EMLSAG00000000019, EMLSAG00000000019-682785 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000019
Unique NameEMLSAG00000000019-682785
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000019 vs. C. finmarchicus
Match: gi|592873625|gb|GAXK01083937.1| (TSA: Calanus finmarchicus comp176116_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 6.306e-1
Identity = 16/38 (42.11%), Postives = 22/38 (57.89%), Query Frame = 0
Query:   12 RLLKEEILDAKIKKFFGIQENDSQDKNILS----LGGE 45
            +L  + +LD+ IK   G QENDS D  +L     +GGE
Sbjct: 1444 QLTSDPVLDSPIKNNLGPQENDSLDSRLLPPEHLVGGE 1557          
BLAST of EMLSAG00000000019 vs. C. finmarchicus
Match: gi|592873626|gb|GAXK01083936.1| (TSA: Calanus finmarchicus comp176116_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 6.327e-1
Identity = 16/38 (42.11%), Postives = 22/38 (57.89%), Query Frame = 0
Query:   12 RLLKEEILDAKIKKFFGIQENDSQDKNILS----LGGE 45
            +L  + +LD+ IK   G QENDS D  +L     +GGE
Sbjct: 1444 QLTSDPVLDSPIKNNLGPQENDSLDSRLLPPEHLVGGE 1557          
BLAST of EMLSAG00000000019 vs. L. salmonis peptides
Match: EMLSAP00000000019 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:82441:82988:-1 gene:EMLSAG00000000019 transcript:EMLSAT00000000019 description:"snap_masked-LSalAtl2s1004-processed-gene-0.14")

HSP 1 Score: 157.532 bits (397), Expect = 2.301e-51
Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
Query:    1 MRSELEIQGTERLLKEEILDAKIKKFFGIQENDSQDKNILSLGGEAKKRRKGYLHHPLLLSRGEEVKKKARCSVSPDC 78
            MRSELEIQGTERLLKEEILDAKIKKFFGIQENDSQDKNILSLGGEAKKRRKGYLHHPLLLSRGEEVKKKARCSVSPDC
Sbjct:    1 MRSELEIQGTERLLKEEILDAKIKKFFGIQENDSQDKNILSLGGEAKKRRKGYLHHPLLLSRGEEVKKKARCSVSPDC 78          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000019 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000019 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 2
Match NameE-valueIdentityDescription
gi|592873625|gb|GAXK01083937.1|6.306e-142.11TSA: Calanus finmarchicus comp176116_c0_seq2 trans... [more]
gi|592873626|gb|GAXK01083936.1|6.327e-142.11TSA: Calanus finmarchicus comp176116_c0_seq1 trans... [more]
back to top
BLAST of EMLSAG00000000019 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000192.301e-51100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:8244... [more]
back to top
BLAST of EMLSAG00000000019 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000019 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000019 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000019 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:82441..82988 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s1004-processed-gene-0.14
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000019 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000019EMLSAT00000000019-695866Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:82441..82988-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000019-682785 ID=EMLSAG00000000019-682785|Name=EMLSAG00000000019|organism=Lepeophtheirus salmonis|type=gene|length=548bp|location=Sequence derived from alignment at LSalAtl2s1004:82441..82988- (Lepeophtheirus salmonis)
ATGAGAAGTACGAGTTTGTATGTTCGGATACCGAACCAAGAAAAATGTGT TTCAACGGAAGGGGATTGTTCATATTTTTATTATTTTATTCTGTGAAAGT CATTTCAACATACTCACATGCATATATTTGCCTTTATTTACTGTAGGCGA GCTCGAAATACAAGGAACCGAGAGGCTTCTTAAAGAAGAGATCCTTGACG CTAAAATAAAAAAGTTTTTTGGGGTAAGTTGAATTCATTTGAGATTCTAC AACTTAAGTATAGGTATATCTTTAACTTTTTGTCATTATCAAAGAGAGAA GGGGGGACAAAGGGAGAGAGAAACAGAGATAGAAAGAAAGCGAGTTTTTG TGTATGTCATGTTCAACCATTTGTTTATTAATTATGTCCATATAGATTCA AGAAAACGACTCACAAGACAAAAATATATTAAGCCTTGGAGGAGAAGCTA AAAAAAGACGCAAAGGGTATCTTCATCATCCTTTACTTCTCTCAAGAGGG GAGGAAGTGAAGAAAAAAGCAAGGTGTTCTGTTTCTCCTGATTGTTAA
back to top
Add to Basket