EMLSAG00000000024, EMLSAG00000000024-682790 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000024
Unique NameEMLSAG00000000024-682790
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000024 vs. GO
Match: - (symbol:Q52V24 "Hepatopancreas trypsin" species:6717 "Pontastacus leptodactylus" [GO:0005515 "protein binding" evidence=IPI] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0046872 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 PDB:4BNR PDBsum:4BNR EMBL:AY906961 PDB:2F91 PDBsum:2F91 IntAct:Q52V24 MEROPS:S01.035 EvolutionaryTrace:Q52V24 Uniprot:Q52V24)

HSP 1 Score: 52.373 bits (124), Expect = 2.583e-8
Identity = 35/94 (37.23%), Postives = 43/94 (45.74%), Query Frame = 0
Query:    7 MNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYD----------------------ARYGTNE---TMICAAAPR--KDSCQ 73
            ++ DI LLK      FND   P+ALPE      GDV++TGWGT  +                      A YG +E   +MICA  P   KDSCQ
Sbjct:   93 LDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQ 186          
BLAST of EMLSAG00000000024 vs. GO
Match: - (symbol:CG31265 species:7227 "Drosophila melanogaster" [GO:0004252 "serine-type endopeptidase activity" evidence=ISS;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 OrthoDB:EOG7MKW6Q EMBL:AY070950 UniGene:Dm.6198 ProteinModelPortal:Q8MTU7 STRING:7227.FBpp0082843 MEROPS:S01.A97 PaxDb:Q8MTU7 PRIDE:Q8MTU7 FlyBase:FBgn0051265 InParanoid:Q8MTU7 Bgee:Q8MTU7 Uniprot:Q8MTU7)

HSP 1 Score: 42.743 bits (99), Expect = 8.412e-5
Identity = 21/58 (36.21%), Postives = 34/58 (58.62%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTN 58
            M+    M+ DI L+K      FN+  +P+ALP   ++   ++VLTGWG+  D  YG++
Sbjct:  121 MYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGS--DVAYGSS 176          
BLAST of EMLSAG00000000024 vs. GO
Match: - (symbol:PRSS2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T TreeFam:TF331065 GeneTree:ENSGT00740000115192 Ensembl:ENSGALT00000030486 Uniprot:F1NP19)

HSP 1 Score: 40.817 bits (94), Expect = 2.096e-4
Identity = 19/66 (28.79%), Postives = 35/66 (53.03%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTNETMICAAAP 67
            + S+ +N DI L+K  S  +++   +P+ALP +  +   + +++GWG      Y   E + C  AP
Sbjct:   33 YSSITLNNDIMLIKLASAVEYSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAP 98          
BLAST of EMLSAG00000000024 vs. GO
Match: - (symbol:Q90629 "Trypsin II-P29" species:9031 "Gallus gallus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0007586 "digestion" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 HOGENOM:HOG000251820 KO:K01312 CTD:5645 EMBL:U15157 PIR:S55066 RefSeq:NP_990715.1 UniGene:Gga.10164 ProteinModelPortal:Q90629 SMR:Q90629 PaxDb:Q90629 GeneID:396344 KEGG:gga:396344 InParanoid:Q90629 NextBio:20816392 PRO:PR:Q90629 Uniprot:Q90629)

