRRHVAREH+
Sbjct:  425 GGGTKLKCPLCERLYGYETNLRAHVRQRHQGIRVPCPYCTRTFTRNNTVRRHVAREHK 482          
BLAST of EMLSAG00000000011 vs. nr
Match: gi|1101349724|ref|XP_018900780.1| (PREDICTED: modifier of mdg4 isoform X1 [Bemisia tabaci] >gi|1101349726|ref|XP_018900781.1| PREDICTED: modifier of mdg4 isoform X1 [Bemisia tabaci])

HSP 1 Score: 139.428 bits (350), Expect = 2.414e-32
Identity = 63/131 (48.09%), Postives = 89/131 (67.94%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMH 164
            +++ LKW+ + +N++TAF  L +SE+L+DVTLFCEG TFKAHRL+LAACS HF+ +F  A +    N    VILDGT + ++  LL FMY+GE ++  ++++S LK AE LQVKGLS     +    Q  H
Sbjct:    5 QQFCLKWNSFGSNLVTAFDSLFKSESLTDVTLFCEGVTFKAHRLILAACSKHFQDIFESATLTQGVN--VVVILDGTSSSNMSALLEFMYKGEVHVSQEKLSSFLKAAEALQVKGLSIEHEKLAAAQQEHH 133          

HSP 2 Score: 117.857 bits (294), Expect = 8.427e-25
Identity = 51/66 (77.27%), Postives = 57/66 (86.36%), Query Frame = 0
Query:  473 PENGTGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHR-HLSL 537
            P+   G KL+CP+CER YGYETNLRAHIRQRHQGIRV CP+C RTFTRNNTVRRH+AREH+  LSL
Sbjct:  382 PDGKLGKKLQCPYCERLYGYETNLRAHIRQRHQGIRVPCPFCTRTFTRNNTVRRHIAREHKTELSL 447          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold571_size134521-processed-gene-0.4 (protein:Tk11007 transcript:snap_masked-scaffold571_size134521-processed-gene-0.4-mRNA-1 annotation:"protein alpha isoform")

HSP 1 Score: 430.254 bits (1105), Expect = 7.327e-145
Identity = 291/578 (50.35%), Postives = 341/578 (59.00%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAP-TNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHMAXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTRSPIPEHSSPN--------------YYP-----REQFPMYRLPTFAGXPVEAVAAAAXAAAAASSGSNNLPSSSSPFNHKASPS---------PCGGGERYSKMIRGGSASPHRP--PSVS----KREEEDDH--YVRSSPMIRP--SSNKAEDYEDVPPPPRGMGNSSSPQ-----PPVSGLSKHQSFPSDSTTTELNSGPSGLLSRAYK----ERLRRESE---HCEPESNTNNDDLTHQTKFP-DFRNSREEISRLNDITPPRNPSGLN-------DEDVR-XXANNLETFRRLAQQHARTLPIPV-------TLAQGFSASDYVRLASHVRDPENG-----TGTKLRCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVAREHRHLS 536
            MGSEKYKLKWSKYE+NIL+AFH LLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFS    +AP T +QFFV+LDGTRADDLQILLHFMYRGEAYLH DRINSVL+TAE LQVKGLSEGPRNIE+NNQN H   +  + R WSP+   G         KK E D+    R  +  H SP+              YY      RE FPMY             + A    +  + G  +      P +    P+         P     RYS M + GS  PH P  PS S     ++E D     V S+P I    S ++  D E    PP    ++ SP      P +S   +   FPSDSTT +  +GPSGL   A+K     RLRR S+   + E E+     D  ++ KFP +F N+RE+I+RL     P +P G N       DE  R   A +LE FRRLAQ     +P  V        L  G +ASDY+R A  VRDP+NG     +GTKL+CPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHV REHRHL+
Sbjct:    1 MGSEKYKLKWSKYESNILSAFHSLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSQTSASAPPTTSQFFVVLDGTRADDLQILLHFMYRGEAYLHQDRINSVLRTAEALQVKGLSEGPRNIELNNQNAH--GSGNNGRSWSPLPPFGGGNDANKRLKKNEMDEPAHLRD-MRHHGSPSPNLHSSGGGISPSSYYAPPPITREPFPMY-------------SGALRNMSTYTRGVRDEHPQHPPAHFTPPPANRSKSPGPPPPPQQGRYS-MDKFGSP-PHGPSLPSSSVDLPAKDERDSTPISVMSAPEIYEGRSISRGHDSER---PPSNKTDTHSPDYERQTPTMSSPLQKTGFPSDSTT-DTAAGPSGLPRTAFKTEDHHRLRRSSDPGLNNEAEAGRATPDDHNRPKFPPNFSNAREDIARLT----PSSPQGRNNDLRMMEDEAARNQAATSLEQFRRLAQAQEHLMPRRVHQTSGLSALVPGLTASDYMRFAMPVRDPDNGDAISGSGTKLKCPFCERTYGYETNLRAHIRQRHQGIRVSCPYCPRTFTRNNTVRRHVQREHRHLA 552          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold202_size261857-snap-gene-1.21 (protein:Tk10171 transcript:maker-scaffold202_size261857-snap-gene-1.21-mRNA-1 annotation:"broad-complex core protein partial")

HSP 1 Score: 107.842 bits (268), Expect = 2.668e-26
Identity = 53/133 (39.85%), Postives = 85/133 (63.91%), Query Frame = 0
