EMLSAG00000000025, EMLSAG00000000025-682791 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000025
Unique NameEMLSAG00000000025-682791
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:Q52V24 "Hepatopancreas trypsin" species:6717 "Pontastacus leptodactylus" [GO:0005515 "protein binding" evidence=IPI] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0046872 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 PDB:4BNR PDBsum:4BNR EMBL:AY906961 PDB:2F91 PDBsum:2F91 IntAct:Q52V24 MEROPS:S01.035 EvolutionaryTrace:Q52V24 Uniprot:Q52V24)

HSP 1 Score: 208.764 bits (530), Expect = 8.877e-65
Identity = 119/233 (51.07%), Postives = 147/233 (63.09%), Query Frame = 0
Query:   42 IVGGEEAEPNSIPFQISFQTTG---DFHFCGGSVMDKDTVITAAHCC---DSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAAAP--GKDSCQGDSGGPLAQDGT----LVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            IVGG +A     P+Q+SFQ T     FHFCG S+ +++  ITA HC    D  N   +Q+VAGE D+    G EQ I V  I  HE F    ++ DI LLKL  SL  N+ V P+ALP++    TGDV+V+GWGT S  G +  VL+ VTV +VSDE C  A YG+++  ++ ICA  P  GKDSCQGDSGGPLA   T    L GIVSWGYGCA PGYPGVY +VS  +DWI
Sbjct:    1 IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCAYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCR-ADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWI 232          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:Prss1 "Anionic trypsin-1" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:3417 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0007584 GO:GO:0031000 GO:GO:0004252 GO:GO:0035094 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 OrthoDB:EOG75B84T HOGENOM:HOG000251820 TreeFam:TF331065 CTD:5644 GeneTree:ENSGT00740000115192 KO:K01312 EMBL:V01273 EMBL:J00778 PIR:B22657 RefSeq:NP_036767.1 UniGene:Rn.34435 ProteinModelPortal:P00762 SMR:P00762 STRING:10116.ENSRNOP00000043068 MEROPS:S01.094 PhosphoSite:P00762 PaxDb:P00762 PRIDE:P00762 Ensembl:ENSRNOT00000040403 GeneID:24691 KEGG:rno:24691 UCSC:RGD:3417 InParanoid:P00762 OMA:HPQYNSW NextBio:604133 PRO:PR:P00762 Genevestigator:P00762 Uniprot:P00762)

HSP 1 Score: 182.57 bits (462), Expect = 1.969e-54
Identity = 100/223 (44.84%), Postives = 132/223 (59.19%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG     +S+P+Q+S  +   +HFCGGS+++   V++AAHC  S     +QV  GEH++    GDEQ I    I  H  + S  +N DI L+KL S + LN +V PVALP          ++SGWG   SNG+++P +L+ V   V+S   C  AY G    + IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA P  PGVY KV  F+ WI
Sbjct:   23 KIVGGYTCPEHSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCYKS----RIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI 239          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:Prss1 "protease, serine, 1 (trypsin 1)" species:10116 "Rattus norvegicus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IDA] [GO:0007584 "response to nutrient" evidence=IEP] [GO:0007586 "digestion" evidence=TAS] [GO:0010033 "response to organic substance" evidence=IEP] [GO:0031000 "response to caffeine" evidence=IDA] [GO:0035094 "response to nicotine" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 RGD:3417 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0007584 GO:GO:0031000 GO:GO:0004252 GO:GO:0035094 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 OrthoDB:EOG75B84T HOGENOM:HOG000251820 TreeFam:TF331065 CTD:5644 GeneTree:ENSGT00740000115192 KO:K01312 EMBL:V01273 EMBL:J00778 PIR:B22657 RefSeq:NP_036767.1 UniGene:Rn.34435 ProteinModelPortal:P00762 SMR:P00762 STRING:10116.ENSRNOP00000043068 MEROPS:S01.094 PhosphoSite:P00762 PaxDb:P00762 PRIDE:P00762 Ensembl:ENSRNOT00000040403 GeneID:24691 KEGG:rno:24691 UCSC:RGD:3417 InParanoid:P00762 OMA:HPQYNSW NextBio:604133 PRO:PR:P00762 Genevestigator:P00762 Uniprot:P00762)

HSP 1 Score: 182.57 bits (462), Expect = 1.969e-54
Identity = 100/223 (44.84%), Postives = 132/223 (59.19%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG     +S+P+Q+S  +   +HFCGGS+++   V++AAHC  S     +QV  GEH++    GDEQ I    I  H  + S  +N DI L+KL S + LN +V PVALP          ++SGWG   SNG+++P +L+ V   V+S   C  AY G    + IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA P  PGVY KV  F+ WI
Sbjct:   23 KIVGGYTCPEHSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCYKS----RIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI 239          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:Try29F "Trypsin 29F" species:7227 "Drosophila melanogaster" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA;ISS;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 EMBL:AE014134 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 KO:K01312 GeneTree:ENSGT00620000088101 MEROPS:S01.A91 FlyBase:FBgn0015316 RefSeq:NP_523518.2 UniGene:Dm.2653 ProteinModelPortal:Q9VLF5 SMR:Q9VLF5 MINT:MINT-1601632 PRIDE:Q9VLF5 EnsemblMetazoa:FBtr0301665 GeneID:34226 KEGG:dme:Dmel_CG9564 CTD:34226 InParanoid:Q9VLF5 PhylomeDB:Q9VLF5 GenomeRNAi:34226 NextBio:787484 Bgee:Q9VLF5 Uniprot:Q9VLF5)

HSP 1 Score: 182.57 bits (462), Expect = 2.972e-54
Identity = 104/233 (44.64%), Postives = 139/233 (59.66%), Query Frame = 0
Query:   35 RHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY--YGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIA 261
            R R  GRIVGG+ A    IP+Q+S Q +  +HFCGGS++ +  V+TAAHC +       +V  G      TS   Q + +K +  H  F +  +++D  LL+L+     N     V LP++D +      V+VSGWG   S   +S VLRSVTV  VS   C++AY  +GS  +  +CA  P  GKD+CQGDSGGPLA DG L G+VSWGYGCA P YPGVY++VS   DWI+
Sbjct:   35 RPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:lambdaTry "lambdaTry" species:7227 "Drosophila melanogaster" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 EMBL:AE013599 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 OrthoDB:EOG75B84T KO:K01312 EMBL:U04853 GeneTree:ENSGT00620000088101 EMBL:AY070589 RefSeq:NP_610673.1 UniGene:Dm.6365 STRING:7227.FBpp0087222 MEROPS:S01.A87 EnsemblMetazoa:FBtr0088121 GeneID:36214 KEGG:dme:Dmel_CG12350 UCSC:CG12350-RA CTD:36214 FlyBase:FBgn0043470 InParanoid:Q7JPN9 OMA:ETDITHY GenomeRNAi:36214 NextBio:797374 Uniprot:Q7JPN9)

HSP 1 Score: 178.718 bits (452), Expect = 1.092e-52
Identity = 96/265 (36.23%), Postives = 146/265 (55.09%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWE-VQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            M R +   L L    +   P  +  E  +       +  GRIVGG++      P QIS +  G+ H CGG++   + +I+AAHC ++ +  E + +VAG  +++  +G +Q++ V++I  H  + +L  +YD  +L L    + N+ V+P+ L K+  +    V V+GWGT S  G  S VL+ V+V VV +  C +AY        +CA     GKD+CQGDSGGPL  + TL+GIVSWG GCA   YPGVY  V   +DW+ +
Sbjct:    1 MSRILVVFLVLGVGCSLADPIYRNEEVHIP------KLDGRIVGGQDTNITQYPHQISMRYRGN-HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:CG17571 species:7227 "Drosophila melanogaster" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 EMBL:AE014134 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG7MKW6Q GeneTree:ENSGT00620000088101 RefSeq:NP_610109.1 UniGene:Dm.11963 ProteinModelPortal:Q9W5U8 SMR:Q9W5U8 MEROPS:S01.A85 PRIDE:Q9W5U8 EnsemblMetazoa:FBtr0081376 GeneID:35409 KEGG:dme:Dmel_CG17571 UCSC:CG17571-RA FlyBase:FBgn0259998 InParanoid:Q9W5U8 PhylomeDB:Q9W5U8 GenomeRNAi:35409 NextBio:793384 Bgee:Q9W5U8 Uniprot:Q9W5U8)

HSP 1 Score: 176.407 bits (446), Expect = 6.452e-52
Identity = 100/226 (44.25%), Postives = 135/226 (59.73%), Query Frame = 0
Query:   40 GRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCS-DAY-YGSND--ETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            GRIV GE+ +  + P+Q+S QTT   HFCGGS++D +TV+TAAHC  S+ + E+QV  G     S S   + + V+   YHE + S  M  D+ ++KL S +    K++ + L   +     + VVSGWGT      SSP  L+ V V ++  + C+ D Y YGS+   ET +CA    KD+CQGDSGGPL  D  LVG+VSWG GCA  GYPGVYA V+    WI
Sbjct:   29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGST---SRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:CG31954 species:7227 "Drosophila melanogaster" [GO:0004175 "endopeptidase activity" evidence=ISS] [GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS] [GO:0006508 "proteolysis" evidence=IEA;NAS] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 EMBL:AE014134 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 OrthoDB:EOG75B84T GeneTree:ENSGT00620000088101 EMBL:BT023549 RefSeq:NP_722915.1 UniGene:Dm.26720 SMR:Q8IQ10 STRING:7227.FBpp0077252 MEROPS:S01.B79 EnsemblMetazoa:FBtr0077563 GeneID:33572 KEGG:dme:Dmel_CG31954 UCSC:CG31954-RA FlyBase:FBgn0051954 InParanoid:Q8IQ10 OMA:NTQNLLE GenomeRNAi:33572 NextBio:784264 Uniprot:Q8IQ10)

HSP 1 Score: 174.481 bits (441), Expect = 4.975e-51
Identity = 107/269 (39.78%), Postives = 147/269 (54.65%), Query Frame = 0
Query:    6 CALLFLVTAANAVPPQIKYSESFMKVKS----MRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFT-GDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY--YGSNDETNICAA--APGKDSCQGDSGGPL-AQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            C+LL L      +P  +K   S   V      +  R  GRIVGG        P Q+S QT+   H CGGS++ ++ ++TAAHC     +  ++V  G  + F+ SG  Q + V+ I  H  F    ++YD  LL+L   +  +E  K V LP+   ++  G+   VSGWG   +   S   LR V V +V+ E CS+ Y  YG   E  ICA     GKD+CQGDSGGP+ ++ G LVG+VSWGYGCA P YPGVY++VS   DWI +H
Sbjct:   12 CSLLVLAGVC-LIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSS--HICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE-FARSG--QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEH 274          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:P00761 "Trypsin" species:9823 "Sus scrofa" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0007586 "digestion" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0005615 GO:GO:0046872 GO:GO:0007586 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 HOGENOM:HOG000251820 PDB:1Z7K PDBsum:1Z7K PDB:4DOQ PDBsum:4DOQ PDB:1TFX PDBsum:1TFX PIR:A90641 PDB:1AKS PDB:1AN1 PDB:1AVW PDB:1AVX PDB:1C9P PDB:1D3O PDB:1DF2 PDB:1EJA PDB:1EPT PDB:1EWU PDB:1FMG PDB:1FN6 PDB:1FNI PDB:1H9H PDB:1H9I PDB:1LDT PDB:1LT2 PDB:1MCT PDB:1QQU PDB:1S5S PDB:1S6F PDB:1S6H PDB:1S81 PDB:1S82 PDB:1S83 PDB:1S84 PDB:1S85 PDB:1TX6 PDB:1UHB PDB:1V6D PDB:1YF4 PDB:2A31 PDB:2A32 PDB:3MYW PDB:4AN7 PDBsum:1AKS PDBsum:1AN1 PDBsum:1AVW PDBsum:1AVX PDBsum:1C9P PDBsum:1D3O PDBsum:1DF2 PDBsum:1EJA PDBsum:1EPT PDBsum:1EWU PDBsum:1FMG PDBsum:1FN6 PDBsum:1FNI PDBsum:1H9H PDBsum:1H9I PDBsum:1LDT PDBsum:1LT2 PDBsum:1MCT PDBsum:1QQU PDBsum:1S5S PDBsum:1S6F PDBsum:1S6H PDBsum:1S81 PDBsum:1S82 PDBsum:1S83 PDBsum:1S84 PDBsum:1S85 PDBsum:1TX6 PDBsum:1UHB PDBsum:1V6D PDBsum:1YF4 PDBsum:2A31 PDBsum:2A32 PDBsum:3MYW PDBsum:4AN7 ProteinModelPortal:P00761 SMR:P00761 DIP:DIP-6083N IntAct:P00761 MINT:MINT-1512991 STRING:9823.ENSSSCP00000017465 BindingDB:P00761 ChEMBL:CHEMBL2366 PaxDb:P00761 PRIDE:P00761 EvolutionaryTrace:P00761 ArrayExpress:P00761 Uniprot:P00761)