HSP 1 Score: 40.0466 bits (92), Expect = 5.303e-4
Identity = 19/66 (28.79%), Postives = 35/66 (53.03%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTNETMICAAAP 67
            + S+ +N DI L+K  S  +++   +P+ALP +  +   + +++GWG      Y   E + C  AP
Sbjct:  101 YSSITLNNDIMLIKLASAVEYSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAP 166          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592915793|gb|GAXK01042582.1| (TSA: Calanus finmarchicus comp212969_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 38.891 bits (89), Expect = 8.993e-4
Identity = 28/93 (30.11%), Postives = 40/93 (43.01%), Query Frame = 0
Query:    9 YDICLLKSKSREDFNDKGKPVALPENYLEF-NGDVVLTGWGTIY------------DARYGTNET---------------MICAAAPRKDSCQ 73
            +DI +L+ K R  FN    P+ LP++  E+ N    + GWGTIY            + R   N T               M+CA   +KD+CQ
Sbjct:  256 HDIAILRLKMRATFNKSIWPIGLPQSTSEYTNTRAFVLGWGTIYFGGPLSDILQEVNLRIWDNPTCKYNYEMLDRVITDNMMCAGDTKKDACQ 534          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592778098|gb|GAXK01176470.1| (TSA: Calanus finmarchicus comp3490_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 35.8094 bits (81), Expect = 6.273e-3
Identity = 29/104 (27.88%), Postives = 44/104 (42.31%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNG--DVVLTGWGTIYD-----------------------ARYGTN-----ETMICAAAPR--KDSCQ 73
            + S  +  D CLLK K   +F +  +P+ALP +  +     +  +TGWGT+ +                       A YG +     ++MICA      KDSCQ
Sbjct:  368 YASATITNDACLLKLKESLEFTEFVQPIALPASGQDTPAGTECTVTGWGTLSEGGFGLPNVLHKVTVPVVSDEDCNASYGASGYSVADSMICAGVEEGGKDSCQ 679          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592918135|gb|GAXK01040240.1| (TSA: Calanus finmarchicus comp146195_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 35.8094 bits (81), Expect = 6.434e-3
Identity = 25/98 (25.51%), Postives = 38/98 (38.78%), Query Frame = 0
Query:    6 GMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVV-LTGWGTIYDA-----------------------RYGTNET------MICAAAPRKDSCQ 73
            G   D  ++K  +   F+D  +P+ LP     ++ ++  +TGWG  Y                         +Y  N+       MICA  P KDSCQ
Sbjct:  382 GSTNDFAIIKLSTPVMFDDSTQPICLPNPNTNYDDNLAEVTGWGETYTVPADDLMTVNVTTMTNEECQELHDKYAPNQNAVIDSNMICAGDPGKDSCQ 675          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592753767|gb|GAXK01200646.1| (TSA: Calanus finmarchicus comp365683_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 35.8094 bits (81), Expect = 6.582e-3
Identity = 20/50 (40.00%), Postives = 28/50 (56.00%), Query Frame = 0
Query:    3 GSLGMNYDICLLKSKSREDFNDKG--KPVALPENYLE--FNGDVVLTGWG 48
            G  G  YD  L++   R DFN     +PV LPE+  +  FN D +++GWG
Sbjct:  586 GQKGAWYDFALIELSERVDFNRHPHIRPVCLPESGEKDYFNEDAIVSGWG 735          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592778099|gb|GAXK01176469.1| (TSA: Calanus finmarchicus comp3490_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 35.8094 bits (81), Expect = 7.913e-3
Identity = 21/76 (27.63%), Postives = 29/76 (38.16%), Query Frame = 0
Query:   23 NDKGKPVALPENYLEFNGDVVLTGWGTIYDARYG-------------------------TNETMICAAAPRKDSCQ 73
            N+   PV LPE   +  G   ++GWGT++    G                           E+M+CA    KDSCQ
Sbjct:  455 NENVAPVTLPEAMQQTEGSCTVSGWGTLHSGDSGLPSKLMKVDVPVVTDQTCKIEYPLQIAESMLCAGEHGKDSCQ 682          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592859562|gb|GAXK01098000.1| (TSA: Calanus finmarchicus comp38145_c4_seq2 transcribed RNA sequence)