Query:   31 MGSEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNM 163
            M +E + LKW+ Y+TNI++A   L   E   DVTL CEG+  KAH+++L+ACS +F+ +F   P + P      VIL      D++ L+ ++YRGE  +  +R+ S LKTAEVL++KGL++  +N+  +N+ +
Sbjct:   23 MPNEHFCLKWNNYQTNIVSALGNLKLDEDFVDVTLSCEGRQIKAHKVILSACSDYFKEVFKDNPCSHPV-----VILRDAAFADVEGLVRYVYRGEVDVQPERLQSFLKTAEVLRIKGLAD--QNLSSSNEGI 148          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold170_size291898-snap-gene-1.57 (protein:Tk03033 transcript:maker-scaffold170_size291898-snap-gene-1.57-mRNA-1 annotation:"longitudinals lacking isoform g")

HSP 1 Score: 112.079 bits (279), Expect = 4.413e-26
Identity = 49/118 (41.53%), Postives = 78/118 (66.10%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++Y L+W+ + T +++ F  L  S +L DVTL  EG+  +AH++VL+ACS +F+SLFS  P   P      VIL   + +DL+ ++ FMY+G   +  D+I+ V+KTA++LQ+KGL E
Sbjct:   46 QRYNLQWNDHSTQMVSVFANLFNSVSLVDVTLAAEGKHIQAHKMVLSACSDYFQSLFSATPTQHP-----IVILKDVQFEDLKTIVQFMYQGSVEVSSDKISDVIKTADMLQIKGLGE 158          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold922_size80897-snap-gene-0.25 (protein:Tk09261 transcript:maker-scaffold922_size80897-snap-gene-0.25-mRNA-1 annotation:"GL23993")

HSP 1 Score: 109.383 bits (272), Expect = 1.752e-25
Identity = 49/118 (41.53%), Postives = 77/118 (65.25%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++Y L+W+ ++ N+L+ F  LL SE   DVTL CEG   KAH++VL+ACS +F+++  + P   P      V L   R ++++ LL FMYRGE  +  + ++S+LK AE L++KGL+E
Sbjct:    9 QQYCLRWNNHQHNLLSVFEDLLNSEAFVDVTLACEGLQLKAHKMVLSACSPYFQAMLYNTPDRHP-----IVFLRDVRYEEMKALLEFMYRGEVSVDQENLSSLLKVAEGLKIKGLAE 121          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold380_size190731-processed-gene-0.7 (protein:Tk02442 transcript:snap_masked-scaffold380_size190731-processed-gene-0.7-mRNA-1 annotation:"hypothetical protein YQE_10194 partial")

HSP 1 Score: 109.768 bits (273), Expect = 2.311e-25
Identity = 51/119 (42.86%), Postives = 76/119 (63.87%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            S+ Y LKW+ Y+TN+ + F  LL++E   DVTL  EGQ  K H++VL+ACS +F+SL +  P   P      VIL     +DL+ ++ +MY+GE  + +D + SVLK+AE L ++GL E
Sbjct:   75 SQHYCLKWNNYQTNLTSVFDQLLQTEAFVDVTLTSEGQVIKCHKVVLSACSPYFQSLLADNPSQHP-----IVILRDITWNDLKYIVEYMYKGEINVSYDELPSVLKSAEALNIRGLVE 188          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold199_size265817-processed-gene-1.0 (protein:Tk08934 transcript:snap_masked-scaffold199_size265817-processed-gene-1.0-mRNA-1 annotation:"protein alpha isoform")

HSP 1 Score: 107.842 bits (268), Expect = 4.412e-25
Identity = 51/118 (43.22%), Postives = 78/118 (66.10%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSE 151
            ++Y LKW+ ++ N+L  F  LL SE   DV +  EGQT +AH++VL+ACS++FE++F     N  +     +IL  T+  D+Q L+ FMY+GE  +   ++ S+LKTAE LQVKGL++
Sbjct:   25 QQYCLKWNNHQANLLRVFDRLLGSEQFCDVLVAAEGQTLRAHKVVLSACSSYFETIF-----NEFSEKNQVIILKDTKFTDVQALVQFMYKGEINVPQHQLGSLLKTAENLQVKGLAD 137          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold97_size377342-snap-gene-2.14 (protein:Tk12118 transcript:maker-scaffold97_size377342-snap-gene-2.14-mRNA-1 annotation:"protein abrupt-like isoform x1")

HSP 1 Score: 105.916 bits (263), Expect = 3.263e-24
Identity = 62/175 (35.43%), Postives = 89/175 (50.86%), Query Frame = 0
Query:   34 EKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEINNQNMHM-----AXASTSSRXWSPINSGGVPISPPLMRKKRERDDSPPTR 203
            E Y L+W+ Y  +++ +F  L E E   DVTL C  + F AH++VL+ACS +F  L    P   P      +IL     +DL+ LL FMY GE  +  DR+   L+TAE LQ++GL++G    E   +N+ M          +    SP N G  P +P     KR R + P +R