HSP 1 Score: 172.94 bits (437), Expect = 5.184e-51
Identity = 96/225 (42.67%), Postives = 129/225 (57.33%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            +IVGG     NSIP+Q+S  +    HFCGGS+++   V++AAHC  S     +QV  GEH++    G+EQ I    I  H  F    ++ DI L+KL S   LN +V  V+LP+       + ++SGWG   S+G S P +L+ +   V+SD  C  +Y G      IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA    PGVY KV  +++WI Q
Sbjct:    8 KIVGGYTCAANSIPYQVSLNSGS--HFCGGSLINSQWVVSAAHCYKS----RIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQ 226          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:LOC100302368 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T TreeFam:TF331065 GeneTree:ENSGT00740000115192 EMBL:FP236615 Ensembl:ENSSSCT00000017947 OMA:TAENDIM ArrayExpress:F1SRS2 Uniprot:F1SRS2)

HSP 1 Score: 173.326 bits (438), Expect = 5.890e-51
Identity = 96/225 (42.67%), Postives = 129/225 (57.33%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            +IVGG     NSIP+Q+S  +    HFCGGS+++   V++AAHC  S     +QV  GEH++    G+EQ I    I  H  F    ++ DI L+KL S   LN +V  V+LP+       + ++SGWG   S+G S P +L+ +   V+SD  C  +Y G      IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA    PGVY KV  +++WI Q
Sbjct:   23 KIVGGYTCAANSIPYQVSLNSGS--HFCGGSLINSQWVVSAAHCYKS----RIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQ 241          
BLAST of EMLSAG00000000025 vs. GO
Match: - (symbol:zgc:66382 "zgc:66382" species:7955 "Danio rerio" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0006508 "proteolysis" evidence=IEA] [GO:0003824 "catalytic activity" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0008233 "peptidase activity" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0008236 "serine-type peptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 ZFIN:ZDB-GENE-030131-1173 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T TreeFam:TF331065 GeneTree:ENSGT00740000115192 EMBL:FP102797 Ensembl:ENSDART00000148846 OMA:DRDCENS Bgee:F8W3C3 Uniprot:F8W3C3)

HSP 1 Score: 172.94 bits (437), Expect = 1.018e-50
Identity = 97/223 (43.50%), Postives = 132/223 (59.19%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIA 261
            +IVGG E +PNS P+Q S  +   +HFCGGS++ +  V++AAHC  S     V+V  GEH++    G EQ I  + +  +  + S  ++ DI L+KL     LN+ V+PVALP           VSGWG   S+   S  L+ + + ++SD  C+++Y G   +T  CA     GKDSCQGDSGGP+  +G L GIVSWGYGCA   +PGVY KV MF  WIA
Sbjct:   28 KIVGGYECQPNSQPWQASLNS--GYHFCGGSLVSEYWVVSAAHCYKS----RVEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIA 244          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592778098|gb|GAXK01176470.1| (TSA: Calanus finmarchicus comp3490_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 195.667 bits (496), Expect = 1.104e-58
Identity = 121/280 (43.21%), Postives = 162/280 (57.86%), Query Frame = 0
Query:    1 MIRF--VCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFG-GRIVGGEEAEPNSIPFQISFQTTGDF---HFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTG--DVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSN---DETNICAAAP--GKDSCQGDSGGPL--AQDGT--LVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            M++F  V +L F  T+A  +P         +    ++ + G GRIVGGEEA     P+Q+S ++ G     HFCGGS++DKD ++TAAHCC +     V VVAG   L +   +E+   +  I  H  + S  +  D CLLKLK SL+  E V+P+ALP   Q+     +  V+GWGT+S  G   P VL  VTV VVSDE C+ +Y  S     ++ ICA     GKDSCQGDSGGP    + G+  LVG+VSWG GCA  GYPGVY + S F+DWI +
Sbjct:  224 MMKFFLVASLAFAATSAANLPSHP------LPALPLQDQVGVGRIVGGEEAVDGEFPWQVSLRSIGALGATHFCGGSIIDKDWILTAAHCCANQVPATVHVVAGGIKLNNFENEEEPRNLDHIISHPNYASATITNDACLLKLKESLEFTEFVQPIALPASGQDTPAGTECTVTGWGTLSEGGFGLPNVLHKVTVPVVSDEDCNASYGASGYSVADSMICAGVEEGGKDSCQGDSGGPFFCGEKGSEELVGVVSWGIGCARKGYPGVYTENSYFVDWIME 1045          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592784512|gb|GAXK01170056.1| (TSA: Calanus finmarchicus comp156_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 185.652 bits (470), Expect = 1.003e-55
Identity = 111/265 (41.89%), Postives = 144/265 (54.34%), Query Frame = 0
Query:    8 LLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQT--TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKV-KPVALPKKDQEFTG--DVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            LL +V  A   P   K+S+  +       R GG+IVGG EA P   P QI+      G    CGGS++  D V+TA HCCD  ++  + V  G H L+    D+  I V  +  HE + S  +  DIC+L+L    DL+  V   ++LP   +E+    +  VSGWGT S  G     L  VTV VVSD+ C  AY G +D  ++ ICA   A GKDSCQGDSGGP      L G+VSWGYGCA  G+PGVY + S FI W+  H
Sbjct:   75 LLAVVAVATGAP---KFSKKALATP--LSRGGGKIVGGTEASPGEFPHQIALLRGGVGGSLMCGGSLVSSDRVVTAGHCCDGQSASRLGVRVGNHHLYEDDADQMDIAVSKVILHEDYDSWTIYNDICMLELSGQADLSSSVIAAISLPSDMEEYPAGTECQVSGWGTTSEGGSLGQTLMKVTVPVVSDDDCRGAY-GQSDIADSMICAGLDAGGKDSCQGDSGGPFMCGSQLSGVVSWGYGCAEAGFPGVYTQTSYFISWLNSH 851          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592778099|gb|GAXK01176469.1| (TSA: Calanus finmarchicus comp3490_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 188.348 bits (477), Expect = 2.653e-55
Identity = 111/232 (47.84%), Postives = 146/232 (62.93%), Query Frame = 0
Query:   40 GRIVGGEEAEPNSIPFQISFQTTGD-FHFCGGSVMDKDTVITAAHCCDSFNSW-EVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGS-LGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISS--NGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLA---QDGT--LVGIVSWGYGCATPGYPGVYAKVSMFIDWIA 261
            G IVGGEEA P+SIP+Q+S + + D  HFCGG+V+  + V++AAHC   ++S  EV VVAGEHD     G EQ +PV  +T HE +GS      DI + +L   L +NE V PV LP+  Q+  G   VSGWGT+ S  +GL S +++ V V VV+D+ C   Y     E+ +CA   GKDSCQGDSGGP+     DG+  L G+VSWG GC    +PGVY +VS F +WIA
Sbjct:  311 GEIVGGEEAAPHSIPWQVSLRRSSDGSHFCGGTVLGPNHVVSAAHCTVIWDSPDEVVVVAGEHDRSVDEGTEQMVPVSKLTVHESYGSPKSFENDIAIWELGEPLVMNENVAPVTLPEAMQQTEGSCTVSGWGTLHSGDSGLPSKLMK-VDVPVVTDQTCKIEYPLQIAESMLCAGEHGKDSCQGDSGGPMVCYNADGSPYLGGVVSWGIGCGGYYHPGVYTEVSYFTEWIA 1003          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592784513|gb|GAXK01170055.1| (TSA: Calanus finmarchicus comp156_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 182.956 bits (463), Expect = 1.748e-54
Identity = 110/265 (41.51%), Postives = 143/265 (53.96%), Query Frame = 0
Query:    8 LLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQT--TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKV-KPVALPKKDQEFT--GDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            LL +V  A   P   K+S+  +       R GG+IVGG EA P   P QI+      G    CGGS++  D V+TA HCCD  ++  + V  G H L+    D+  I V  +  HE + S  +  DIC+L+L    D +  V   ++LP   +E+    +  VSGWGT S  G     L  VTV VVSD+ C  AY G +D  ++ ICA   A GKDSCQGDSGGP      L G+VSWGYGCA  G+PGVY + S FI W+  H
Sbjct:   32 LLAVVAVATGAP---KFSKKALATP--LSRGGGKIVGGTEASPGEFPHQIALLRGGVGGSLMCGGSLVSSDRVVTAGHCCDGQSASRLGVRVGNHHLYEDDPDQMDIAVSKVMLHEDYDSWTIYNDICMLELSGQADFSSSVIGAISLPSDMEEYPVGTECTVSGWGTTSEGGSLGQTLMKVTVPVVSDDDCRGAY-GQSDIADSMICAGLDAGGKDSCQGDSGGPFMCGSQLSGVVSWGYGCAEAGFPGVYTQTSYFISWLNSH 808          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592881151|gb|GAXK01076750.1| (TSA: Calanus finmarchicus comp98234_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 183.341 bits (464), Expect = 1.767e-54
Identity = 101/231 (43.72%), Postives = 135/231 (58.44%), Query Frame = 0
Query:   41 RIVGGEEAEP-NSIPFQISFQTT--GDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPL-------AQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGGEE +P +SIP+Q+S Q T  GD+HFCGGS++    V+TAAHCC   +   V+V+AG+HDL++    EQ + +     H  +       DICLL+L +SL +   V  V      ++FTG   VSGWGT+   G++   L SV V +  D  C + Y      E+ +CA   GKD+CQGDSGGPL        +   L GIVSWG GC   GYPGVY +V+ F DWI
Sbjct:   81 KIVGGEEVDPPHSIPYQVSLQLTEWGDWHFCGGSILTDRVVVTAAHCCYEQDLAGVKVMAGKHDLYAEEEMEQGVSIASAVIHPQYDPWTTENDICLLQLATSLQITSAVNVVRPAVNGEKFTGVGRVSGWGTLEDGGVAPDFLMSVEVPLKDDAECRNVYGDEAVMESMLCAGDTGKDACQGDSGGPLVCRKESSGEFNVLCGIVSWGLGCGRDGYPGVYTEVAYFKDWI 773          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592859852|gb|GAXK01097710.1| (TSA: Calanus finmarchicus comp38035_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 172.17 bits (435), Expect = 6.902e-51
Identity = 101/236 (42.80%), Postives = 134/236 (56.78%), Query Frame = 0
Query:   39 GGRIVGGEEAEPNSIPFQISFQT--TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKV-KPVALPKKDQEFTG--DVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAP--GKDSCQGDSGGPLAQDG---TLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            GG+IVGG EA+    P  +S      G    CGGS++    VITA HCCD  ++  + V  G + L+    D+  I V  +  HE + S  +N DICLL+L    D    V   + LP++ +++    + +V+GWGT S  G  + VL  VTV V+SDE C  AY  S+  ++ ICA     GKDSCQGDSGGPL   G    L GIVSWGYGCA PG+PGVY + S F+ W+  H
Sbjct:    5 GGKIVGGTEADVGEFPHMVSLLRGGVGGSLMCGGSLITPTLVITAGHCCDGQSASRLAVRVGTYHLYEDDPDQVDIAVSKVMLHEDYDSWTINNDICLLELDGQADFGSDVIGGINLPEEGKDYPAGTECIVAGWGTTSEGGSLATVLMKVTVFVLSDEECRGAYGQSDISDSMICAGVEEGGKDSCQGDSGGPLMCGGLPLELSGIVSWGYGCAEPGFPGVYTQTSYFVSWLNSH 712          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592944223|gb|GAXK01014330.1| (TSA: Calanus finmarchicus comp8458_c0_seq8 transcribed RNA sequence)