HSP 1 Score: 34.2686 bits (77), Expect = 2.109e-2
Identity = 27/101 (26.73%), Postives = 39/101 (38.61%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEF-NGDVVLTGWGTI------------YDARYGTN----------------ETMICAAAPRKDSCQ 73
            + S G N D  +++      F+    P  LP++   + N    +TGWGT+             D R  +N                  MICA+ P KDSCQ
Sbjct:  426 YNSNGNNNDFAIVRLSKDVTFSKTVMPACLPDSTKNYDNVAATVTGWGTLSSGGYQPSVLYEVDLRTQSNAQCTSSATAYSSSDITSNMICASNPGKDSCQ 728          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592942310|gb|GAXK01016243.1| (TSA: Calanus finmarchicus comp4948996_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 33.113 bits (74), Expect = 3.687e-2
Identity = 22/87 (25.29%), Postives = 36/87 (41.38%), Query Frame = 0
Query:   10 DICLLKSKSREDFNDKGKPVALPENYLEFNGDVV-LTGWGTI-YDARYGT---------------------NETMICAAAPRKDSCQ 73
            D  +++      F++   P+ LP     ++  +  +TGWG++ Y   Y T                        MICA++P KDSCQ
Sbjct:  232 DFAIIQLSRDVKFSNTIMPICLPNPSTNYDNRITTVTGWGSLSYKGSYPTVLQEVDVKTVTNAACSNKYYITSNMICASSPGKDSCQ 492          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592843345|gb|GAXK01114199.1| (TSA: Calanus finmarchicus comp3446942_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 32.3426 bits (72), Expect = 7.335e-2
Identity = 18/48 (37.50%), Postives = 25/48 (52.08%), Query Frame = 0
Query:    7 MNYDICLLKSKSREDFNDKG--KPVALPENYLEF--NGDVVLTGWGTI 50
            +N D+CLLK  +   F D    +PV LP N      N + + TGWG +
Sbjct:  252 LNNDVCLLKLSTPISFPDHPLVRPVCLPPNSQTQYGNDEAIATGWGKV 395          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592767678|gb|GAXK01186890.1| (TSA: Calanus finmarchicus comp439630_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.9574 bits (71), Expect = 8.934e-2
Identity = 21/49 (42.86%), Postives = 25/49 (51.02%), Query Frame = 0
Query:    8 NYDICLLKSKSREDFND--KGKPVALP----ENYLEFNGDVVLTGWGTI 50
            NYD  LLK K   DF      +P+ LP     NY +F   V  TGWGT+
Sbjct:  362 NYDFSLLKMKKTVDFTKYPHIRPICLPVDANNNYNDFVATV--TGWGTL 502          
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Match: gi|592877485|gb|GAXK01080251.1| (TSA: Calanus finmarchicus comp392318_c0_seq8 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 2.248e-1
Identity = 14/48 (29.17%), Postives = 24/48 (50.00%), Query Frame = 0
Query:    7 MNYDICLLKSKSREDFNDKGKPVALPENYLEFNG-DVVLTGWGTIYDA 53
             N D+ L+K      F++  +PV LP     +NG +  + GWG + + 
Sbjct:  349 FNNDLALIKLNREVQFSESIRPVCLPATDRSYNGQNTTVVGWGKLREG 492          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000000024 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:18324:18734:-1 gene:EMLSAG00000000024 transcript:EMLSAT00000000024 description:"maker-LSalAtl2s1005-snap-gene-0.11")

HSP 1 Score: 155.606 bits (392), Expect = 1.137e-50
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTNETMICAAAPRKDSCQ 73
            MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTNETMICAAAPRKDSCQ
Sbjct:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDARYGTNETMICAAAPRKDSCQ 73          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000004828 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:397245:398159:-1 gene:EMLSAG00000004828 transcript:EMLSAT00000004828 description:"augustus_masked-LSalAtl2s254-processed-gene-4.1")

HSP 1 Score: 90.5077 bits (223), Expect = 1.032e-23
Identity = 50/96 (52.08%), Postives = 57/96 (59.38%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  123 FASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 218          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000010925 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:283497:284811:1 gene:EMLSAG00000010925 transcript:EMLSAT00000010925 description:"maker-LSalAtl2s730-augustus-gene-3.19")

HSP 1 Score: 89.3521 bits (220), Expect = 2.024e-23
Identity = 50/97 (51.55%), Postives = 57/97 (58.76%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            MF S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP K SCQ
Sbjct:   94 MFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKXSCQ 190          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000000025 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858:7782:-1 gene:EMLSAG00000000025 transcript:EMLSAT00000000025 description:"maker-LSalAtl2s1005-augustus-gene-0.8")