Sbjct:   24 EHYSLRWNDYAQSVVASFRSLKEEEDFVDVTLACNSKQFTAHKVVLSACSPYFRQLLKTNPCQHP-----IIILRDITEEDLKSLLKFMYNGEVRIPEDRMKEFLRTAETLQIRGLTDGGVTREPVGKNIPMTNSVRGNVDLNGASMSPDNFG--PSAP-----KRHRFNGPESR 186          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold117_size339417-snap-gene-0.11 (protein:Tk06383 transcript:maker-scaffold117_size339417-snap-gene-0.11-mRNA-1 annotation:"PREDICTED: uncharacterized protein LOC100882374")

HSP 1 Score: 103.219 bits (256), Expect = 2.451e-23
Identity = 46/127 (36.22%), Postives = 77/127 (60.63%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFCEGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPRNIEIN 159
            S+ + L+W+ + +N+L  F  LL++E   DVTL C+G + K H+++L+ACS++F+ LF       P      V L   +  D++ +L +MY+GE  +  + + S+LK AE+L+VKGL E  R   +N
Sbjct:   10 SQVFCLRWNNHRSNLLNVFDLLLQTEAFCDVTLACDGASVKCHKIILSACSSYFQQLFMENNCEHP-----IVFLKDIKYSDIRSILAYMYKGEVNVQQEELPSLLKVAELLKVKGLVEEEREKLLN 131          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold676_size113663-processed-gene-0.7 (protein:Tk06493 transcript:snap_masked-scaffold676_size113663-processed-gene-0.7-mRNA-1 annotation:"tpa_inf: btb poz and kelch domain-containing protein")

HSP 1 Score: 100.523 bits (249), Expect = 1.505e-22
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFC-EGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPR 154
            S+++ LKW+ +  N L++F  LL++ TL DVTL C  G+T  AHR+VLAACS +F  LF   P   P      ++      + ++ LL FMY+GE  +    +N  LK A+ LQVKGLS+  R
Sbjct:    4 SQQFHLKWNNHSLNTLSSFQQLLDTNTLVDVTLTCSNGKTVTAHRMVLAACSEYFYRLFKELPEKHPV-----IVFKDAGEEIVRDLLLFMYKGEVEVQESYLNDFLKFADTLQVKGLSQSDR 121          
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold676_size113663-processed-gene-0.3 (protein:Tk06492 transcript:snap_masked-scaffold676_size113663-processed-gene-0.3-mRNA-1 annotation:"GD25965")

HSP 1 Score: 100.523 bits (249), Expect = 1.505e-22
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 0
Query:   33 SEKYKLKWSKYETNILTAFHGLLESETLSDVTLFC-EGQTFKAHRLVLAACSTHFESLFSHAPINAPTNNQFFVILDGTRADDLQILLHFMYRGEAYLHHDRINSVLKTAEVLQVKGLSEGPR 154
            S+++ LKW+ +  N L++F  LL++ TL DVTL C  G+T  AHR+VLAACS +F  LF   P   P      ++      + ++ LL FMY+GE  +    +N  LK A+ LQVKGLS+  R
Sbjct:    4 SQQFHLKWNNHSLNTLSSFQQLLDTNTLVDVTLTCSNGKTVTAHRMVLAACSEYFYRLFKELPEKHPV-----IVFKDAGEEIVRDLLLFMYKGEVEVQESYLNDFLKFADTLQVKGLSQSDR 121          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000011 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-3.228e-2942.65symbol:chinmo "Chronologically inappropriate morph... [more]
-2.056e-2543.44symbol:ttk "tramtrack" species:7227 "Drosophila me... [more]
-3.972e-2541.53symbol:bab2 "bric a brac 2" species:7227 "Drosophi... [more]
-7.818e-2541.13symbol:lolal "lola like" species:7227 "Drosophila ... [more]
-1.326e-2439.83symbol:bab1 "bric a brac 1" species:7227 "Drosophi... [more]
-2.085e-2338.40symbol:BtbVII "BTB-protein-VII" species:7227 "Dros... [more]
-3.418e-2241.38symbol:ab "abrupt" species:7227 "Drosophila melano... [more]
-7.320e-2240.34symbol:br "broad" species:7227 "Drosophila melanog... [more]
-1.310e-2037.29symbol:lov "jim lovell" species:7227 "Drosophila m... [more]
-1.321e-2038.84symbol:CG3726 species:7227 "Drosophila melanogaste... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592762759|gb|GAXK01191654.1|1.305e-4971.54TSA: Calanus finmarchicus comp41427_c0_seq2 transc... [more]
gi|592762760|gb|GAXK01191653.1|1.536e-4971.54TSA: Calanus finmarchicus comp41427_c0_seq1 transc... [more]
gi|592762757|gb|GAXK01191656.1|2.555e-3460.68TSA: Calanus finmarchicus comp41427_c0_seq4 transc... [more]