HSP 1 Score: 171.014 bits (432), Expect = 2.386e-48
Identity = 96/227 (42.29%), Postives = 134/227 (59.03%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQT-TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPK-KDQEFTGDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLA--QDG--TLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            RIVGG E E N  P+Q++  + TG   FCGG+++    V+TAAHC    +  +++V+ GEH   +   ++ K+ V+ IT   ++    M  D  +L LK  +    ++ P  LP   +Q F G V  VSGWGT+ SNG    VL  V V V ++E C + Y     + NICA   GKDSCQGDSGGPL   ++G  +L+G+VS+GYGCA+P  PGVYA+VS    WI
Sbjct:  120 RIVGGVETEVNEYPWQVALVSPTGRSPFCGGTLISNRHVMTAAHCTAGSSPSKMRVLLGEHK--TNDANQIKVEVESITDDPLYNDNNMRNDFSILTLKEPVTFTREISPACLPSYTNQMFAGQVATVSGWGTLQSNGNQPTVLMEVDVTVTTNEVCKNVYGSGISDINICAMDAGKDSCQGDSGGPLVIQENGRFSLIGVVSYGYGCASPNIPGVYARVSERKSWI 794          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592944224|gb|GAXK01014329.1| (TSA: Calanus finmarchicus comp8458_c0_seq7 transcribed RNA sequence)

HSP 1 Score: 171.014 bits (432), Expect = 2.538e-48
Identity = 96/227 (42.29%), Postives = 134/227 (59.03%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQT-TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPK-KDQEFTGDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLA--QDG--TLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            RIVGG E E N  P+Q++  + TG   FCGG+++    V+TAAHC    +  +++V+ GEH   +   ++ K+ V+ IT   ++    M  D  +L LK  +    ++ P  LP   +Q F G V  VSGWGT+ SNG    VL  V V V ++E C + Y     + NICA   GKDSCQGDSGGPL   ++G  +L+G+VS+GYGCA+P  PGVYA+VS    WI
Sbjct:  120 RIVGGVETEVNEYPWQVALVSPTGRSPFCGGTLISNRHVMTAAHCTAGSSPSKMRVLLGEHK--TNDANQIKVEVESITDDPLYNDNNMRNDFSILTLKEPVTFTREISPACLPSYTNQMFAGQVATVSGWGTLQSNGNQPTVLMEVDVTVTTNEVCKNVYGSGISDINICAMDAGKDSCQGDSGGPLVIQENGRFSLIGVVSYGYGCASPNIPGVYARVSERKSWI 794          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592944228|gb|GAXK01014325.1| (TSA: Calanus finmarchicus comp8458_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 171.014 bits (432), Expect = 3.546e-48
Identity = 96/227 (42.29%), Postives = 134/227 (59.03%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQT-TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPK-KDQEFTGDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLA--QDG--TLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            RIVGG E E N  P+Q++  + TG   FCGG+++    V+TAAHC    +  +++V+ GEH   +   ++ K+ V+ IT   ++    M  D  +L LK  +    ++ P  LP   +Q F G V  VSGWGT+ SNG    VL  V V V ++E C + Y     + NICA   GKDSCQGDSGGPL   ++G  +L+G+VS+GYGCA+P  PGVYA+VS    WI
Sbjct:  120 RIVGGVETEVNEYPWQVALVSPTGRSPFCGGTLISNRHVMTAAHCTAGSSPSKMRVLLGEHK--TNDANQIKVEVESITDDPLYNDNNMRNDFSILTLKEPVTFTREISPACLPSYTNQMFAGQVATVSGWGTLQSNGNQPTVLMEVDVTVTTNEVCKNVYGSGISDINICAMDAGKDSCQGDSGGPLVIQENGRFSLIGVVSYGYGCASPNIPGVYARVSERKSWI 794          
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Match: gi|592944227|gb|GAXK01014326.1| (TSA: Calanus finmarchicus comp8458_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 171.014 bits (432), Expect = 3.627e-48
Identity = 96/227 (42.29%), Postives = 134/227 (59.03%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQT-TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPK-KDQEFTGDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLA--QDG--TLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            RIVGG E E N  P+Q++  + TG   FCGG+++    V+TAAHC    +  +++V+ GEH   +   ++ K+ V+ IT   ++    M  D  +L LK  +    ++ P  LP   +Q F G V  VSGWGT+ SNG    VL  V V V ++E C + Y     + NICA   GKDSCQGDSGGPL   ++G  +L+G+VS+GYGCA+P  PGVYA+VS    WI
Sbjct:  120 RIVGGVETEVNEYPWQVALVSPTGRSPFCGGTLISNRHVMTAAHCTAGSSPSKMRVLLGEHK--TNDANQIKVEVESITDDPLYNDNNMRNDFSILTLKEPVTFTREISPACLPSYTNQMFAGQVATVSGWGTLQSNGNQPTVLMEVDVTVTTNEVCKNVYGSGISDINICAMDAGKDSCQGDSGGPLVIQENGRFSLIGVVSYGYGCASPNIPGVYARVSERKSWI 794          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000000025 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858:7782:-1 gene:EMLSAG00000000025 transcript:EMLSAT00000000025 description:"maker-LSalAtl2s1005-augustus-gene-0.8")

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK
Sbjct:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000004828 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:397245:398159:-1 gene:EMLSAG00000004828 transcript:EMLSAT00000004828 description:"augustus_masked-LSalAtl2s254-processed-gene-4.1")

HSP 1 Score: 473.011 bits (1216), Expect = 1.011e-169
Identity = 228/264 (86.36%), Postives = 239/264 (90.53%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M++FVC LLFLV AANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 MMKFVCTLLFLVVAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 264          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000010924 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:259189:288108:-1 gene:EMLSAG00000010924 transcript:EMLSAT00000010924 description:"maker-LSalAtl2s730-snap-gene-2.5")

HSP 1 Score: 432.565 bits (1111), Expect = 9.853e-153
Identity = 219/264 (82.95%), Postives = 231/264 (87.50%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M++F C LLFLV AANA PPQIK+SESFM+VKSMR RFGGRIV GEE EPNSIPFQISFQTT   HFCG SVMDKDT+ITAAHCCDSF  WEVQVVAGEHD FSTSGDEQKI V DITYHEMF + G NYD+CLLKLKSSLDLNEKVKPVALP+KDQEFTGD VVSGWGTI S+G SSP+LRSVTVQ+VSDE CSDAY GS DET ICAAA GK SCQGDSGGPLAQDGTLVGIVSWG GCA PGYPGVY KVS FIDWI +HK
Sbjct:   63 MMKFFCTLLFLVVAANAFPPQIKFSESFMRVKSMRQRFGGRIVRGEEVEPNSIPFQISFQTTRGLHFCGASVMDKDTIITAAHCCDSFFPWEVQVVAGEHDHFSTSGDEQKIAVSDITYHEMFETHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDAVVSGWGTIYSDGPSSPLLRSVTVQIVSDEDCSDAYPGSTDETMICAAAAGKXSCQGDSGGPLAQDGTLVGIVSWGRGCAFPGYPGVYGKVSQFIDWIVEHK 326          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000010925 (pep:novel supercontig:LSalAtl2s:LSalAtl2s730:283497:284811:1 gene:EMLSAG00000010925 transcript:EMLSAT00000010925 description:"maker-LSalAtl2s730-augustus-gene-3.19")

HSP 1 Score: 420.239 bits (1079), Expect = 2.767e-149
Identity = 201/236 (85.17%), Postives = 212/236 (89.83%), Query Frame = 0
Query:   29 MKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M+ KSMRHRFGGRIVGGEE EPNSIPFQ+SFQTTG FHFCG SVMDKDT+ITAAHCCDSF  WEVQVVAGEHDLFSTSGDEQ I V DITYHEMF S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G +SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGK SCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWI +HK
Sbjct:    1 MRXKSMRHRFGGRIVGGEEVEPNSIPFQVSFQTTGGFHFCGASVMDKDTIITAAHCCDSFFPWEVQVVAGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKXSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIVEHK 236          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000002836 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:13958:14826:-1 gene:EMLSAG00000002836 transcript:EMLSAT00000002836 description:"maker-LSalAtl2s1638-augustus-gene-0.2")

HSP 1 Score: 348.591 bits (893), Expect = 7.968e-121
Identity = 181/264 (68.56%), Postives = 205/264 (77.65%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M++F+CALLFL  AANA                M+H   GRIVGG+E EPNSIPFQIS + +G +HFCGGSVMDKDT+ITA HCC +    ++ VVAGEHD  S SGDEQKI V ++  H+ FG+ G NYDICLLKLKSSL LNEKVKPVALP+KDQEFTGDVVVSGWGT+   G SS VLRSVT+Q+VSDEYCSDAY G  DE+ ICA +PGKDSCQGDSGGPL QDGTLVGIVSWG GCA PGYPG+Y KVS FIDWIA+ K
Sbjct:    1 MMKFLCALLFLAVAANAG-------------SIMKHS--GRIVGGDEVEPNSIPFQISIEISGGYHFCGGSVMDKDTIITAGHCCTNLKPEDILVVAGEHDFLSMSGDEQKIAVSEMXRHDKFGTYGPNYDICLLKLKSSLALNEKVKPVALPEKDQEFTGDVVVSGWGTVEFGGSSSDVLRSVTLQLVSDEYCSDAYDGHTDESMICAGSPGKDSCQGDSGGPLTQDGTLVGIVSWGNGCAFPGYPGIYGKVSKFIDWIAEQK 249          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000007886 (pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646:53754:1 gene:EMLSAG00000007886 transcript:EMLSAT00000007886 description:"maker-LSalAtl2s464-augustus-gene-0.4")

HSP 1 Score: 286.574 bits (732), Expect = 2.605e-96
Identity = 137/241 (56.85%), Postives = 173/241 (71.78%), Query Frame = 0
Query:   24 YSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            ++  +  + +MR+    +IVGG EA+P+SIPFQ+SFQ    FHFCGGS++D+ TVITA HCC  F+  +VQVV G HD  S  G EQ   +  ITYHE F S G+N DICLL+++   + N+ VKPV LP+K+   TG+VVVSGWGT+ +NG SSPVLR+VT+ +V    C   Y G  DE+ ICA+  GKDSCQGDSGGPL Q+ TLVGIVSWG GCA P +PGVY KVSMFIDWI ++K
Sbjct:   21 FTSEYRLIHAMRYMGESKIVGGTEAQPHSIPFQVSFQRKNGFHFCGGSILDETTVITAGHCCKGFSINDVQVVVGAHDFNSPEGTEQTQNIVKITYHENFASKGINNDICLLEVEHPFEFNDNVKPVTLPEKEFTPTGEVVVSGWGTLRANGNSSPVLRTVTLNMVPYLRCYINYIGGLDESMICASGKGKDSCQGDSGGPLVQENTLVGIVSWGIGCAHPWFPGVYTKVSMFIDWIHENK 261          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000000023 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582:2451:1 gene:EMLSAG00000000023 transcript:EMLSAT00000000023 description:"augustus_masked-LSalAtl2s1005-processed-gene-0.0")