HSP 1 Score: 86.2705 bits (212), Expect = 4.139e-22
Identity = 55/97 (56.70%), Postives = 60/97 (61.86%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGTN-ETMICAAAPRKDSCQ 73
            MFGSLGMNYDICLLK KS  D N+K KPVALP+   EF GDVV++GWGTI                        DA YG+N ET ICAAAP KDSCQ
Sbjct:  122 MFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQ 218          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000000023 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582:2451:1 gene:EMLSAG00000000023 transcript:EMLSAT00000000023 description:"augustus_masked-LSalAtl2s1005-processed-gene-0.0")

HSP 1 Score: 80.8777 bits (198), Expect = 1.623e-20
Identity = 52/96 (54.17%), Postives = 58/96 (60.42%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIY-----------------------DARYG-TNETMICAAAPRKDSCQ 73
            FGS G NYD+CLLK KS  D N+K KPVALPE   EF GDVV++GWGTI                        DA +G T+ETMICAAAP KDSCQ
Sbjct:   34 FGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQ 129          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000010924 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:259189:288108:-1 gene:EMLSAG00000010924 transcript:EMLSAT00000010924 description:"maker-LSalAtl2s730-snap-gene-2.5")

HSP 1 Score: 73.9442 bits (180), Expect = 1.522e-17
Identity = 49/97 (50.52%), Postives = 55/97 (56.70%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIY-----------------------DARYG-TNETMICAAAPRKDSCQ 73
            MF + G NYD+CLLK KS  D N+K KPVALPE   EF GD V++GWGTIY                       DA  G T+ETMICAAA  K SCQ
Sbjct:  184 MFETHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDAVVSGWGTIYSDGPSSPLLRSVTVQIVSDEDCSDAYPGSTDETMICAAAAGKXSCQ 280          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000002836 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:13958:14826:-1 gene:EMLSAG00000002836 transcript:EMLSAT00000002836 description:"maker-LSalAtl2s1638-augustus-gene-0.2")

HSP 1 Score: 72.4034 bits (176), Expect = 3.388e-17
Identity = 47/96 (48.96%), Postives = 55/96 (57.29%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYG-TNETMICAAAPRKDSCQ 73
            FG+ G NYDICLLK KS    N+K KPVALPE   EF GDVV++GWGT+                        DA  G T+E+MICA +P KDSCQ
Sbjct:  108 FGTYGPNYDICLLKLKSSLALNEKVKPVALPEKDQEFTGDVVVSGWGTVEFGGSSSDVLRSVTLQLVSDEYCSDAYDGHTDESMICAGSPGKDSCQ 203          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000007886 (pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646:53754:1 gene:EMLSAG00000007886 transcript:EMLSAT00000007886 description:"maker-LSalAtl2s464-augustus-gene-0.4")

HSP 1 Score: 64.3142 bits (155), Expect = 2.447e-14
Identity = 38/96 (39.58%), Postives = 49/96 (51.04%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-------------------YDARY-----GTNETMICAAAPRKDSCQ 73
            F S G+N DICLL+ +   +FND  KPV LPE      G+VV++GWGT+                   Y   Y     G +E+MICA+   KDSCQ
Sbjct:  120 FASKGINNDICLLEVEHPFEFNDNVKPVTLPEKEFTPTGEVVVSGWGTLRANGNSSPVLRTVTLNMVPYLRCYINYIGGLDESMICASGKGKDSCQ 215          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000004826 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:382958:388781:1 gene:EMLSAG00000004826 transcript:EMLSAT00000004826 description:"maker-LSalAtl2s254-snap-gene-3.35")