gi|592762758|gb|GAXK01191655.1|2.757e-3460.68TSA: Calanus finmarchicus comp41427_c0_seq3 transc... [more]
gi|592858476|gb|GAXK01099086.1|4.772e-2844.35TSA: Calanus finmarchicus comp238511_c0_seq1 trans... [more]
gi|592903314|gb|GAXK01055061.1|7.683e-2744.72TSA: Calanus finmarchicus comp84534_c2_seq1 transc... [more]
gi|592787700|gb|GAXK01166868.1|4.840e-2637.59TSA: Calanus finmarchicus comp1193_c26_seq242 tran... [more]
gi|592787874|gb|GAXK01166694.1|5.580e-2537.59TSA: Calanus finmarchicus comp1193_c26_seq68 trans... [more]
gi|592787888|gb|GAXK01166680.1|1.065e-2437.59TSA: Calanus finmarchicus comp1193_c26_seq54 trans... [more]
gi|592910523|gb|GAXK01047852.1|1.188e-2440.48TSA: Calanus finmarchicus comp74949_c0_seq5 transc... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000000110.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:8080... [more]
EMLSAP000000068272.526e-2842.98pep:novel supercontig:LSalAtl2s:LSalAtl2s385:12269... [more]
EMLSAP000000095418.130e-2746.61pep:novel supercontig:LSalAtl2s:LSalAtl2s613:57802... [more]
EMLSAP000000015481.998e-2639.52pep:novel supercontig:LSalAtl2s:LSalAtl2s126:20964... [more]
EMLSAP000000111195.264e-2442.74pep:novel supercontig:LSalAtl2s:LSalAtl2s753:17269... [more]
EMLSAP000000024552.441e-2340.68pep:novel supercontig:LSalAtl2s:LSalAtl2s1471:5217... [more]
EMLSAP000000074812.774e-2239.02pep:novel supercontig:LSalAtl2s:LSalAtl2s42:537429... [more]
EMLSAP000000087702.618e-2139.52pep:novel supercontig:LSalAtl2s:LSalAtl2s543:27459... [more]
EMLSAP000000030383.231e-2134.17pep:novel supercontig:LSalAtl2s:LSalAtl2s1728:2209... [more]
EMLSAP000000102527.386e-2033.33pep:novel supercontig:LSalAtl2s:LSalAtl2s67:813352... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|75027304|sp|Q9VQ30.3|CHNMO_DROME2.834e-2942.65RecName: Full=Zinc finger protein chinmo; AltName:... [more]
gi|20455517|sp|P17789.2|TTKB_DROME1.290e-2543.44RecName: Full=Protein tramtrack, beta isoform; Alt... [more]
gi|47117851|sp|P42282.3|TTKA_DROME1.545e-2543.44RecName: Full=Protein tramtrack, alpha isoform; Al... [more]
gi|73621174|sp|Q7KRI2.1|LOLAL_DROME1.774e-2541.13RecName: Full=Longitudinals lacking protein-like; ... [more]
gi|29428067|sp|Q9W0K4.2|BAB2_DROME2.999e-2541.53RecName: Full=Protein bric-a-brac 2[more]
gi|29428068|sp|Q9W0K7.2|BAB1_DROME9.901e-2539.83RecName: Full=Protein bric-a-brac 1[more]
gi|27923726|sp|Q24174.2|ABRU_DROME2.487e-2241.38RecName: Full=Protein abrupt; AltName: Full=Protei... [more]
gi|13124701|sp|Q01295.2|BRC1_DROME2.869e-2240.34RecName: Full=Broad-complex core protein isoforms ... [more]
gi|13123979|sp|Q24206.2|BRC4_DROME5.322e-2240.34RecName: Full=Broad-complex core protein isoform 6[more]
gi|73621294|sp|P14083.2|LOV_DROME9.563e-2137.29RecName: Full=Protein jim lovell; AltName: Full=Pr... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
XP_006557561.11.525e-3446.98PREDICTED: protein abrupt isoform X1 [Apis mellife... [more]
XP_623488.38.698e-3454.70PREDICTED: protein abrupt isoform X2 [Apis mellife... [more]
XP_006557563.18.698e-3454.70PREDICTED: protein abrupt isoform X2 [Apis mellife... [more]
EEB17412.11.824e-3346.26zinc finger protein and BTB domain-containing prot... [more]
gb|KFM58812.1|6.415e-3248.74Protein bric-a-brac 2, partial [Stegodyphus mimosa... [more]
gb|KYB27564.1|8.521e-3246.92hypothetical protein TcasGA2_TC033042 [Tribolium c... [more]
gb|KFM71876.1|1.659e-3047.06Protein bric-a-brac 1, partial [Stegodyphus mimosa... [more]
gb|EEC14389.1|1.885e-3047.11zinc finger protein, putative [Ixodes scapularis][more]
ADV36931.11.235e-2942.65chronologically inappropriate morphogenesis, isofo... [more]