HSP 1 Score: 270.396 bits (690), Expect = 2.757e-91
Identity = 145/174 (83.33%), Postives = 152/174 (87.36%), Query Frame = 0
Query:   92 EVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG-YGCATPGYPGVYAKVSMFIDWIAQHK 264
            +VQ +A EHDLFS SGDEQK+ V  ITYHE FGS G NYD+CLLKLKSSLDLNEKVKPVALP+KDQEFTGDVVVSGWGTI SNG S PVLRSVTV VVSDE CSDAY+GS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWG  GCA PGYPGVY KVS FIDWIA+ K
Sbjct:    3 DVQXIAAEHDLFSISGDEQKVGVSKITYHEKFGSHGTNYDVCLLKLKSSLDLNEKVKPVALPEKDQEFTGDVVVSGWGTIXSNGPSXPVLRSVTVHVVSDEDCSDAYFGSTDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGXXGCAAPGYPGVYGKVSKFIDWIAETK 176          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000004826 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:382958:388781:1 gene:EMLSAG00000004826 transcript:EMLSAT00000004826 description:"maker-LSalAtl2s254-snap-gene-3.35")

HSP 1 Score: 241.506 bits (615), Expect = 1.083e-77
Identity = 126/264 (47.73%), Postives = 164/264 (62.12%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDK-----------------DTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYP 247
            ++   C LL L          +K      K K +  +  G+IVGG   +PNSIP+QISFQ    FHFCGGS++DK                 DTV+TAAHCC +F   EVQ+VAGEH+L   SG EQ   V  I YHE + + G N DICLLKL+SSL+ N+KV  V LP+K+++F G V VSGWG+++  G SS  LRSV V+++S   C+  Y  + D++ +CA A  KDSCQGDSGGPL +  TLVG+VSWG GCA+P +P
Sbjct:    7 ILHITCMLLAL---------SLKTEGQRRKKKDIMFQGDGKIVGGNAVKPNSIPYQISFQLKSGFHFCGGSIIDKVHMSILEFSMSSLESLKDTVLTAAHCCQNFEPEEVQIVAGEHNLSKVSGIEQIANVSFIKYHEDYATKGTNNDICLLKLESSLEFNDKVDAVNLPRKNKKFKGKVRVSGWGSVTPGGESSDFLRSVDVKIMSFAKCNLLYLNALDKSMLCAGARRKDSCQGDSGGPLTKKNTLVGVVSWGIGCASPWFP 261          

HSP 2 Score: 102.064 bits (253), Expect = 2.652e-25
Identity = 56/97 (57.73%), Postives = 65/97 (67.01%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVA 97
            M+RF+  LLFL  AAN V P +K+S              GRIVGGEE EPNS PF ISFQTTG F+F G SVMDKDT+ITAAHC DS    +VQ++A
Sbjct:  263 MMRFLYILLFLAVAAN-VGPIMKHS--------------GRIVGGEEVEPNSNPFHISFQTTGGFYFWGASVMDKDTIITAAHCFDSGRPKDVQIIA 344          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000003510 (pep:novel supercontig:LSalAtl2s:LSalAtl2s191:404984:406519:-1 gene:EMLSAG00000003510 transcript:EMLSAT00000003510 description:"maker-LSalAtl2s191-snap-gene-4.24")

HSP 1 Score: 211.846 bits (538), Expect = 7.215e-68
Identity = 118/262 (45.04%), Postives = 138/262 (52.67%), Query Frame = 0
Query:    3 RFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            R  C  L  V    A P Q   +E             GRI+GGEE EPNSIPFQ++FQ T  F  CG S+++KDT ITAAHCC   +  +V VVAGEHDL   SGDEQ                                             D+EFTG+ +VSGWG  S    +SPVLR+  + ++S + C D Y    DET ICA + GKDSCQGDSGGPL Q+G LVGIVSWG  C  P YPGVY KVS F DWI  H 
Sbjct:   11 RKNCTNLISVALTXANPTQTHINE-------------GRIIGGEEVEPNSIPFQVAFQKTSGFLLCGASIINKDTAITAAHCCSDLSPEDVMVVAGEHDLSEKSGDEQT--------------------------------------------DEEFTGEAIVSGWGVRSFGSSTSPVLRATNITLISFDECKDKYGRQFDETMICAGSLGKDSCQGDSGGPLFQNGKLVGIVSWGVFCGHPSYPGVYGKVSKFHDWILAHN 215          
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Match: EMLSAP00000002537 (pep:novel supercontig:LSalAtl2s:LSalAtl2s14:637103:638071:-1 gene:EMLSAG00000002537 transcript:EMLSAT00000002537 description:"maker-LSalAtl2s14-augustus-gene-6.12")

HSP 1 Score: 196.052 bits (497), Expect = 4.238e-61
Identity = 112/266 (42.11%), Postives = 147/266 (55.26%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAA--PGKDSCQGDSGGPLA-QDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            M++ + ALL LV  +          E F   K         ++GGE  EPNSIP+Q+S +  G FHFCGGS+ D+ T ITAAHCC   N     VVAG+H+    S +EQ + +K +  +  FG+ G+N DIC+L L+     N+KV  V LPK+DQ F G  VVSGWG+       S  L    + ++  + C   +  + DET ICA      K SC GDSGGPL  + G   G+VSWG  C  P YPGVY K+S FIDWI + 
Sbjct:    1 MMKGIVALLTLVAFSQGRRFDYSNKEIFKNPK---------VIGGEVVEPNSIPYQLSIKNRG-FHFCGGSIYDETTAITAAHCCVVINVDITTVVAGDHNQLFPSKNEQILKIKKVITNPDFGTNGLNNDICVLILEEPFVFNDKVDKVKLPKQDQAFEGKAVVSGWGSRIEGFPGSFKLFKAELTLLDSKKCHQLFGDNFDETMICANGVDEMKGSCHGDSGGPLVCEGGVQCGLVSWGIRCGAPEYPGVYVKLSHFIDWIKEQ 256          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|136424|sp|P00765.1|TRYP_ASTAS (RecName: Full=Trypsin-1; AltName: Full=Trypsin I)

HSP 1 Score: 205.297 bits (521), Expect = 6.506e-65
Identity = 117/233 (50.21%), Postives = 144/233 (61.80%), Query Frame = 0
Query:   42 IVGGEEAEPNSIPFQISFQTTG---DFHFCGGSVMDKDTVITAAHCC---DSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAAAP--GKDSCQGDSGGPLAQDGT----LVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            IVGG +A     P+Q+SFQ T     FHFCG S+ +++  ITA HC    D  N   +Q+VAGE D+    G EQ I V  I  HE F    ++ DI LLKL  SL  N  V P+ALP +    TG+V+V+GWGT S  G +  VL+ VTV +VSD  C D  YG+++  ++ ICA  P  GKDSCQGDSGGPLA   T    L GIVSWGYGCA PGYPGVY +VS  +DWI
Sbjct:    1 IVGGTDAVLGEFPYQLSFQETFLGFSFHFCGASIYNENYAITAGHCVYGDDYENPSGLQIVAGELDMSVNEGSEQTITVSKIILHENFDYDLLDNDISLLKLSGSLTFNNNVAPIALPAQGHTATGNVIVTGWGTTSEGGNTPDVLQKVTVPLVSDAECRDD-YGADEIFDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWI 232          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|547699|sp|P35588.1|HYPB_HYPLI (RecName: Full=Hypodermin-B; Short=HB; Flags: Precursor)

HSP 1 Score: 184.882 bits (468), Expect = 1.213e-56
Identity = 111/269 (41.26%), Postives = 149/269 (55.39%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQK--IPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPV-LRSVTVQVVSDEYCSDAYYGSNDE---TNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            M++FV  +  +     AV P             M  +  GRIVGG EA+    P+Q+S Q  G +HFCGGS+   + ++TAAHC +  ++ +++V  G      +  DE+   + V +   HE + ++ M YD+ LLKL S L     VK + L K+      D VVSGWGTI  N    PV LRSV V++VS E C    YG  +    T ICA A GKD+CQGDSGGPL     LVG+VSWG GCA PG+PGVY  VS+   WI ++
Sbjct:    1 MLKFVILVCSVACVFGAVVP-----------GGMLPQLDGRIVGGFEADIEDFPWQVSIQR-GGYHFCGGSIYSPEIIVTAAHCLEKIDASQLRVRVG-----GSYWDEEGSLLTVSNFKIHEKYDAMIMWYDVALLKLSSKLTYGATVKNIELAKETPPDNADAVVSGWGTIYENYPYMPVQLRSVDVKIVSREVCRSDEYGYGNAIGPTMICAYAVGKDACQGDSGGPLVVGEALVGVVSWGEGCAYPGFPGVYTDVSVVRSWITEN 252          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|136409|sp|P00762.1|TRY1_RAT (RecName: Full=Anionic trypsin-1; AltName: Full=Anionic trypsin I; AltName: Full=Pretrypsinogen I; AltName: Full=Serine protease 1; Flags: Precursor)

HSP 1 Score: 182.57 bits (462), Expect = 7.941e-56
Identity = 100/223 (44.84%), Postives = 132/223 (59.19%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG     +S+P+Q+S  +   +HFCGGS+++   V++AAHC  S     +QV  GEH++    GDEQ I    I  H  + S  +N DI L+KL S + LN +V PVALP          ++SGWG   SNG+++P +L+ V   V+S   C  AY G    + IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA P  PGVY KV  F+ WI
Sbjct:   23 KIVGGYTCPEHSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCYKS----RIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI 239          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|205371851|sp|P29787.2|TRY5_AEDAE (RecName: Full=Trypsin 5G1; Flags: Precursor)

HSP 1 Score: 178.718 bits (452), Expect = 4.248e-54
Identity = 98/233 (42.06%), Postives = 133/233 (57.08%), Query Frame = 0
Query:   37 RFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNS-WEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVV--VSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY--YGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            R  GRIVGG E     +PFQ+S    G  HFCGGS++ +  V+TA HC  S  +  +V++ + +H     +   Q I VK +  H  +  +  +YD  LL+L+ ++  ++   PV LP+KD          VSGWG   +   SS VLR+  V  VS + C  AY  +G   +  +CA     GKDSCQGDSGGPL  D TLVG+VSWGYGCA  GYPGVYA+V+   DW+ +
Sbjct:   35 RSSGRIVGGFEVPVEEVPFQVSLSGVGSSHFCGGSLLSERWVMTAGHCAASGQTNLQVRIGSSQH-----ASGGQLIKVKKVNRHPKYDEVTTDYDFALLELEETVTFSDSCAPVKLPQKDAPVNEGTCLQVSGWGNTQNPSESSEVLRAAYVPAVSQKECHKAYLSFGGVTDRMVCAGFKEGGKDSCQGDSGGPLVHDNTLVGVVSWGYGCAQAGYPGVYARVASVRDWVKE 262          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|97537546|sp|P35041.2|TRY7_ANOGA (RecName: Full=Trypsin-7; Flags: Precursor)

HSP 1 Score: 177.563 bits (449), Expect = 1.015e-53
Identity = 102/264 (38.64%), Postives = 151/264 (57.20%), Query Frame = 0
Query:    4 FVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDV--VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY-YGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
             +  L+ +V  A A P +       ++ +S  H  G RIVGG E   +  P+Q+S Q   + H CGGSV++   V+TAAHC D   ++ + V  G     ++SG    + V  I  H  +     +YD  LL+L+S L  ++ V+PVALP++D+        +VSGWG+  S   S+ +LR+  V  V  E C +AY + +  +  +CA     GKD+CQGDSGGPL  DG L+G+VSWG GCA PGYPGVYA+V++  +W+ +
Sbjct:    8 LLTVLIAVVACARAQPSR---RHPLVQPRSP-HGSGHRIVGGFEINVSDTPYQVSLQYI-NSHRCGGSVLNSKWVLTAAHCTDGLQAFTLTVRLGS-SRHASSG--TVVNVARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRMLCAGYQQGGKDACQGDSGGPLVADGKLIGVVSWGSGCAQPGYPGVYARVAVVRNWVRE 263          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|136429|sp|P00761.1|TRYP_PIG (RecName: Full=Trypsin; Flags: Precursor)

