EMLSAG00000000018, EMLSAG00000000018-682784 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000018
Unique NameEMLSAG00000000018-682784
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592930494|gb|GAXK01028051.1| (TSA: Calanus finmarchicus comp301101_c0_seq8 transcribed RNA sequence)

HSP 1 Score: 27.335 bits (59), Expect = 4.775e+0
Identity = 20/67 (29.85%), Postives = 30/67 (44.78%), Query Frame = 0
Query:    9 LLLYRRDSDKLSIPSNQQDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQR 75
            LL+  + S  L++ S  +  L T +N+V    L   KIP R+   P     L +   FP   P  +R
Sbjct:   51 LLIREKVSTWLTLLSRTKVPL*T*QNQVMSQSLISPKIPRRLPGHPMALHLLTKTETFPRGFPVMRR 251          
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592930495|gb|GAXK01028050.1| (TSA: Calanus finmarchicus comp301101_c0_seq7 transcribed RNA sequence)

HSP 1 Score: 27.335 bits (59), Expect = 4.784e+0
Identity = 20/67 (29.85%), Postives = 30/67 (44.78%), Query Frame = 0
Query:    9 LLLYRRDSDKLSIPSNQQDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQR 75
            LL+  + S  L++ S  +  L T +N+V    L   KIP R+   P     L +   FP   P  +R
Sbjct:   51 LLIREKVSTWLTLLSRTKVPL*T*QNQVMSQSLISPKIPRRLPGHPMALHLLTKTETFPRGFPVMRR 251          
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592792852|gb|GAXK01161716.1| (TSA: Calanus finmarchicus comp34753_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 5.850e+0
Identity = 15/49 (30.61%), Postives = 27/49 (55.10%), Query Frame = 0
Query:   26 QDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQ 74
            Q +L   ++K+ + +  + K P RV+ +  T+G LDQ+    E +P  Q
Sbjct:   75 Q*ELLMARSKLVQWVATRKKQPPRVEQVLDTRGFLDQVLLLEEYIPDTQ 221          
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592792854|gb|GAXK01161714.1| (TSA: Calanus finmarchicus comp34753_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 6.325e+0
Identity = 15/49 (30.61%), Postives = 27/49 (55.10%), Query Frame = 0
Query:   26 QDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQ 74
            Q +L   ++K+ + +  + K P RV+ +  T+G LDQ+    E +P  Q
Sbjct:   75 Q*ELLMARSKLVQWVATRKKQPPRVEQVLDTRGFLDQVLLLEEYIPDTQ 221          
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592792853|gb|GAXK01161715.1| (TSA: Calanus finmarchicus comp34753_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 6.564e+0
Identity = 15/49 (30.61%), Postives = 27/49 (55.10%), Query Frame = 0
Query:   26 QDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQ 74
            Q +L   ++K+ + +  + K P RV+ +  T+G LDQ+    E +P  Q
Sbjct:   75 Q*ELLMARSKLVQWVATRKKQPPRVEQVLDTRGFLDQVLLLEEYIPDTQ 221          
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Match: gi|592940344|gb|GAXK01018209.1| (TSA: Calanus finmarchicus comp32328_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 8.260e+0
Identity = 17/50 (34.00%), Postives = 29/50 (58.00%), Query Frame = 0
Query:   27 DDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQRL 76
            D + T K ++ + L +Q +I N++   PQ   ++DQ+ H+  P PTQ  L
Sbjct:  904 DRIKTQKIQMDKELEYQNQI-NQMYNDPQ---YMDQLEHYYRPAPTQPAL 1041          
BLAST of EMLSAG00000000018 vs. L. salmonis peptides
Match: EMLSAP00000000018 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:73983:74432:1 gene:EMLSAG00000000018 transcript:EMLSAT00000000018 description:"snap_masked-LSalAtl2s1004-processed-gene-0.9")

HSP 1 Score: 161.77 bits (408), Expect = 5.555e-53
Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
Query:    1 MCVTIISCLLLYRRDSDKLSIPSNQQDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQRLVF 78
            MCVTIISCLLLYRRDSDKLSIPSNQQDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQRLVF
Sbjct:    1 MCVTIISCLLLYRRDSDKLSIPSNQQDDLHTFKNKVARGLLFQGKIPNRVKAIPQTKGHLDQISHFPEPLPTQQRLVF 78          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000018 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000018 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 6
Match NameE-valueIdentityDescription
gi|592930494|gb|GAXK01028051.1|4.775e+029.85TSA: Calanus finmarchicus comp301101_c0_seq8 trans... [more]
gi|592930495|gb|GAXK01028050.1|4.784e+029.85TSA: Calanus finmarchicus comp301101_c0_seq7 trans... [more]
gi|592792852|gb|GAXK01161716.1|5.850e+030.61TSA: Calanus finmarchicus comp34753_c1_seq3 transc... [more]
gi|592792854|gb|GAXK01161714.1|6.325e+030.61TSA: Calanus finmarchicus comp34753_c1_seq1 transc... [more]
gi|592792853|gb|GAXK01161715.1|6.564e+030.61TSA: Calanus finmarchicus comp34753_c1_seq2 transc... [more]
gi|592940344|gb|GAXK01018209.1|8.260e+034.00TSA: Calanus finmarchicus comp32328_c0_seq1 transc... [more]
back to top
BLAST of EMLSAG00000000018 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000185.555e-53100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:7398... [more]
back to top
BLAST of EMLSAG00000000018 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000018 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000018 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000018 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:73983..74432 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s1004-processed-gene-0.9
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000018 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000018EMLSAT00000000018-695865Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:73983..74432+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000018-682784 ID=EMLSAG00000000018-682784|Name=EMLSAG00000000018|organism=Lepeophtheirus salmonis|type=gene|length=450bp|location=Sequence derived from alignment at LSalAtl2s1004:73983..74432+ (Lepeophtheirus salmonis)
ATGTGCGTGACTATTATAAGCTGCTTGCTCCTATACAGAAGAGATTCTGA TAAGCTTAGTATTCCTTCCAATCAACAAGATGATCTTCATACATTTAAAA ACAAAGTTGCTAGAGGACTTCTTTTCCAAGGAAAGATCCCAAATAGAGTC AAAGCAATTCCTCAAACCAAAGGTCATTTAGACCAAATATCTCATTTTCC TGAACCCCTTCCTACACAACAGCGTTGTAAAATGRCAAAATGCTGCATGA AAACAAAATTGCAATGCAGTATCCCAAATCCCATTATGCTTAGTTGCAGA AAGGCTGTGTTTCGTTCAATTTCATAGTGGATAGTTTATTTGTCAATCAA TATTTTTTTAAAGTCACCAAATTTATATTTASCAGCCAATATATATATAT TTAGAAACAATAGAAATTTGATTAACGTTACTTTTACAGTAGTTTTTTAA
back to top
Add to Basket