AAF51351.31.235e-2942.65chronologically inappropriate morphogenesis, isofo... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|755966584|ref|XP_011305548.1|2.573e-3442.86PREDICTED: transcription regulator protein BACH2 i... [more]
gi|755966581|ref|XP_011305547.1|6.023e-3442.86PREDICTED: transcription regulator protein BACH2 i... [more]
gi|1058073346|gb|JAS40334.1|6.320e-3352.14hypothetical protein g.23533, partial [Cuerna arid... [more]
gi|970897024|ref|XP_015114047.1|1.088e-3242.86PREDICTED: uncharacterized protein LOC107039100 [D... [more]
gi|1058129263|gb|JAS68280.1|1.426e-3252.14hypothetical protein g.23535, partial [Cuerna arid... [more]
gi|985414467|ref|XP_015372661.1|1.770e-3251.28PREDICTED: protein tramtrack, beta isoform [Diurap... [more]
gi|328703811|ref|XP_003242312.1|1.897e-3251.28PREDICTED: protein tramtrack, alpha isoform [Acyrt... [more]
gi|1101349728|ref|XP_018900782.1|2.053e-3248.09PREDICTED: modifier of mdg4 isoform X2 [Bemisia ta... [more]
gi|795045944|ref|XP_011868407.1|2.131e-3249.65PREDICTED: protein abrupt isoform X2 [Vollenhovia ... [more]
gi|1101349724|ref|XP_018900780.1|2.414e-3248.09PREDICTED: modifier of mdg4 isoform X1 [Bemisia ta... [more]

Pages

back to top
BLAST of EMLSAG00000000011 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold571_size134521-processed-gene-0.47.327e-14550.35protein:Tk11007 transcript:snap_masked-scaffold571... [more]
maker-scaffold202_size261857-snap-gene-1.212.668e-2639.85protein:Tk10171 transcript:maker-scaffold202_size2... [more]
maker-scaffold170_size291898-snap-gene-1.574.413e-2641.53protein:Tk03033 transcript:maker-scaffold170_size2... [more]
maker-scaffold922_size80897-snap-gene-0.251.752e-2541.53protein:Tk09261 transcript:maker-scaffold922_size8... [more]
snap_masked-scaffold380_size190731-processed-gene-0.72.311e-2542.86protein:Tk02442 transcript:snap_masked-scaffold380... [more]
snap_masked-scaffold199_size265817-processed-gene-1.04.412e-2543.22protein:Tk08934 transcript:snap_masked-scaffold199... [more]
maker-scaffold97_size377342-snap-gene-2.143.263e-2435.43protein:Tk12118 transcript:maker-scaffold97_size37... [more]
maker-scaffold117_size339417-snap-gene-0.112.451e-2336.22protein:Tk06383 transcript:maker-scaffold117_size3... [more]
snap_masked-scaffold676_size113663-processed-gene-0.71.505e-2241.46protein:Tk06493 transcript:snap_masked-scaffold676... [more]
snap_masked-scaffold676_size113663-processed-gene-0.31.505e-2241.46protein:Tk06492 transcript:snap_masked-scaffold676... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:80801..91923 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteZinc finger protein chinmo
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1003-snap-gene-1.13
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000011 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000011EMLSAT00000000011-695858Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:80801..91923-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000011-682777 ID=EMLSAG00000000011-682777|Name=EMLSAG00000000011|organism=Lepeophtheirus salmonis|type=gene|length=11123bp|location=Sequence derived from alignment at LSalAtl2s1003:80801..91923- (Lepeophtheirus salmonis)