HSP 1 Score: 172.94 bits (437), Expect = 2.251e-52
Identity = 96/225 (42.67%), Postives = 129/225 (57.33%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            +IVGG     NSIP+Q+S  +    HFCGGS+++   V++AAHC  S     +QV  GEH++    G+EQ I    I  H  F    ++ DI L+KL S   LN +V  V+LP+       + ++SGWG   S+G S P +L+ +   V+SD  C  +Y G      IC      GKDSCQGDSGGP+  +G L GIVSWGYGCA    PGVY KV  +++WI Q
Sbjct:    8 KIVGGYTCAANSIPYQVSLNSGS--HFCGGSLINSQWVVSAAHCYKS----RIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQ 226          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|2499865|sp|P70059.1|TRY2_XENLA (RecName: Full=Trypsin; Flags: Precursor)

HSP 1 Score: 172.94 bits (437), Expect = 3.301e-52
Identity = 89/223 (39.91%), Postives = 132/223 (59.19%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG     N++P+Q+S      +HFCGGS+++   V++AAHC  S     +QV  GEH++    G EQ I  + +  H  + S  ++ DI L+KL ++  L+  ++ V LP        + ++SGWG   S+G + P +L+ +   +++D  CS++Y G   +   CA   A GKDSCQGDSGGP+  +G L G+VSWGYGCA   YPGVY KV  F+ WI
Sbjct:   21 KIVGGFTCAKNAVPYQVSLNA--GYHFCGGSLINSQWVVSAAHCYKS----RIQVRLGEHNIALNEGTEQFIDSQKVIKHPNYNSRNLDNDIMLIKLSTTARLSANIQSVPLPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTDSQCSNSYPGEITKNMFCAGFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNFVTWI 237          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|2851507|sp|P00763.2|TRY2_RAT (RecName: Full=Anionic trypsin-2; AltName: Full=Anionic trypsin II; AltName: Full=Pretrypsinogen II; AltName: Full=Serine protease 2; Flags: Precursor)

HSP 1 Score: 172.17 bits (435), Expect = 7.616e-52
Identity = 92/223 (41.26%), Postives = 130/223 (58.30%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG   + NS+P+Q+S  +   +HFCGGS+++   V++AAHC  S     +QV  GEH++    G+EQ +    I  H  F    +N DI L+KL S + LN +V  VALP          ++SGWG   S+G++ P +L+ +   ++    C  +Y G   +  +C      GKDSCQGDSGGP+  +G L GIVSWGYGCA P  PGVY KV  ++DWI
Sbjct:   23 KIVGGYTCQENSVPYQVSLNSG--YHFCGGSLINDQWVVSAAHCYKS----RIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|464946|sp|P35032.1|TRY2_SALSA (RecName: Full=Trypsin-2; AltName: Full=Trypsin II; Flags: Precursor)

HSP 1 Score: 171.014 bits (432), Expect = 1.594e-51
Identity = 94/222 (42.34%), Postives = 129/222 (58.11%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAA--APGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG E +  S P Q+S  +   +HFCGGS+++++ V++AAHC  S     V+V  GEH++  T G EQ I    +  H  + S  ++ DI L+KL     LN  V+PVALP           VSGWG   S+      L+ + + ++S   C+++Y G       CA     GKDSCQGDSGGP+  +G L G+VSWGYGCA PG PGVYAKV +F DW+
Sbjct:    9 KIVGGYECKAYSQPHQVSLNS--GYHFCGGSLVNENWVVSAAHCYQS----RVEVRLGEHNIQVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWL 224          
BLAST of EMLSAG00000000025 vs. SwissProt
Match: gi|729315|sp|P39675.1|DERP3_DERPT (RecName: Full=Mite allergen Der p 3; AltName: Full=Allergen Der p III; AltName: Allergen=Der p 3; Flags: Precursor)

HSP 1 Score: 171.4 bits (433), Expect = 2.841e-51
Identity = 102/235 (43.40%), Postives = 138/235 (58.72%), Query Frame = 0
Query:   42 IVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEK-VKPVALPKK--DQEFTGDVVVSGWGTISSNGLSSPV-LRSVTVQVVSDEYCSDAYYGSNDETN---ICA---AAPGKDSCQGDSGGPLA--QDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            IVGGE+A     P+QIS Q++   HFCGG+++D+  ++TAAHC     + ++ +    ++    S   +KI V  I  HE + S  ++ DI L+KLKS + LN+K  K V LP K  D +    V VSGWG +     S P  LR V + VVS + C++ Y  +N E     IC    A  GKDSCQGDSGGP+   ++  +VGIVSWGYGCA  GYPGVY +V  FIDWI   +
Sbjct:   30 IVGGEKALAGECPYQISLQSSS--HFCGGTILDEYWILTAAHCVAGQTASKLSI---RYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKR 259          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: EFX77150.1 (trypsin [Daphnia pulex])

HSP 1 Score: 187.193 bits (474), Expect = 1.924e-57
Identity = 110/242 (45.45%), Postives = 136/242 (56.20%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDF------HFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLN-EKVKPVALPKKDQEF---TGDVV-VSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND-ETNICAAAP--GKDSCQGDSGGPL----AQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            +IVGG E  PNS+PFQIS Q  G        H CGGS++D  T++ AAHC D  N   ++VV GEH     SG EQ   V   T HE + S     DI L+ + +  DL+    +PV LP    EF    G ++ VSGWGT S  G  S  L SV + V+SD  C+ AY G+    + +CA  P  G DSCQGDSGGPL     +     GIVSWG GCA   YPGVY +VS F+DWIA +K
Sbjct:   44 KIVGGTEVAPNSLPFQISLQRRGLLPNSAYSHICGGSILDATTILDAAHCVDGANVARLRVVVGEHSQTQASGLEQISAVSSFTMHENYSSSTYENDISLIFVATPFDLSVASARPVNLPAPTSEFDPPAGTIITVSGWGTTSEGGSVSDTLLSVDIPVISDADCNTAYGGNAVFSSMMCAGGPNGGIDSCQGDSGGPLFTGTGETAVQHGIVSWGQGCAQAAYPGVYTQVSYFLDWIAANK 285          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: EFX80960.1 (trypsin [Daphnia pulex])

HSP 1 Score: 184.882 bits (468), Expect = 8.158e-57
Identity = 110/229 (48.03%), Postives = 136/229 (59.39%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFT--GDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCSDAYYGSNDETN--ICAA--APGKDSCQGDSGGPLAQDGT--LVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            RIVGG +A PN  P+QIS +  G  H CG S+     +ITAAHC D      + +VAGEH L   SG+EQ   V     H  + S     DICLL+L S L LN  V  V +P +  +     + VVSGWGT SS G + P +LR VTV +VSD+ C  + YG+N  T+  ICA     G DSCQGDSGGPL  +GT  L+G+VSWG GCA  GY GVY +VS F +WI
Sbjct:   41 RIVGGTQASPNEFPYQISLRRLGS-HICGASIYKSGWIITAAHCTDGTAVGSLSIVAGEHSLSINSGNEQTRNVAAKHEHVSYSSRTQENDICLLELSSPLTLNSVVGVVRIPAQGAQTAVGTNCVVSGWGTTSSGGSTIPDILRKVTVPIVSDDTCRGS-YGTNAITDSMICAGFRLGGADSCQGDSGGPLVDEGTNLLIGVVSWGIGCADAGYYGVYTEVSYFHNWI 267          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: AHN54286.1 (trypsin 29F, isoform D [Drosophila melanogaster])

HSP 1 Score: 182.57 bits (462), Expect = 5.997e-56
Identity = 104/233 (44.64%), Postives = 139/233 (59.66%), Query Frame = 0
Query:   35 RHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY--YGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIA 261
            R R  GRIVGG+ A    IP+Q+S Q +  +HFCGGS++ +  V+TAAHC +       +V  G      TS   Q + +K +  H  F +  +++D  LL+L+     N     V LP++D +      V+VSGWG   S   +S VLRSVTV  VS   C++AY  +GS  +  +CA  P  GKD+CQGDSGGPLA DG L G+VSWGYGCA P YPGVY++VS   DWI+
Sbjct:   35 RPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: AAF52738.1 (trypsin 29F, isoform C [Drosophila melanogaster])

HSP 1 Score: 182.57 bits (462), Expect = 5.997e-56
Identity = 104/233 (44.64%), Postives = 139/233 (59.66%), Query Frame = 0
Query:   35 RHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY--YGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIA 261
            R R  GRIVGG+ A    IP+Q+S Q +  +HFCGGS++ +  V+TAAHC +       +V  G      TS   Q + +K +  H  F +  +++D  LL+L+     N     V LP++D +      V+VSGWG   S   +S VLRSVTV  VS   C++AY  +GS  +  +CA  P  GKD+CQGDSGGPLA DG L G+VSWGYGCA P YPGVY++VS   DWI+
Sbjct:   35 RPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: EFX77153.1 (trypsin [Daphnia pulex])

HSP 1 Score: 182.57 bits (462), Expect = 1.134e-55
Identity = 113/245 (46.12%), Postives = 138/245 (56.33%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHF----CGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLN-EKVKPVALPKKDQEF---TGDVVV-SGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETN-----ICAAAP---GKDSCQGDSGGPL----AQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            +IVGG E EPNS+PFQ+S Q  G        CGGS++D++T++ AAHC D  N   +++VAGEH L   SG EQ   V  +  H  + S     DI L+ L S LDL+    K +ALP    E     G VV  SGWGT SS G  S VLRSV + VVSD  C  AY G+    +     ICA      G DSCQGDSGGPL     +     GIVSWG GCA   +PGVY +VS F+DWIA  +
Sbjct:   42 KIVGGTEVEPNSLPFQVSLQRKGLTGLYSQSCGGSILDENTILDAAHCVDGANIPNLRIVAGEHSLSVESGLEQNRLVTRVATHPRYNSATYEDDISLIFLDSPLDLSVPSAKAIALPPSTSELDPPAGTVVTCSGWGTTSSGGSISDVLRSVDIPVVSDADCDAAYGGTASSPSVYPSMICAGDTTNGGIDSCQGDSGGPLFTGTGETAVQHGIVSWGQGCALARFPGVYTQVSYFLDWIAAAR 286          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: EFX77160.1 (trypsin [Daphnia pulex])

HSP 1 Score: 179.874 bits (455), Expect = 1.289e-54
Identity = 107/246 (43.50%), Postives = 145/246 (58.94%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQ---TTGDF-HFCGGSVMDKDTVITAAHCCDSFNSWEV-QVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLN-EKVKPVALPKKDQEF---TGDV-VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND-------ETNICAAAPGK--DSCQGDSGGPL----AQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            +IVGG+E  PNS+PFQIS Q    +G F   CGGS+++++T++ AAHC D      + +VVAGEHDLF  SG EQ + V +I  H  +       DI L+ L + LDL+    KP+ +P    EF    G V  VSGWGT SS G  S VL SV + ++SD+ C+  Y   ++       E+ +CA  P    DSCQGDSGGP       +   +G+VSWG GCAT  YPGVY ++S F+DWI ++
Sbjct:   44 KIVGGKEVVPNSLPFQISLQRKSASGIFSQSCGGSILNENTILDAAHCVDGVADVSIFRVVAGEHDLFQVSGLEQNMDVNNILMHPDYNKKTSENDIALIYLAAPLDLSVPSAKPINMPPATWEFDPPAGIVATVSGWGTTSSGGSISNVLLSVDIPIISDDACNAIYTDESEPKPKAIYESMLCAGGPNGNVDSCQGDSGGPFFIGTGTNAIQLGVVSWGRGCATGHYPGVYTQISYFLDWINEN 289          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: AAF58665.1 (lambdaTry [Drosophila melanogaster])

