EMLSAG00000000016, EMLSAG00000000016-682782 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000016
Unique NameEMLSAG00000000016-682782
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000016 vs. C. finmarchicus
Match: gi|592893211|gb|GAXK01065164.1| (TSA: Calanus finmarchicus comp4259091_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 28.1054 bits (61), Expect = 1.597e+0
Identity = 14/44 (31.82%), Postives = 26/44 (59.09%), Query Frame = 0
Query:    2 SLQSKKIDKQTSPFGEA--LLPFPSSPLLTYILSVLKRTQSETS 43
            +LQS+++DKQT+ + +A   + +   P+L   L    +TQ + S
Sbjct:  170 ALQSQEVDKQTTQYNQAEEEMIYEKEPILVKRLRRENKTQEKIS 301          
BLAST of EMLSAG00000000016 vs. L. salmonis peptides
Match: EMLSAP00000000016 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:63466:63770:-1 gene:EMLSAG00000000016 transcript:EMLSAT00000000016 description:"maker-LSalAtl2s1004-snap-gene-0.24")

HSP 1 Score: 114.775 bits (286), Expect = 3.883e-35
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
Query:    1 MSLQSKKIDKQTSPFGEALLPFPSSPLLTYILSVLKRTQSETSLTLFFLNFFYLTKNYL 59
            MSLQSKKIDKQTSPFGEALLPFPSSPLLTYILSVLKRTQSETSLTLFFLNFFYLTKNYL
Sbjct:    1 MSLQSKKIDKQTSPFGEALLPFPSSPLLTYILSVLKRTQSETSLTLFFLNFFYLTKNYL 59          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000016 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000016 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 1
Match NameE-valueIdentityDescription
gi|592893211|gb|GAXK01065164.1|1.597e+031.82TSA: Calanus finmarchicus comp4259091_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000000016 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000163.883e-35100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:6346... [more]
back to top
BLAST of EMLSAG00000000016 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000016 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000016 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000016 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:63466..63770 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1004-snap-gene-0.24
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000016 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000016EMLSAT00000000016-695863Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:63466..63770-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000016-682782 ID=EMLSAG00000000016-682782|Name=EMLSAG00000000016|organism=Lepeophtheirus salmonis|type=gene|length=305bp|location=Sequence derived from alignment at LSalAtl2s1004:63466..63770- (Lepeophtheirus salmonis)
ATGTCCTTACAAAGTAAAAAAATCGACAAACAAACTTCTCCATTTGGAGA AGCCCTCCTTCCTTTTCCTTCTTCTCCACTCCTCACTTACATACTTAGGT TCATTTCTCATTGATTGATTAATTAATTAATTATTTCACACTTGCAATTA CAATTACTCTCACAAATACAAAAATACAAATCGCTTATAAGTGTGTAGGA GACGTCAAATTTATATTGTAGAGTGTCTTAAAACGGACTCAAAGTGAAAC ATCTTTAACACTCTTTTTTTTAAATTTTTTTTACTTAACAAAAAATTATC TTTAA
back to top
Add to Basket