ATGGATGACGACTGGGAATATGTTTCACGGAATAATAGGTAAATTCTTTC ACATATTATAACATATTATGAACGATCATGTCACTTATGTTTGTAAATGT GTCCTTGCAGCTTACACCTTTTATTTATTTATCACTCAACCACCCCCCTC CCCACACACAAACATACCTCTTCTGACATTAGGATTCAGATCCATAGTTA TAGCAGTCCTTAGTAACAACAACAGTACTCTTCCTAACTTTCACTTTTTA AAATATAATCATCACAGCTCCCCTTTTCCCAAAAAGAAAAGATTCACCAG TCACCTATGCGTCTGCTACCCCTTTCCCTCTGTACGTTTTTCCTGAGTCC TTCCCCCGTCAAGGATTTATTTCATTTCATAAATACATTTACATTAGGCT GGTATGTTTTTCAACTTTTTTAGAATTTCGATTATGGCCTGCGCAAAATA GTTGTCACATGGTATGAAAATTACCTATACAAAATTGAATTACCCTACGA GGTCATCTTTAGGTCGCACATCTTGTCCAAAGTTTGAAAGGAGACAAAAG TTGTTTTTTTACTTCGTCAATAAATATCAAATTACAGTATCAATCCTTAT TTTACAGAAATTAGTGATGATAYACATTATTRTAGCCTATAAAATGTATT TATAAAGTGTTCCTTTTTTTCTAAAGCTACCCTACGAAGAAAAAAAGAGA GAATAACATAAAATAATTTTGATCCTTCCTTTCTGAAAATGTAAAAATCG AGATGTGCGACCTACAAATGACCCCGAAGGACAAAGATATTTTGCATAGG TCWTTTTCATKCCATTTGACAACTTTTCTGCKCCTACCGTAATCGAAATT CGTAAAAAGTTGAAAATCAAACCACCCTATTGACAATATAATTGTCAATG TGCAAAAATACCTTATTTGTCCATACTTTATTACTTAGACAATCCGCTCA CTACAAAAATCCAGATGACCTAGATTTTATGTACATAGGAAATATCTTGT TATTACTTATTAATCTACATAGATTGTTACCCATTGGTGAGTTCAACGTA AGTAAGTAGGCTCTATAAATTGTACATTGATATCTTGTAACTACCTAACT TAGTGTTGTGTCAGTTTTTATTTATTCGGTACAGTCCTGTCTTAGCAAGG GTCCTTAAGAATGTCGGTCCTTCGGACTCTCAGTACTAAAACTGATTAAA ACAAGAAGAAATAAATTTGAGTGAGGTCATGAAGGACAAAAAATTTTAGG ACTGAACTGGACTGGACCGAGACTGAATTGGACGGAACTGCAGTCTACAG TTATAAATAAGGACGAACATACCATTAACATATTTACACTGACTTATAAG TGACAGAGATCAAATGAAGGATCTAACTATGTAAGGCAACTACAGTTGTT CTACGTCATAGAGTTCTTCCTTCTTCCTCTTTACTCCTCTTATACACACA CCACATTCGATAAATTATTTAATTCAAGTGAAATACATTTATCTGCATGG ACTATATACAGAGAAAGAAAGAAGGAATGAAAAGAAAATACGCATTTAAA AAAAAGTAAATGATATTGCTTTGGTTGTATGTGGCGCCCCCTATGTGTGT AACTAACTTTCCATTAGTGACGTCACACACCTATAAATAAGAAATAAAAA AATGTATCAAGGAATTATTCCTTGGATATTCTATTGCGCTGTTGTTAAGG AGAAGAGGAGGGAAAGAAGAAAAATTATTTCCCCTTCTTTTCTGACAAAA GGGTTGCCTTGCTATTATTGTATTTCTATTATATAATCCATATATGTTGG TTACAAGTTGCAAACAAACAAAAAATGAAGCATTTTTAGTGTTAGATCGG TCTAAAAAGACTAACCTTGTCCTTTCAGCTGTTCAACATAACCTTTTTCA AGAGACAAGATATCTTAAGTTTATAGTAGGACGTGTGTTAACTTATTTTT ATACTAGCTATCATGTATAATTTTTTGTATTCCTAAGAGTGAAGAATATC TAAAAAGATAGCTAAGACTGAAGGACTGAGGTATTGGACCTTAAGACCGT TGAATGGTAAATAAAGATCGGACCGATATAAAAAGGGGGTGGGGGAGGGG GAGAGACTGATTAGGCAATCAGTCCTAGGATAGATCCAAGACTAGGCCTT TAATTGAAAGATTTACAGTACTTGGGATGCGGAACATGCAATTATTGAAT ATTCCATAAATGATCCAAAAATTGATGGTGTCATTTTTGACTATTTTAAT ACAAAATACTCAAATACATATAAGTATTCTTTGGTATATTACAAAGATCA AATTACGACAGTTATATACCTCATTAATATATAATAACCATGTAATTGTA ATATATCAAAATTAAATGATAGAATCATCTAATAGTTGGTAGGTGGGATG ACCATTTTTTGAAATAAATAATACATACTGTATACTGCATACTGTGCTAT ACAAATTGTACAAGTTGCAGCCAAAAAATGAGATGAATCATTTTAAATGA AGGATTTACAGTAGATTTGGGCTGAAGTCGGTGGCGCTGGAACCATCCGG GGCCATTACCCTTCCCCTCCTCCCAACTTTAGCGGAATTTTTATAGTTCT CACAATAAAAAAAATTATCTCAACTTAAAATGTTAAATCAAATGCTTCTC AGTAAAAATAAAAATCCACTTTTCCCTTCTAATAAAAAAAATTGTTTATC GTACAAATTGAGTCTCTAAAAAAAAGTTTAATTCTCAAATTAAAAAAAAA AAAATTTTGTCTCCTCTAAAAAAATCAATTTGTCAAATTTGGCATTTAAA AAAAATTGCAAACAAAAAAAATACGGCAAAATTGTCAAAACGCCCAATGT CTCCGTATAAGTATTCTTTGCCACATTAAACAGTTCTAATGCCCAAAGTT ATACTACTTAGTAATACATAATAACCATAGAATTGTAAAATATCAAAATA AAATGATAGTATCAGTGAATAGCTTGTTGGTAGATAGAATTAATAATGTT GTAATTGAATAATGAATTTTAAGACGTAGAAATTGTAACTTGTACAGACA TAGCAACCTGTACACAACGTTATAATACAAAAAAATATATTGTTCATTCA TGGAACATTCAATTTATTCCTTATTTATTCGGTCCAGTTCAGTCTTATGG GTCCTTCGGACTCTCAGTACTAGAACTGATTTGAAAAAAATAAAGTTGAG TGACGTCATCAAGGACCAAACTCAACCCGTTTTAGAACTAATATGCGTTC TAAATAATGATCGATACGCCATTAATTCAATTATTGTATGATCCTCATCC CAAGCCTATTCATTTAAATCCTTTTAAGTAATTCATCTTTTTTTTATTGC AACTTGTACAAGTAGCAATGTACTNATTCATCTTTTTTTTATTGCAACTT GTACAGTTAGCTTATACAAGTAGCAATGTACTCCACATATATGTATAACA GTATACACGACGAGTGTAAAAGCTAATTGGCAACATTACTACTAATAACA ATCCTAAGGACGAATGAATGAGTTTGTATTTTTTGTACATTTTTATTCGG GAAGATGACTTAGCATTAAAAAATGCTTATTAGCATGTTGCTTCGACTGC TGTGTATTAGTTGTTATAATAGTAATCATCCTAAAGAAGGCATAAAAAGA AAGAGAAATCGCGGATGCGGCGCATACAATATTTATAAACTAATATTATG CTGACACGACAGTCTTAGTCAAAATCTAATGATCCTCACGACTAGAACAT GCACTATGAACATATCATTATTATGATAGGCCCTTATATTATATATATAT ATATGAGCTATAACTAAGAACAAATACACATTGCGCTTGGAATCATTTCT CAAGGCCGACAAAAATGCTGAAAAACGATGTGAAGAAATAAATTGTCATC ATTATCATCAACCTTCTTATTCCTCTTCGCAAGCTACATTGTACATTCAA ATAAAAGCTACAATCAGTAGTAGAAGGCATACTCAACCGCACGCCTTTTC ATTTGCTGCATGCACTCATTGCAGTATGTGTGAGAAATACACTACGCTTT