HSP 1 Score: 178.718 bits (452), Expect = 2.317e-54
Identity = 96/265 (36.23%), Postives = 146/265 (55.09%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWE-VQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            M R +   L L    +   P  +  E  +       +  GRIVGG++      P QIS +  G+ H CGG++   + +I+AAHC ++ +  E + +VAG  +++  +G +Q++ V++I  H  + +L  +YD  +L L    + N+ V+P+ L K+  +    V V+GWGT S  G  S VL+ V+V VV +  C +AY        +CA     GKD+CQGDSGGPL  + TL+GIVSWG GCA   YPGVY  V   +DW+ +
Sbjct:    1 MSRILVVFLVLGVGCSLADPIYRNEEVHIP------KLDGRIVGGQDTNITQYPHQISMRYRGN-HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: EAA12262.3 (AGAP008293-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 177.563 bits (449), Expect = 4.919e-54
Identity = 102/264 (38.64%), Postives = 151/264 (57.20%), Query Frame = 0
Query:    4 FVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDV--VVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY-YGSNDETNICAAAP--GKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
             +  L+ +V  A A P +       ++ +S  H  G RIVGG E   +  P+Q+S Q   + H CGGSV++   V+TAAHC D   ++ + V  G     ++SG    + V  I  H  +     +YD  LL+L+S L  ++ V+PVALP++D+        +VSGWG+  S   S+ +LR+  V  V  E C +AY + +  +  +CA     GKD+CQGDSGGPL  DG L+G+VSWG GCA PGYPGVYA+V++  +W+ +
Sbjct:    8 LLTVLIAVVACARAQPSR---RHPLVQPRSP-HGSGHRIVGGFEINVSDTPYQVSLQYI-NSHRCGGSVLNSKWVLTAAHCTDGLQAFTLTVRLGS-SRHASSG--TVVNVARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSATESNAILRAANVPTVDQEECREAYSHDAITDRMLCAGYQQGGKDACQGDSGGPLVADGKLIGVVSWGSGCAQPGYPGVYARVAVVRNWVRE 263          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: AHN54610.1 (uncharacterized protein Dmel_CG17571, isoform B [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 1.372e-53
Identity = 100/226 (44.25%), Postives = 135/226 (59.73%), Query Frame = 0
Query:   40 GRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCS-DAY-YGSND--ETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            GRIV GE+ +  + P+Q+S QTT   HFCGGS++D +TV+TAAHC  S+ + E+QV  G     S S   + + V+   YHE + S  M  D+ ++KL S +    K++ + L   +     + VVSGWGT      SSP  L+ V V ++  + C+ D Y YGS+   ET +CA    KD+CQGDSGGPL  D  LVG+VSWG GCA  GYPGVYA V+    WI
Sbjct:   29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGST---SRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251          
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Match: AAF45447.1 (uncharacterized protein Dmel_CG17571, isoform A [Drosophila melanogaster])

HSP 1 Score: 176.407 bits (446), Expect = 1.372e-53
Identity = 100/226 (44.25%), Postives = 135/226 (59.73%), Query Frame = 0
Query:   40 GRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSP-VLRSVTVQVVSDEYCS-DAY-YGSND--ETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            GRIV GE+ +  + P+Q+S QTT   HFCGGS++D +TV+TAAHC  S+ + E+QV  G     S S   + + V+   YHE + S  M  D+ ++KL S +    K++ + L   +     + VVSGWGT      SSP  L+ V V ++  + C+ D Y YGS+   ET +CA    KD+CQGDSGGPL  D  LVG+VSWG GCA  GYPGVYA V+    WI
Sbjct:   29 GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGST---SRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWI 251          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|71534671|emb|CAH61268.1| (putative trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK
Sbjct:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|31563314|gb|AAP55755.1| (trypsin 1c, partial [Lepeophtheirus salmonis])

HSP 1 Score: 474.937 bits (1221), Expect = 1.853e-168
Identity = 227/262 (86.64%), Postives = 238/262 (90.84%), Query Frame = 0
Query:    3 RFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            RF CALLFLV AANAVPPQIKYSESFM+VKSMRHRFGGRIVGGEE EPNSIPFQ+SFQTTG FHFCG SVMDKDT+ITAAHCCDSF  WEVQVVAGEHDLFSTSGDEQ I V DITYHEMF S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G +SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWI +HK
Sbjct:    1 RFFCALLFLVVAANAVPPQIKYSESFMRVKSMRHRFGGRIVGGEEVEPNSIPFQVSFQTTGGFHFCGASVMDKDTIITAAHCCDSFFPWEVQVVAGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIVEHK 262          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|31563316|gb|AAP55756.1| (trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|gb|AAP55757.1| trypsin 1aii [Lepeophtheirus salmonis] >gi|31563320|gb|AAP55758.1| trypsin 1aiii [Lepeophtheirus salmonis] >gi|31563324|gb|AAP55760.1| trypsin 1a [Lepeophtheirus salmonis] >gi|71534674|emb|CAH61461.1| putative trypsin [Lepeophtheirus salmonis])

HSP 1 Score: 473.011 bits (1216), Expect = 9.050e-168
Identity = 228/264 (86.36%), Postives = 239/264 (90.53%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M++FVC LLFLV AANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 MMKFVCTLLFLVVAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 264          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031228|gb|AAL71881.1| (trypsin type 7, partial [Lepeophtheirus salmonis])

HSP 1 Score: 470.7 bits (1210), Expect = 7.194e-167
Identity = 225/261 (86.21%), Postives = 237/261 (90.80%), Query Frame = 0
Query:    4 FVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            F CALLFLV AANAVPPQIKYSESFM+VKSMRHRFGGRIVGGEE EPNSIPFQ+SFQTTG FHFCG SVMDKDT+ITAAHCCDSF  WEVQVV+GEHDLFSTSGDEQ I V DITYHEMF S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G +SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWI +HK
Sbjct:    1 FFCALLFLVVAANAVPPQIKYSESFMRVKSMRHRFGGRIVGGEEVEPNSIPFQVSFQTTGGFHFCGASVMDKDTIITAAHCCDSFFPWEVQVVSGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIVEHK 261          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031216|gb|AAL71875.1| (trypsin type 1, partial [Lepeophtheirus salmonis])

HSP 1 Score: 470.315 bits (1209), Expect = 1.235e-166
Identity = 226/262 (86.26%), Postives = 237/262 (90.46%), Query Frame = 0
Query:    3 RFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            +FVC LLFLV AANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CS+AYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 KFVCTLLFLVVAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSBAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 262          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|31563322|gb|AAP55759.1| (trypsin 1b [Lepeophtheirus salmonis])

HSP 1 Score: 461.455 bits (1186), Expect = 4.188e-163
Identity = 224/264 (84.85%), Postives = 237/264 (89.77%), Query Frame = 0
Query:    1 MIRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            M+RFVCAL FL  AA+AVP +IKYS+SFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 MLRFVCALFFLAVAASAVP-RIKYSDSFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 263          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031218|gb|AAL71876.1| (trypsin type 2, partial [Lepeophtheirus salmonis])

HSP 1 Score: 455.677 bits (1171), Expect = 7.171e-161
Identity = 222/261 (85.06%), Postives = 234/261 (89.66%), Query Frame = 0
Query:    4 FVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            FVCAL FL  AA+AVP +IKYS+SFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 FVCALFFLAVAASAVP-RIKYSDSFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 260          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031220|gb|AAL71877.1| (trypsin type 3, partial [Lepeophtheirus salmonis])

HSP 1 Score: 454.136 bits (1167), Expect = 2.475e-160
Identity = 221/261 (84.67%), Postives = 234/261 (89.66%), Query Frame = 0
Query:    4 FVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            FVCAL FL  AA+AVP +IKYSESFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  N+KVKP+ALP+K+QEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 FVCALFFLAVAASAVP-RIKYSESFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNKKVKPIALPEKEQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 260          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031226|gb|AAL71880.1| (trypsin type 6, partial [Lepeophtheirus salmonis])

HSP 1 Score: 449.514 bits (1155), Expect = 1.092e-158
Identity = 215/248 (86.69%), Postives = 226/248 (91.13%), Query Frame = 0
Query:   17 AVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            AVPPQIKYSESFM+VKSMRHRFGGRIVGGEE EPNSIPFQ+SFQTTG FHFCG SVMDKDT+ITAAHCCDSF  WEVQVVAGEHDLFSTSGDEQ I V DITYHEMF S G NYD+CLLKLKSSL  NEKVKP+ALP+KDQEF GDVVVSGWGTISS+G +SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWI +HK
Sbjct:    1 AVPPQIKYSESFMRVKSMRHRFGGRIVGGEEVEPNSIPFQVSFQTTGGFHFCGASVMDKDTIITAAHCCDSFFPWEVQVVAGEHDLFSTSGDEQTIDVSDITYHEMFASHGTNYDVCLLKLKSSLHFNEKVKPIALPEKDQEFIGDVVVSGWGTISSSGPASPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIVEHK 248          
BLAST of EMLSAG00000000025 vs. nr
Match: gi|19031222|gb|AAL71878.1| (trypsin type 4, partial [Lepeophtheirus salmonis])

HSP 1 Score: 448.743 bits (1153), Expect = 2.613e-158
Identity = 217/250 (86.80%), Postives = 226/250 (90.40%), Query Frame = 0
Query:   15 ANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQHK 264
            ANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEE EPNSIPFQISFQTTG FHFCG SVMDKDT+ITAAHCCDSF   EVQVVAGEHDLFSTSGDEQKI V DITYHE F S G NYD+CLLKLKSSL  NEKV P+ALP+KDQEF GDVVVSGWGTISS+G  SPVL++VTVQVVSDE CSDAYYGS DET ICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCA PGYPGVY KVS FIDWIA+H+
Sbjct:    1 ANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEVEPNSIPFQISFQTTGGFHFCGASVMDKDTIITAAHCCDSFYPSEVQVVAGEHDLFSTSGDEQKIAVSDITYHEKFASHGTNYDVCLLKLKSSLHFNEKVNPIALPEKDQEFIGDVVVSGWGTISSSGPPSPVLKAVTVQVVSDEDCSDAYYGSIDETMICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCAAPGYPGVYGKVSKFIDWIAEHQ 250          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1259_size52279-snap-gene-0.10 (protein:Tk02678 transcript:maker-scaffold1259_size52279-snap-gene-0.10-mRNA-1 annotation:"anionic trypsin-1 precursor")

HSP 1 Score: 225.328 bits (573), Expect = 2.060e-72
Identity = 119/225 (52.89%), Postives = 147/225 (65.33%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTG-DFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLG-MNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG E EPNSIP+Q+S Q  G DFHFCGG++ D+ TVITAAHCC   +  +++V AGEH L ++ G EQ   V  I  HE +G+ G  + D+CLLKL   LDLN KV    LP +  E+  +  +VVSGWGT+S+ G S   L SVTV  V D  C D Y+    D++ ICA   G DSCQGDSGGPL  DG   G+VSWGYGCA    PGVYA+ S F+DWI
Sbjct:  148 KIVGGTEVEPNSIPYQVSLQYPGIDFHFCGGAIYDESTVITAAHCCAGQSPSDLRVNAGEHSLSNSDGTEQLRDVSKIIGHEDYGTPGQFSNDVCLLKLSKPLDLNGKVDAAKLPSQGDEYDSNTKIVVSGWGTLSAGGSSPDTLYSVTVPFVEDSVCDDNYFLETIDDSMICAGEEGVDSCQGDSGGPLTCDGVHCGVVSWGYGCAGRNQPGVYAQTSYFVDWI 372          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold531_size145796-snap-gene-0.21 (protein:Tk12609 transcript:maker-scaffold531_size145796-snap-gene-0.21-mRNA-1 annotation:"Trypsin-1")

