EMLSAG00000000020, EMLSAG00000000020-682786 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000020
Unique NameEMLSAG00000000020-682786
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000020 vs. C. finmarchicus
Match: gi|592842874|gb|GAXK01114670.1| (TSA: Calanus finmarchicus comp174309_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 7.517e+0
Identity = 15/40 (37.50%), Postives = 24/40 (60.00%), Query Frame = 0
Query:   41 DDTSCQN--NNIICIVKSRLLLLQEPSSLVTFMTHSLCSK 78
             + SC++  NNI C+     ++L+  S LV F T+ LCS+
Sbjct: 1893 SEKSCKHHQNNIFCLPPMVQIILKRLSKLVFFATYILCSE 2012          
BLAST of EMLSAG00000000020 vs. C. finmarchicus
Match: gi|592808801|gb|GAXK01145767.1| (TSA: Calanus finmarchicus comp570330_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 8.268e+0
Identity = 10/31 (32.26%), Postives = 20/31 (64.52%), Query Frame = 0
Query:   16 GDGYDPAPSLEIKEAKKIKTESKGNDDTSCQ 46
            GDG D +P++ + E +++  +++GN  T  Q
Sbjct:  474 GDGLDVSPTVMVGEKQQLLGKNRGNGHTKTQ 566          
BLAST of EMLSAG00000000020 vs. C. finmarchicus
Match: gi|592863356|gb|GAXK01094206.1| (TSA: Calanus finmarchicus comp49407_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 8.591e+0
Identity = 13/55 (23.64%), Postives = 27/55 (49.09%), Query Frame = 0
Query:   28 KEAKKIKTESKGNDDTSCQNNNIICIVKSRLLLLQEPSSLVTFMTHSLCSKCLKM 82
            K+  ++     GN+ TS  N +   +  +  +L QE  ++ + +   +C+K  KM
Sbjct:  685 KKHSQVSVNRAGNNKTSISNGHEYAV*SNNYILEQEVRTVPSILICKICTKAFKM 849          
BLAST of EMLSAG00000000020 vs. C. finmarchicus
Match: gi|592863357|gb|GAXK01094205.1| (TSA: Calanus finmarchicus comp49407_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 26.9498 bits (58), Expect = 8.592e+0
Identity = 13/55 (23.64%), Postives = 27/55 (49.09%), Query Frame = 0
Query:   28 KEAKKIKTESKGNDDTSCQNNNIICIVKSRLLLLQEPSSLVTFMTHSLCSKCLKM 82
            K+  ++     GN+ TS  N +   +  +  +L QE  ++ + +   +C+K  KM
Sbjct:  685 KKHSQVSVNRAGNNKTSISNGHEYAV*SNNYILEQEVRTVPSILICKICTKAFKM 849          
BLAST of EMLSAG00000000020 vs. L. salmonis peptides
Match: EMLSAP00000000020 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:90633:90921:-1 gene:EMLSAG00000000020 transcript:EMLSAT00000000020 description:"snap_masked-LSalAtl2s1004-processed-gene-0.10")

HSP 1 Score: 165.236 bits (417), Expect = 3.041e-54
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 MKLKEVVLCVLVLEAGDGYDPAPSLEIKEAKKIKTESKGNDDTSCQNNNIICIVKSRLLLLQEPSSLVTFMTHSLCSKCLKM 82
            MKLKEVVLCVLVLEAGDGYDPAPSLEIKEAKKIKTESKGNDDTSCQNNNIICIVKSRLLLLQEPSSLVTFMTHSLCSKCLKM
Sbjct:    1 MKLKEVVLCVLVLEAGDGYDPAPSLEIKEAKKIKTESKGNDDTSCQNNNIICIVKSRLLLLQEPSSLVTFMTHSLCSKCLKM 82          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000020 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000020 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 4
Match NameE-valueIdentityDescription
gi|592842874|gb|GAXK01114670.1|7.517e+037.50TSA: Calanus finmarchicus comp174309_c0_seq1 trans... [more]
gi|592808801|gb|GAXK01145767.1|8.268e+032.26TSA: Calanus finmarchicus comp570330_c0_seq2 trans... [more]
gi|592863356|gb|GAXK01094206.1|8.591e+023.64TSA: Calanus finmarchicus comp49407_c1_seq2 transc... [more]
gi|592863357|gb|GAXK01094205.1|8.592e+023.64TSA: Calanus finmarchicus comp49407_c1_seq1 transc... [more]
back to top
BLAST of EMLSAG00000000020 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000000203.041e-54100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:9063... [more]
back to top
BLAST of EMLSAG00000000020 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000020 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000020 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000020 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:90633..90921 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s1004-processed-gene-0.10
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000020 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000020EMLSAT00000000020-695867Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:90633..90921-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000020-682786 ID=EMLSAG00000000020-682786|Name=EMLSAG00000000020|organism=Lepeophtheirus salmonis|type=gene|length=289bp|location=Sequence derived from alignment at LSalAtl2s1004:90633..90921- (Lepeophtheirus salmonis)
ATGAAGTTGAAGGAAGTTGTACTTTGTGTTCTCGTACTGGAGGCAGGGGA CGGATATGGTGMATCGTCACTCCTTAGAATGTATTCTCTCCTTCCTAGAT CCAGCACCATCCCTTGAAATAAAAGAAGCTAAAAAAATCAAGACAGAGAG CAAAGGGAATGACGACACCTCGTGTCAAAATAATAATATTATATGTATAG TCAAAAGTCGACTACTTCTTCTTCAAGAACCTTCCTCATTAGTCACCTTC ATGACTCATTCTCTATGCTCCAAATGTTTAAAGATGTGA
back to top
Add to Basket