HSP 1 Score: 57.7658 bits (138), Expect = 1.583e-11
Identity = 33/96 (34.38%), Postives = 47/96 (48.96%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI------------YDARY------------GTNETMICAAAPRKDSCQ 73
            + + G N DICLLK +S  +FNDK   V LP    +F G V ++GWG++             D +               +++M+CA A RKDSCQ
Sbjct:  137 YATKGTNNDICLLKLESSLEFNDKVDAVNLPRKNKKFKGKVRVSGWGSVTPGGESSDFLRSVDVKIMSFAKCNLLYLNALDKSMLCAGARRKDSCQ 232          
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Match: EMLSAP00000005416 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2918:1117:2218:1 gene:EMLSAG00000005416 transcript:EMLSAT00000005416 description:"maker-LSalAtl2s2918-snap-gene-0.4")

HSP 1 Score: 51.6026 bits (122), Expect = 1.070e-9
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTIYDAR----------------------YGT--NETMICAAAPRKDSCQ 73
            FG+ G+N DIC+L  +    FN+    +        F GD V++GWGT Y                         YG+  +++MICAAAP KDSCQ
Sbjct:   94 FGTSGVNNDICILHLEKPLKFNE----LQCLTKIXXFEGDAVISGWGTTYSGAPPSFVXRWAKVNIVSKAECQNAYGSLLDDSMICAAAPGKDSCQ 185          
BLAST of EMLSAG00000000024 vs. Select Arthropod Genomes
Match: gb|EFA05680.2| (serine protease P151 [Tribolium castaneum])

HSP 1 Score: 46.9802 bits (110), Expect = 4.374e-7
Identity = 24/47 (51.06%), Postives = 30/47 (63.83%), Query Frame = 0
Query:    3 GSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGT 49
            G +G N DI LLK  +  +F D  +P+ LPE   EF GD VLTGWG+
Sbjct:  117 GRVGPN-DIALLKLATPLEFGDLVQPIGLPEPGSEFTGDSVLTGWGS 162          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|31563314|gb|AAP55755.1| (trypsin 1c, partial [Lepeophtheirus salmonis])

HSP 1 Score: 92.8189 bits (229), Expect = 1.848e-21
Identity = 51/97 (52.58%), Postives = 58/97 (59.79%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            MF S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  120 MFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 216          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031226|gb|AAL71880.1| (trypsin type 6, partial [Lepeophtheirus salmonis])

HSP 1 Score: 92.4337 bits (228), Expect = 1.849e-21
Identity = 51/97 (52.58%), Postives = 58/97 (59.79%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            MF S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  106 MFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 202          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031228|gb|AAL71881.1| (trypsin type 7, partial [Lepeophtheirus salmonis])

HSP 1 Score: 92.8189 bits (229), Expect = 1.997e-21
Identity = 51/97 (52.58%), Postives = 58/97 (59.79%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            MF S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  119 MFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 215          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031224|gb|AAL71879.1| (trypsin type 5, partial [Lepeophtheirus salmonis])

HSP 1 Score: 90.5077 bits (223), Expect = 1.065e-20
Identity = 50/97 (51.55%), Postives = 58/97 (59.79%), Query Frame = 0
Query:    1 MFGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            MF S G NYD+CLLK KS   FN+K KP+ALP+   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:   97 MFASHGTNYDVCLLKLKSSLHFNEKVKPIALPKKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 193          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|31563316|gb|AAP55756.1| (trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|gb|AAP55757.1| trypsin 1aii [Lepeophtheirus salmonis] >gi|31563320|gb|AAP55758.1| trypsin 1aiii [Lepeophtheirus salmonis] >gi|31563324|gb|AAP55760.1| trypsin 1a [Lepeophtheirus salmonis] >gi|71534674|emb|CAH61461.1| putative trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 90.5077 bits (223), Expect = 1.498e-20
Identity = 50/96 (52.08%), Postives = 57/96 (59.38%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  123 FASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 218          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|31563322|gb|AAP55759.1| (trypsin 1b [Lepeophtheirus salmonis])

HSP 1 Score: 90.5077 bits (223), Expect = 1.521e-20
Identity = 50/96 (52.08%), Postives = 57/96 (59.38%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  122 FASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 217          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031218|gb|AAL71876.1| (trypsin type 2, partial [Lepeophtheirus salmonis])