HSP 1 Score: 217.238 bits (552), Expect = 1.928e-68
Identity = 116/225 (51.56%), Postives = 145/225 (64.44%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQ-TTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLG-MNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG E EPNSIP+Q+S Q  + DFHFCGG++ D+ TVITAAHCC   ++ +++V AGEH L +  G EQ   V  I  H  +G  G  + DICLLKL   L+L+  V    LP + +E+  D  ++VSGWGT+S+ G+S   L SV V  V D  C   YY    D+T +CA   G DSCQGDSGGPL  DG   G+VSWGYGCA  G PGVYAK S F+DWI
Sbjct:  217 KIVGGSEVEPNSIPYQVSIQYPSTDFHFCGGAIYDESTVITAAHCCAGQSASDMRVNAGEHSLSNNDGTEQLRDVSKIIGHGSYGIPGRFSNDICLLKLSEPLNLDGMVDAAKLPAQGEEYGSDNTLIVSGWGTLSAGGISPDALHSVVVPFVPDGVCRGNYYLEIIDKTMMCAGKEGVDSCQGDSGGPLTCDGVHCGVVSWGYGCAGLGQPGVYAKTSYFVDWI 441          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1289_size50518-snap-gene-0.10 (protein:Tk08062 transcript:maker-scaffold1289_size50518-snap-gene-0.10-mRNA-1 annotation:"Trypsin-1")

HSP 1 Score: 211.075 bits (536), Expect = 4.423e-68
Identity = 115/225 (51.11%), Postives = 144/225 (64.00%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTG-DFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLG-MNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGD--VVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAY-YGSNDETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG E  PNSIPFQ+S Q  G D HFCGG++ D+ T+ITAAHCC   +  E+ V+AGEH L +  G EQ   V  I  HE +G+ G ++ DICLLKL   L+LN++V    LP + +E+  +  +VVSGWGT+SS G S  VL SVTV  V D  C D Y     D++ +CA   G DSCQ DSGGPL  DG   G+VSWG GC     PGVYA+ S FI+WI
Sbjct:   50 KIVGGSEVVPNSIPFQVSLQVPGIDGHFCGGAIYDESTIITAAHCCAIPSPSELMVIAGEHSLSNIDGTEQLRYVSKIISHEDYGTPGPVSNDICLLKLSEPLELNDEVAATKLPAQGEEYDSNSTMVVSGWGTLSSGGSSPDVLMSVTVPFVEDSVCQDNYPLAIIDDSMLCAGEEGVDSCQEDSGGPLTCDGVHCGVVSWGSGCGGVNQPGVYAQTSYFINWI 274          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold270_size230592-snap-gene-1.27 (protein:Tk10976 transcript:maker-scaffold270_size230592-snap-gene-1.27-mRNA-1 annotation:"trypsin-like serine proteinase 1")

HSP 1 Score: 210.69 bits (535), Expect = 4.487e-68
Identity = 113/225 (50.22%), Postives = 142/225 (63.11%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGS-LGMNYDICLLKLKSSLDLNEKVKPVALP---KKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            +IVGG E EPNSIP+Q+S QT+G FHFCGG+V D+ TVITAAHCC      + QV+AGEH+L    G+EQ   V +I  HE +G     + DICLLKL  +LD N  V    +P   + D +    +VVSGWGT+   G S   L SV V  V+D+ C  +Y     D++ IC+   G DSCQGDSGGP+  DG   GIVSWG  CA+ GYPGVY + S F+DWI
Sbjct:   33 KIVGGSEVEPNSIPYQVSLQTSG-FHFCGGAVYDEMTVITAAHCCRGDQPGDFQVIAGEHNLRKDEGNEQTREVTEIIMHETYGDPTTHSNDICLLKLDVALDFNGLVDAAPMPTQGQDDYDENTKIVVSGWGTLKPGGSSPDELYSVVVPFVNDDDCRISYGADAIDDSMICSGEEGVDSCQGDSGGPMTCDGAHCGIVSWGVSCASAGYPGVYVQTSYFVDWI 256          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1142_size59991-snap-gene-0.13 (protein:Tk01292 transcript:maker-scaffold1142_size59991-snap-gene-0.13-mRNA-1 annotation:"trypsin partial")

HSP 1 Score: 210.69 bits (535), Expect = 3.412e-67
Identity = 113/268 (42.16%), Postives = 159/268 (59.33%), Query Frame = 0
Query:    2 IRFVCALLFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTT--GDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQEFT--GDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPLA-QDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            ++    LL L T+  A+    K        ++       RIVGG E EP+SIP+Q+S Q +  G+ H+CG SV+D  T++TAAHCCD     E+ + AG+H+LF   G EQ + V  +  HE +  L +  DIC+LK+   L++N+ V+ + LP   Q +       +SGWG ++ +G +  VL S TV +VSDE C DAY   N  ++ ICA    +DSCQGDSGGP+  +DG + GIVSWG+GC   GYPGV  +VS F+DWI  H
Sbjct:   65 MKVFAQLLLLTTSCLALETHFKTKYLHKTNQNFAPGPRTRIVGGAEVEPHSIPWQVSLQLSNFGNAHYCGASVIDSTTLLTAAHCCDGVLPEELLISAGDHNLFVDEGTEQAMGVAQLVIHEDYDPLTVVNDICILKVDGQLEMNDNVQSLPLPDPMQTYAPGTQATLSGWGYLAVDGPAPDVLYSTTVAIVSDEECKDAYGAENISDSMICAGGGAQDSCQGDSGGPMTCEDGRICGIVSWGFGCGV-GYPGVNTEVSYFVDWIVSH 331          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold539_size142544-snap-gene-0.29 (protein:Tk01727 transcript:maker-scaffold539_size142544-snap-gene-0.29-mRNA-1 annotation:"intestinal trypsin 5 precursor")

HSP 1 Score: 190.274 bits (482), Expect = 1.057e-59
Identity = 111/270 (41.11%), Postives = 156/270 (57.78%), Query Frame = 0
Query:    4 FVCALLFL-VTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTGDF-HFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGD-EQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDL-NEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAAAPGKDSCQGDSGGPLA-----QDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
             +CA L L +  ++   P+I   ++ M    +      +IVGG E  P+SIPFQ+S Q      HFCG +V+ +  V+TAAHCC+ + S E+  +AG H L +   + EQK  VK+I  HE + S  +  DICLL++    +L   KV+   +P K+++F G   VSGWGT S  G SSP L+ V V +VS   C +A YG+ +   T  CA   G DSCQGDSGGPL       +  L G+VSWG GCA  G+PGVY +++ F+ WI +
Sbjct:    6 ILCAALILPLCVSSWRHPRI-LPQAVMSELGLEDPTDSKIVGGHEVIPHSIPFQVSLQEKAKSKHFCGAAVISEFFVLTAAHCCEGYRSKEIVAIAGRHCLDAHHENGEQKRGVKEIIIHEQWRSSTVENDICLLRVGKKFNLWKGKVREALMPYKNEQFEGRAEVSGWGTTSYGGNSSPSLQVVDVPIVSQRVC-EASYGAENIFSTMFCAGEKGNDSCQGDSGGPLVCIDGFGNKILCGVVSWGKGCAREGFPGVYTRIASFMPWITK 273          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold531_size145796-snap-gene-0.18 (protein:Tk12603 transcript:maker-scaffold531_size145796-snap-gene-0.18-mRNA-1 annotation:"PREDICTED: trypsin-3-like")

HSP 1 Score: 172.555 bits (436), Expect = 7.595e-52
Identity = 107/255 (41.96%), Postives = 137/255 (53.73%), Query Frame = 0
Query:    9 LFLVTAANAVPPQIKYSESFMKVKSMRHRFGGRIVGGEEAEPNSIPFQISFQTTG-DFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLG-MNYDICLLKLKSSLDLNEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSN-DETNICAAAPGKDSCQGDSGGPLAQDGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWI 260
            + LV A  A+  Q       M  + + +    +IVGG E EPNSIP+Q+S Q  G DFHFCGG++ D+ TVITAAHCC   +  +++V AGEH L ++ G EQ   V  I  HE +G+ G  + D+CLLKL   L+LN                        G I +   SS    +V         C D Y+    D++ ICA   G DSCQGDSGGPL  DG   G+VSWGYGCA    PGVYA+ S F+DWI
Sbjct:  155 ITLVVAMVALGAQAGRIRPVMPKRPLGYP-ADKIVGGTEVEPNSIPYQVSLQYPGIDFHFCGGAIYDESTVITAAHCCAGQSPSDLRVNAGEHSLSNSDGTEQLRDVSKIIGHEDYGTPGQFSNDVCLLKLSEPLELN------------------------GFIGNGSPSSFPFIAV---------CDDNYFLETIDDSMICAGEEGVDSCQGDSGGPLTCDGVHCGVVSWGYGCAGRNQPGVYAQTSYFVDWI 375          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold17_size721972-snap-gene-5.11 (protein:Tk09975 transcript:maker-scaffold17_size721972-snap-gene-5.11-mRNA-1 annotation:"hepatopancreas partial")

HSP 1 Score: 166.392 bits (420), Expect = 8.239e-51
Identity = 102/235 (43.40%), Postives = 133/235 (56.60%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGD---FHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALPKKDQ--EFTGDVVVSGWGTISSNGL-SSPVLRSVTVQVVSDEYCSDAYYGSND--ETNICAA---APGKDSCQGDSGGPLAQDGT--LVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQ 262
            +IVGGE+A     P+QIS +   D    H CGGS+++++ ++TA HCC           AG+ D +   G EQ I VK I  H  + +     DICLL+LK S   +E V PV LP+  Q  E    V V+G+G     G+ +S  LR V + VVSDE C+ AY   N+  E+ ICA      G D+CQGDSGGP    GT   VG+VSWG GCA  GYPGV  +VS F+DWI +
Sbjct:   28 KIVGGEKAVLGEFPYQISIREFFDNPLTHICGGSIINENWILTAGHCCVGLPIL-FHTTAGDVDTYVNEGTEQHIDVKTIIQHPEYSAQTFANDICLLELKESFVFDENVGPVTLPEPMQPIEAGSSVTVTGYGVTREGGIFTSEFLRKVDLPVVSDEECAAAYVDMNEVIESMICAGDIVNGGIDACQGDSGGPYVITGTNTQVGVVSWGRGCAEVGYPGVNTEVSYFLDWIQE 261          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold122_size333723-snap-gene-0.17 (protein:Tk04108 transcript:maker-scaffold122_size333723-snap-gene-0.17-mRNA-1 annotation:"plasminogen activator spa")

HSP 1 Score: 157.147 bits (396), Expect = 1.794e-46
Identity = 97/251 (38.65%), Postives = 130/251 (51.79%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQTTGD-------------FHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDL-NEKVKPVALPKKDQEFTGDVVVSGWGTISSNGLSSPVLRSVTVQVVSDEYCSDAYYGSNDETN-------ICAAAP--GKDSCQGDSGGPLA---QDG--TLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            RIVGG EA P   P+Q+S Q   +             +H CG SV+  + V+TAAHC   F + ++ +VAG+H+L +    EQ   VK +  H  +       DI LL+L +   L N +V P+ LP ++Q      V SGWGT    G    +L  V + ++ +E C   Y      T        ICA     G+DSCQGDSGGPLA    DG  TL G+VSWG+GCA P  PGVY  V  ++DWIA +
Sbjct:   81 RIVGGVEAFPGEFPWQVSLQLLKNKYADFNEHDPKARYHICGASVLSSNYVLTAAHCVVDFLADQIVLVAGDHNLVTFERSEQVSRVKTVKAHLQYNRNSFENDIALLELTTPFHLDNNRVGPICLP-QEQSSKDLAVASGWGTTEEGGSLPQILNRVGLPILPNELCQGMYESEYPGTGGFVRDGMICAGFENGGRDSCQGDSGGPLACKQSDGSYTLCGLVSWGFGCARPNLPGVYTDVYDYLDWIADN 330          
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold91_size383040-snap-gene-2.26 (protein:Tk03190 transcript:maker-scaffold91_size383040-snap-gene-2.26-mRNA-1 annotation:"serine protease 27-like")