TTTTACTATATAATATATGCTATGCCATCGTTTTGAAAAAGAACATAATT ATGACATGTATGTGAGTGTAGCTGCTCTCCCCTGCCTCCTTACAGCAGCT CTCTCTCTCTCCTTTTACTCATCAAAATGAATGGATCACACTATACGCAA ATCTCCTTTCTTTTGATACGCCTCTTATACTCTAACATGAAGAAGATATT GGCAAATATATATATATAGTACAATTCCTCGCAGTAGAATTACTTTATTT TCTGAGTGATCGTTCCTTAAGCCTGAGCAGCGCAGCTACCACTGAAGGGG GGAATGGACCCTTGCAATTTGTATTATAAAGTATTCGGTCGAAGGAGGAG GCAAACGGCTAACTTTTGTAATTCTCGCCTCCCTACATAATATAATAATA ATACCCATGTAGTCAGATGTTGTTATGCAATAAAAAATAAGTAGAGAGAA ATATCCAGTTTTTCATTATGACAATGCTGATTCTTTGTTCAAATAACAAC TACTTTTTGAGCGTGCGGGTGCCCCTAGAAGAAGAAAAACAACAACAACA CCATTATTAATACAAGCATAATAATTCAAAATGCTTATCTTTCTTACATA AAGGTTACTCTTCTTCCAGTATATATATAAATAATATATACTACATAATC ATTCTTGGAGGGAAAGGGTGCAGTTCGTCGTCACTTACAGAATTTGATAA CGCGTCATTTCCATATGTAGTACAGTAAAGCATGTATGCTTGTATTTGTA CATTCATACATACATATTTTCACTGCGATATCCTTGCAGTTGAGCGAGAG AAGGAGGAAGAGAGTAGAAGTATAGAAAGAAAAAGTTAAGGATATACTTA ATATTATTTAATTTGAAAAATAGGGAAAGAAGAAGGCTTACACTTTCTCT CTTACTTTGAGGGAGAATATATATATATATACAATGAGAGAAAGACACAG GGAGCTTATGAAGTAGTAGAGAGCTTTCCTCTTGTTCTTGTTGTCGTTGA TTCTTTATGTTATTATTATTTTAAAAAATGCAAGAGAACTAGTAGAAAGG AAGAGGATTTTCCTGAGATGCGGTCCTTTATATATATATCAATGTATTTA CGCAACGCTTTCTGTATATCTATCGAATATACATGTAGGCTCCTTCGAAT CCCCTTAATACTTATGTATATATATCCCTTTGTCAATGATGTAGTATAGG GACTGTTTGATGTACTAATGACCACTAGAACACACTCCATCCAATCAAAA TCTGAGAGGATCTCACATTTTAATCACTAGGAAGAAGTATAACTTGGATT TTTCACATTTCATTATGTTTCAATGAGTCAATTAAAATCCTATTGGGTTT TACAGCGATACTACCGCTGTGTATCTGTGGACAAGTGTGGTCGTATAGCA TGTTAAACAATAATAAGAACTGTTTGATGTACTAATGACTAGTAGAATGC TCTCTATCCAATCAAATCTCACATTTTAAACAATAAGGACGTCGAATTTC TATCACATAATTCAAAATTCTCCGTGGCATCATTTGCTTGTGACAACGAC TTTACATTTTGCTGCAATTTTTCAATTTTCACCATGTTTCAATTATCCTT TTAAATCCTACAAAGTTTTGGCGTGATACTAGCACCGTGCATCTGCAGAC AAGCTGTAAGGGCGTTAAAAAGTCTCTATCGAAAGGAAATAGTTGTTAAG CTGCTGCTATGACAATGTCTTAAGTAAATACATTTTTTGCATTTGTTGCA AATATGTACTATAGGGGCTGTTAACGACAGATGCATGACGCAAGTATCGC AGTAAAACTCAATAGGATTTTAAAGGATAATTATGACTGAAAAGGTAATC AAAGCTCAATACAAAGTTATTATCACAACCAATTTATGCCTCTGAGTCAT TTAAATTTATGTACAGAAGTCCTACTTCTTCTTATTACTTAAAATGTGAG ATCCTGTGAAGTTTTGATTGAATAGAGGGCGTCCAAGTGGCTATTCTTAC ACACTGTGGAGATTGTCTAATGTAMAAAATAGAGAGTGTMCTYTATCCGA TCAAAACCTGAGAAGATTTCAAATGTTAAACACTAAGAGTACGTCGAATC TCTATCGAACAATTCAAAATMCTCCGAGACATCATTTGCCATTAACAACT TCATTTTAAGCTGATGATTTCATAATTATATAATATCCTATTAGGTTTTT ACCACAATACTAGAGCNCAAAAGTAGTATGTTGTAAAGGGAAGGTAGGGG AAGGAAAGAAAACAAGCAGCAGCCAAAGGAATACTAACGTATATATATAT ATATATATAATGTACATTACATACATACATTGTTGTCGTAAAGTGTAATA AAGAGAGAACTATAAAATACATAGTACATACAAAAGAGAGAGAGAGAGAG TCGAGACCGCTTTGCCTATACTGCCGAGTGTCTACGTTGATTTCCGGTAG AATAACAAGCAGAAGAGGGGGGGGGGAATGATTTGCAGTACGCGCAAGAG TGTAGTAGTCAAACTGCACTCAGTGGGAAAKCATACTTCTACACTCTAAA CAACACAACAACCACTACTACTACTAAAAAAYAAAARAACAAAAWMTTAC AAAATATTAAAATAAATTCCTGCTAAATTGACGAACCAATTATTKCCTCA GAATCACTACTACACAGTAACCAGAAGACAAAGGAGCCATGTGCACCTCC CAAGTAAGTAATTACTTCGTTTTCAAGTGTTTGTTGTCGTGTCTTATGTA TGAACCTACTTTTTGGGTGCTATGGAATCCTCACGAGAAGAAAATCGTGT AAAATCTGCAAAAGATCCCCGATTATATTGACATACTCGTTAGTTGCCTG TGATTTTGTATAACTTTCTTTGTAAACTGCATTATGAAGACAAAGGATCC TCGGATGATTGTGCACCTCATATACAAAGTCTCTGAACGAGGCAAAGTAG TAATGGGGGGGGGGGGGGAAARCCCAAGAGCCTCTCTTTTAATTCCCATA ATTAAATAATATTATAAAATACACCAATAATTTGAATGAGTAGTTAGCAA TAATGAAAATTGGCGCGCGATGATGTTATGTGATTTCGCATTACACTAAT AAAACCCCGCGCGCTTTTTTCTCTCCTTTTTTCTTGTTGCCTCTGCGTGT GTGCTTCTGTCTTGCTGCTTGGCTTAGGCGCGAGAGGAGCAAACAATGTT TATTTTTATGATTGCTTTTTTTAATGCGGCATTGACCAATGAGAGTGAGT TTTTGTGCATAACTGCATGGAAAGCGCAGGTTCTTTACGGGCTGAACGGG CGGAATTGCATCAGCGAAATTCTCTTGAGTGCCTCAAGCCTTCACACTAA CACCACCACCGTCCTGGTCTATTTCTATATGTACTTGTATTACTATTCTA CGAAGGATCATATTCTCCTCTTACTATTTTATTGTTTTTTTTCTTCTGTT AAATTATTATTATTATTATATAGCCATGTATGTTCGTAGTATCTGACTAC AACGCATTGCGAACTAGAAATCGTATGTTGGATGTACATTGATGTATGAC