HSP 1 Score: 90.5077 bits (223), Expect = 1.641e-20
Identity = 50/96 (52.08%), Postives = 57/96 (59.38%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  119 FASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 214          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031220|gb|AAL71877.1| (trypsin type 3, partial [Lepeophtheirus salmonis])

HSP 1 Score: 90.1225 bits (222), Expect = 1.825e-20
Identity = 50/96 (52.08%), Postives = 56/96 (58.33%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN K KP+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  119 FASHGTNYDVCLLKLKSSLHFNKKVKPIALPEKEQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 214          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031216|gb|AAL71875.1| (trypsin type 1, partial [Lepeophtheirus salmonis])

HSP 1 Score: 90.1225 bits (222), Expect = 1.908e-20
Identity = 49/96 (51.04%), Postives = 57/96 (59.38%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K KP+ALPE   EF GDVV++GWGTI                        +A YG+ +ETMICAAAP KDSCQ
Sbjct:  121 FASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSBAYYGSIDETMICAAAPGKDSCQ 216          
BLAST of EMLSAG00000000024 vs. nr
Match: gi|19031222|gb|AAL71878.1| (trypsin type 4, partial [Lepeophtheirus salmonis])

HSP 1 Score: 87.8113 bits (216), Expect = 1.129e-19
Identity = 49/96 (51.04%), Postives = 56/96 (58.33%), Query Frame = 0
Query:    2 FGSLGMNYDICLLKSKSREDFNDKGKPVALPENYLEFNGDVVLTGWGTI-----------------------YDARYGT-NETMICAAAPRKDSCQ 73
            F S G NYD+CLLK KS   FN+K  P+ALPE   EF GDVV++GWGTI                        DA YG+ +ETMICAAAP KDSCQ
Sbjct:  109 FASHGTNYDVCLLKLKSSLHFNEKVNPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQ 204          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000024 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 4
Match NameE-valueIdentityDescription
-2.583e-837.23symbol:Q52V24 "Hepatopancreas trypsin" species:671... [more]
-8.412e-536.21symbol:CG31265 species:7227 "Drosophila melanogast... [more]
-2.096e-428.79symbol:PRSS2 "Uncharacterized protein" species:903... [more]
-5.303e-428.79symbol:Q90629 "Trypsin II-P29" species:9031 "Gallu... [more]
back to top
BLAST of EMLSAG00000000024 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592915793|gb|GAXK01042582.1|8.993e-430.11TSA: Calanus finmarchicus comp212969_c1_seq1 trans... [more]
gi|592778098|gb|GAXK01176470.1|6.273e-327.88TSA: Calanus finmarchicus comp3490_c3_seq1 transcr... [more]
gi|592918135|gb|GAXK01040240.1|6.434e-325.51TSA: Calanus finmarchicus comp146195_c0_seq1 trans... [more]
gi|592753767|gb|GAXK01200646.1|6.582e-340.00TSA: Calanus finmarchicus comp365683_c0_seq2 trans... [more]
gi|592778099|gb|GAXK01176469.1|7.913e-327.63TSA: Calanus finmarchicus comp3490_c0_seq1 transcr... [more]
gi|592859562|gb|GAXK01098000.1|2.109e-226.73TSA: Calanus finmarchicus comp38145_c4_seq2 transc... [more]
gi|592942310|gb|GAXK01016243.1|3.687e-225.29TSA: Calanus finmarchicus comp4948996_c0_seq1 tran... [more]
gi|592843345|gb|GAXK01114199.1|7.335e-237.50TSA: Calanus finmarchicus comp3446942_c0_seq1 tran... [more]
gi|592767678|gb|GAXK01186890.1|8.934e-242.86TSA: Calanus finmarchicus comp439630_c0_seq1 trans... [more]
gi|592877485|gb|GAXK01080251.1|2.248e-129.17TSA: Calanus finmarchicus comp392318_c0_seq8 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000024 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 11
Match NameE-valueIdentityDescription
EMLSAP000000000241.137e-50100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1832... [more]
EMLSAP000000048281.032e-2352.08pep:novel supercontig:LSalAtl2s:LSalAtl2s254:39724... [more]
EMLSAP000000109252.024e-2351.55pep:novel supercontig:LSalAtl2s:LSalAtl2s730:28349... [more]
EMLSAP000000000254.139e-2256.70pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858... [more]
EMLSAP000000000231.623e-2054.17pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582... [more]
EMLSAP000000109241.522e-1750.52pep:novel supercontig:LSalAtl2s:LSalAtl2s730:25918... [more]
EMLSAP000000028363.388e-1748.96pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:1395... [more]
EMLSAP000000078862.447e-1439.58pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646... [more]
EMLSAP000000048261.583e-1134.38pep:novel supercontig:LSalAtl2s:LSalAtl2s254:38295... [more]
EMLSAP000000054161.070e-934.38pep:novel supercontig:LSalAtl2s:LSalAtl2s2918:1117... [more]

Pages

back to top
BLAST of EMLSAG00000000024 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000024 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 1
Match NameE-valueIdentityDescription
gb|EFA05680.2|4.374e-751.06serine protease P151 [Tribolium castaneum][more]
back to top
BLAST of EMLSAG00000000024 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|31563314|gb|AAP55755.1|1.848e-2152.58trypsin 1c, partial [Lepeophtheirus salmonis][more]
gi|19031226|gb|AAL71880.1|1.849e-2152.58trypsin type 6, partial [Lepeophtheirus salmonis][more]
gi|19031228|gb|AAL71881.1|1.997e-2152.58trypsin type 7, partial [Lepeophtheirus salmonis][more]
gi|19031224|gb|AAL71879.1|1.065e-2051.55trypsin type 5, partial [Lepeophtheirus salmonis][more]
gi|31563316|gb|AAP55756.1|1.498e-2052.08trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|... [more]
gi|31563322|gb|AAP55759.1|1.521e-2052.08trypsin 1b [Lepeophtheirus salmonis][more]
gi|19031218|gb|AAL71876.1|1.641e-2052.08trypsin type 2, partial [Lepeophtheirus salmonis][more]
gi|19031220|gb|AAL71877.1|1.825e-2052.08trypsin type 3, partial [Lepeophtheirus salmonis][more]
gi|19031216|gb|AAL71875.1|1.908e-2051.04trypsin type 1, partial [Lepeophtheirus salmonis][more]
gi|19031222|gb|AAL71878.1|1.129e-1951.04trypsin type 4, partial [Lepeophtheirus salmonis][more]

Pages

back to top
BLAST of EMLSAG00000000024 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1005supercontigLSalAtl2s1005:18324..18734 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Notetrypsin 1c, partial [Lepeophtheirus salmonis]
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1005-snap-gene-0.11
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000024 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000024EMLSAT00000000024-695871Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1005:18324..18734-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000024-682790 ID=EMLSAG00000000024-682790|Name=EMLSAG00000000024|organism=Lepeophtheirus salmonis|type=gene|length=411bp|location=Sequence derived from alignment at LSalAtl2s1005:18324..18734- (Lepeophtheirus salmonis)
ATGTTTGGATCCCTGGGCATGAACTATGACATTTGTCTTTTGAAATCAAA GTCCAGGGAGGACTTCAACGAGTAAAAACTAAATCATACCATTTCTTTTT TAAATAGTTAATAACTATTGTTTATTAAGTAAAGGCAAGCCTGTTGCTCT CCCAGAAAATTACCTAGAATTCAACGGTGATGTTGTTTTGACCGGATGGG GAACTATCTAGTACAGTGGCCCACCTTTTCCAGTCTTTAGGTCAGTTACT TTCCATGTTGTTTCTGATGATGGAGACAATAAAAATAATATTTATACCTT GAAAAGAAATTTACATCTATAAATTATATTAAAATAGACTGAAGCGATGC CCGCTATGGTACTAATGAGACTATGATATGTGCTGCTGCTCCCCGAAAGG ACTCCTGCCAA
back to top
Add to Basket