TTGGTTCAATCATCTAATGTGGGCGAATCCCTGTATCTTAATTAAAATGA ACCTTTGCCACGTAGTTAAAATAATGATGATGATCAACTCATCGTCCTTA CTGAGTAAAAGAGGAGGAGTAGTAAATGAAGGGCTCTTGTATGGTTATTA TTTCACTAAATGTCTAATATTCTTCATGATTGTCCCAGCCTTTTGCACAT ATAAATTAATATGAGTGATAGACGAAGGCAAATCCCTCCTTTCTTCGACC TCATTATTAATTTCTTAGATAGATGATGACTACGCTTCTTTATTATTATT ATGAGGCAACAGATGACTTATTAGTAGTAATAGATGAAGCCTCTACAGTT AGATGAGGTTCATTTACTCAGAGGATTTAATACATATAATGTAAGTATAC AACATATTACCTAGAGTAAGCATGCTACAGAGAAATGAGACCAACCGGCT TGAGAAAGAAAAAGAAATACATGTACTATCTATATAGTAACAAATAATAA AATCAGTGGGTTCACCCTTAAAGGTAGAACTTTGAAACCGGCCTCTTAAC TTAATGATAAATTTGAAGAAGAAAAAAAATCACAAGATGCGCGTGCCTGC AAATTTATATACACATTTTACATTTAGCAAAAAAATCGTTTTCGTACATG AATATTGTAGTATATATATTTTTATTTCTTTACAGGGAGAGTACAGCAAC TTTTTCCGTCGTTGAAGGAAGGGATAGAATGAGAAAGATGGGGAGTGAAA AGTATAAGCTCAAATGGAGCAAATACGAAACGAACATACTAACAGCATTT CATGGATTGCTCGAGTCTGAAACTCTTTCGGATGTTACACTATTCTGTGA AGGTATAATAATTCATTCATCTGCTATTTTGTTTAAGTTAATGCAGTTAT TAAGGGAGATTCTTCTTTTTATATTGATGTTCTTGTACAAACATAGATTG TAACCTACACATTCACCAAAGTCATGCTTCCTCCTTCTTTCGCTAAGAGA AAACAAATATTTACCGTCTGCGGTATGCTATTATGTATGGCACTTTATGA CTCAGCAAATTAATAGTTGCTGTAAATCCAATTTATATTTATAGTTTTTT TCACAGTACGCTGCATTACAGAGTATGTAATTAAACCTTCCTTATTGTAG ATTTTTCCGTTTCATTGTTGAATAGTTTCCATGCACTTTTCTCATGTTGA GTACATTCAGCATTGTAATCAAATCAATTATTTTTGAAGCCTTTTTCTTC CTTTTTTACATCGTTATTTACCTACAAAAACAAATTGTTTGAAAAAGATA AGAATAGCTTGATGAGTGTTATGTATATACATATGATCATAAAAAAATTC TATTCGATATCTGTATTAATATTAATCAATAATTATCAATATTTCTATAG GTCAAACCTTCAAAGCTCACAGACTCGTGTTAGCAGCGTGTAGCACTCAT TTTGAAAGTCTATTTAGCCATGCGCCAATCAATGCCCCCACAAATAATCA ATTTTTTGTCATTTTGGATGGAACAAGAGCAGATGATCTTCAGATTTTGC TTCATTTTATGTATAGAGGTGAGGCCTATTTGCATCATGACAGAATCAAC AGCGTTCTCAAGACTGCTGAAGTACTTCAGGTATGACCTCTTATTTAACA TTTTTATATATTAAGGTTTTAATCCATAATTTTCTGTAATCTCATAGGTT AAGGGCTTGTCCGAAGGACCCCGAAACATTGAAATAAATAATCAAAATAT GCATATGGCGSSTGCCTCTACTAGTAGCAGGMCTTGGTCTCCTATCAATT CTGGTGGTGTTCCCATATCCCCACCTCTTATGAGGAAAAAGAGAGAGAGG GATGACTCACCACCAACTAGAAGTCCTATACCAGAACATTCTTCTCCTAA CTATTACCCAAGGGAACAATTTCCTATGTATCGATTGCCCACATTTGCAG GAAGKCCAGTCGAAGCTGTTGCAGCAGCGGCAGSAGCAGCCGCGGCTGCT AGTAGTGGAAGTAACAATCTTCCCTCTTCGTCATCACCTTTTAATCATAA AGCGTCTCCTTCACCTTGCGGAGGAGGGGAACGTTATTCCAAAATGATAC GTGGGGGATCAGCATCTCCACATCGTCCTCCTTCGGTCTCTAAAAGAGAG GAAGAGGACGATCACTATGTTCGCTCATCTCCTATGATTCGTCCATCATC TAACAAGGCTGAAGATTACGAGGATGTCCCACCACCTCCAAGAGGTATGG GAAATTCCTCTTCACCTCAACCACCTGTTTCAGGCCTTTCGAAACATCAA TCTTTCCCTTCCGATTCTACTACGACTGAACTAAACTCCGGACCATCCGG TTTATTATCCCGTGCATATAAAGAAAGACTGCGAAGAGAGTCCGAACACT GCGAACCTGAATCAAATACTAATAATGACGATCTTACACATCAGACTAAA TTTCCTGACTTCAGGAATTCAAGAGAAGAAATATCAAGGCTGAATGATAT TACTCCTCCAAGAAATCCCTCAGGTAAATTATTGTTGTACTCATATTGAG TTCTCACATTCTTGCATTATAACCCATAACTTAAAATCTACTCTTTCATA TTAGGATTAAATGATGAAGATGTTAGGKCTSCTGCCAATAATTTGGAAAC ATTTCGACGATTAGCTCAACAACACGCAAGGACTTTACCTATTCCTGTAA CTCTAGCTCAAGGTTTTTCAGCTAGTGACTATGTGAGATTAGCTTCTCAT GTTAGAGATCCTGAAAATGGTACCGGTAATGACCTCTTTCTTTTACTATC TTTTATAAAGACAATTTGATCATATCTTGATAGAAAAATCACGGAAACAT TATTTTTATAATTAGGTACAAAGCTGAGATGCCCATTTTGCGAAAGAACT TATGGTTATGAAACCAACCTACGTGCTCATATTCGCCAGAGGCATCAGGG AATAAGAGTGTCGTGTCCATACTGCCCTCGCACATTCACACGAAATAATA CAGTTCGTCGTCATGTTGCTAGAGAACATCGTCACCTAAGTCGTAACATT CCTKCACGATTTKCTTCTKCGCGTATKCCTCCTGARCCGATTTCCGCGCA ACAAAMGGCTGSTGTASCATCCGCTACATCATTACTACAGCCACCTTCTC CTAATACATCTGGTAATGGACAAAATTCAACCCCAGAAATAGTAGCTAAA CACCCATGACATCTAATGCCCCCTGGAGTTGATAAGATTTTTGCACCAGC ATAATGCTTAAATGTGTATGATCATGACTGATGATATAAAAAGATAATTT TTTCGAATTCTTTATTAACCACGTTTTGTATGTATTTTTTTTTAAGAAAA TGAACGTATTTTTTTTTTTTCCCTTGAAGAAAAAAAGTGATCGGTTAAAT CGAAAAAGAAAAGTAAAAAAAAAGTGTTGTAGTTTGATGGTTAGTAAAGA ATTTTTTTTTTTAAATCATTTTTATTAAGTAGTGTTCTCTCAGACCTCTC TAGAAATCCACAAGACTGACTAA
back to top
Add to Basket