HSP 1 Score: 159.844 bits (403), Expect = 4.306e-46
Identity = 95/237 (40.08%), Postives = 139/237 (58.65%), Query Frame = 0
Query:   41 RIVGGEEAEPNSIPFQISFQT-TGDFHFCGGSVMDKDTVITAAHCCDSFNSWEVQVVAGEHDLFSTSGDEQKIPVKDITYHEMFGSLGMNYDICLLKLKSSLDLNEKVKPVALP--KKDQEFTG-DVVVSGWGTISSNGLSS---PVLRSVTVQVVSDEYCSDAYYGSNDETN--ICAAAPGKDSCQGDSGGPLAQ-----DGTLVGIVSWGYGCATPGYPGVYAKVSMFIDWIAQH 263
            RIV G+ + PNSIP+Q+   +  G+  FCGG+++    V+TAAHC     + ++ VV GEH++ +T+   Q++ V  I  H  + S+  N D  +L+L   +  N ++KP  LP     + +TG D  VSGWG +  N ++S     L+  T++VVSD  C  A YG    T+  +CA A G DSCQGDSGGPL         T++G+VS+G GCA  G PGVYA+V+  + WI Q+
Sbjct:  250 RIVDGQTSSPNSIPWQVGLVSGAGNVPFCGGTLISSRHVLTAAHCT---GTPDLSVVLGEHNIKTTADQAQRVKVARIIDHPSYNSVTFNNDFAILELAKDVAFNNQIKPSCLPVDGSTKTYTGVDARVSGWGLLEYNEINSIKPQFLQETTLKVVSDGDCR-AIYGIQAITDRMLCAYAKGTDSCQGDSGGPLTTLESNGRHTVIGVVSFGSGCAQVGVPGVYARVTSVLPWIKQN 482          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000025 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-8.877e-6551.07symbol:Q52V24 "Hepatopancreas trypsin" species:671... [more]
-1.969e-5444.84symbol:Prss1 "Anionic trypsin-1" species:10116 "Ra... [more]
-1.969e-5444.84symbol:Prss1 "protease, serine, 1 (trypsin 1)" spe... [more]
-2.972e-5444.64symbol:Try29F "Trypsin 29F" species:7227 "Drosophi... [more]
-1.092e-5236.23symbol:lambdaTry "lambdaTry" species:7227 "Drosoph... [more]
-6.452e-5244.25symbol:CG17571 species:7227 "Drosophila melanogast... [more]
-4.975e-5139.78symbol:CG31954 species:7227 "Drosophila melanogast... [more]
-5.184e-5142.67symbol:P00761 "Trypsin" species:9823 "Sus scrofa" ... [more]
-5.890e-5142.67symbol:LOC100302368 "Uncharacterized protein" spec... [more]
-1.018e-5043.50symbol:zgc:66382 "zgc:66382" species:7955 "Danio r... [more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592778098|gb|GAXK01176470.1|1.104e-5843.21TSA: Calanus finmarchicus comp3490_c3_seq1 transcr... [more]
gi|592784512|gb|GAXK01170056.1|1.003e-5541.89TSA: Calanus finmarchicus comp156_c3_seq1 transcri... [more]
gi|592778099|gb|GAXK01176469.1|2.653e-5547.84TSA: Calanus finmarchicus comp3490_c0_seq1 transcr... [more]
gi|592784513|gb|GAXK01170055.1|1.748e-5441.51TSA: Calanus finmarchicus comp156_c1_seq1 transcri... [more]
gi|592881151|gb|GAXK01076750.1|1.767e-5443.72TSA: Calanus finmarchicus comp98234_c0_seq1 transc... [more]
gi|592859852|gb|GAXK01097710.1|6.902e-5142.80TSA: Calanus finmarchicus comp38035_c0_seq1 transc... [more]
gi|592944223|gb|GAXK01014330.1|2.386e-4842.29TSA: Calanus finmarchicus comp8458_c0_seq8 transcr... [more]
gi|592944224|gb|GAXK01014329.1|2.538e-4842.29TSA: Calanus finmarchicus comp8458_c0_seq7 transcr... [more]
gi|592944228|gb|GAXK01014325.1|3.546e-4842.29TSA: Calanus finmarchicus comp8458_c0_seq3 transcr... [more]
gi|592944227|gb|GAXK01014326.1|3.627e-4842.29TSA: Calanus finmarchicus comp8458_c0_seq4 transcr... [more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000000250.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:6858... [more]
EMLSAP000000048281.011e-16986.36pep:novel supercontig:LSalAtl2s:LSalAtl2s254:39724... [more]
EMLSAP000000109249.853e-15382.95pep:novel supercontig:LSalAtl2s:LSalAtl2s730:25918... [more]
EMLSAP000000109252.767e-14985.17pep:novel supercontig:LSalAtl2s:LSalAtl2s730:28349... [more]
EMLSAP000000028367.968e-12168.56pep:novel supercontig:LSalAtl2s:LSalAtl2s1638:1395... [more]
EMLSAP000000078862.605e-9656.85pep:novel supercontig:LSalAtl2s:LSalAtl2s464:52646... [more]
EMLSAP000000000232.757e-9183.33pep:novel supercontig:LSalAtl2s:LSalAtl2s1005:1582... [more]
EMLSAP000000048261.083e-7747.73pep:novel supercontig:LSalAtl2s:LSalAtl2s254:38295... [more]
EMLSAP000000035107.215e-6845.04pep:novel supercontig:LSalAtl2s:LSalAtl2s191:40498... [more]
EMLSAP000000025374.238e-6142.11pep:novel supercontig:LSalAtl2s:LSalAtl2s14:637103... [more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|136424|sp|P00765.1|TRYP_ASTAS6.506e-6550.21RecName: Full=Trypsin-1; AltName: Full=Trypsin I[more]
gi|547699|sp|P35588.1|HYPB_HYPLI1.213e-5641.26RecName: Full=Hypodermin-B; Short=HB; Flags: Precu... [more]
gi|136409|sp|P00762.1|TRY1_RAT7.941e-5644.84RecName: Full=Anionic trypsin-1; AltName: Full=Ani... [more]
gi|205371851|sp|P29787.2|TRY5_AEDAE4.248e-5442.06RecName: Full=Trypsin 5G1; Flags: Precursor[more]
gi|97537546|sp|P35041.2|TRY7_ANOGA1.015e-5338.64RecName: Full=Trypsin-7; Flags: Precursor[more]
gi|136429|sp|P00761.1|TRYP_PIG2.251e-5242.67RecName: Full=Trypsin; Flags: Precursor[more]
gi|2499865|sp|P70059.1|TRY2_XENLA3.301e-5239.91RecName: Full=Trypsin; Flags: Precursor[more]
gi|2851507|sp|P00763.2|TRY2_RAT7.616e-5241.26RecName: Full=Anionic trypsin-2; AltName: Full=Ani... [more]
gi|464946|sp|P35032.1|TRY2_SALSA1.594e-5142.34RecName: Full=Trypsin-2; AltName: Full=Trypsin II;... [more]
gi|729315|sp|P39675.1|DERP3_DERPT2.841e-5143.40RecName: Full=Mite allergen Der p 3; AltName: Full... [more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX77150.11.924e-5745.45trypsin [Daphnia pulex][more]
EFX80960.18.158e-5748.03trypsin [Daphnia pulex][more]
AHN54286.15.997e-5644.64trypsin 29F, isoform D [Drosophila melanogaster][more]
AAF52738.15.997e-5644.64trypsin 29F, isoform C [Drosophila melanogaster][more]
EFX77153.11.134e-5546.12trypsin [Daphnia pulex][more]
EFX77160.11.289e-5443.50trypsin [Daphnia pulex][more]
AAF58665.12.317e-5436.23lambdaTry [Drosophila melanogaster][more]
EAA12262.34.919e-5438.64AGAP008293-PA [Anopheles gambiae str. PEST][more]
AHN54610.11.372e-5344.25uncharacterized protein Dmel_CG17571, isoform B [D... [more]
AAF45447.11.372e-5344.25uncharacterized protein Dmel_CG17571, isoform A [D... [more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|71534671|emb|CAH61268.1|0.000e+0100.00putative trypsin [Lepeophtheirus salmonis][more]
gi|31563314|gb|AAP55755.1|1.853e-16886.64trypsin 1c, partial [Lepeophtheirus salmonis][more]
gi|31563316|gb|AAP55756.1|9.050e-16886.36trypsin 1a [Lepeophtheirus salmonis] >gi|31563318|... [more]
gi|19031228|gb|AAL71881.1|7.194e-16786.21trypsin type 7, partial [Lepeophtheirus salmonis][more]
gi|19031216|gb|AAL71875.1|1.235e-16686.26trypsin type 1, partial [Lepeophtheirus salmonis][more]
gi|31563322|gb|AAP55759.1|4.188e-16384.85trypsin 1b [Lepeophtheirus salmonis][more]
gi|19031218|gb|AAL71876.1|7.171e-16185.06trypsin type 2, partial [Lepeophtheirus salmonis][more]
gi|19031220|gb|AAL71877.1|2.475e-16084.67trypsin type 3, partial [Lepeophtheirus salmonis][more]
gi|19031226|gb|AAL71880.1|1.092e-15886.69trypsin type 6, partial [Lepeophtheirus salmonis][more]
gi|19031222|gb|AAL71878.1|2.613e-15886.80trypsin type 4, partial [Lepeophtheirus salmonis][more]

Pages

back to top
BLAST of EMLSAG00000000025 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold1259_size52279-snap-gene-0.102.060e-7252.89protein:Tk02678 transcript:maker-scaffold1259_size... [more]
maker-scaffold531_size145796-snap-gene-0.211.928e-6851.56protein:Tk12609 transcript:maker-scaffold531_size1... [more]
maker-scaffold1289_size50518-snap-gene-0.104.423e-6851.11protein:Tk08062 transcript:maker-scaffold1289_size... [more]
maker-scaffold270_size230592-snap-gene-1.274.487e-6850.22protein:Tk10976 transcript:maker-scaffold270_size2... [more]
maker-scaffold1142_size59991-snap-gene-0.133.412e-6742.16protein:Tk01292 transcript:maker-scaffold1142_size... [more]
maker-scaffold539_size142544-snap-gene-0.291.057e-5941.11protein:Tk01727 transcript:maker-scaffold539_size1... [more]
maker-scaffold531_size145796-snap-gene-0.187.595e-5241.96protein:Tk12603 transcript:maker-scaffold531_size1... [more]
maker-scaffold17_size721972-snap-gene-5.118.239e-5143.40protein:Tk09975 transcript:maker-scaffold17_size72... [more]
maker-scaffold122_size333723-snap-gene-0.171.794e-4638.65protein:Tk04108 transcript:maker-scaffold122_size3... [more]
maker-scaffold91_size383040-snap-gene-2.264.306e-4640.08protein:Tk03190 transcript:maker-scaffold91_size38... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1005supercontigLSalAtl2s1005:6858..7782 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteTrypsin-1
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1005-augustus-gene-0.8
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000025 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000025EMLSAT00000000025-695872Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1005:6858..7782-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000025-682791 ID=EMLSAG00000000025-682791|Name=EMLSAG00000000025|organism=Lepeophtheirus salmonis|type=gene|length=925bp|location=Sequence derived from alignment at LSalAtl2s1005:6858..7782- (Lepeophtheirus salmonis)
ATGATTAGATTTGTCTGTGCCCTTTTGTTCCTGGTTACTGCAGCCAATGC TGTTCCCCCTCAAATTAAATACTCTGAGAGTTTCATGAAAGTCAAGTCAA TGAGACACAGATTCGGGGGAAGAATCGTTGGAGGAGAAGAAGCTGAGCCT AACTCAATTCCCTTCCAAATTTCATTCCAAACTACTGGAGATTTCCACTT TTGTGGTGGTTCTGTCATGGACAAAGATACTGTTATCACTGCTGCTCATT GCTGTGACAGCTTTAACTCATGGGAAGTCCAAGTTGTTGCTGGTGAACAC GATCTCTTTTCCACTAGTGGGGATGAACAAAAGATTCCCGTAAAAGATAT CACCTACCACGAGATGTTTGGATCCCTGGGTATGAACTACGATATTTGTC TTTTGAAATTGAAGTCGTCCTTGGACCTCAATGAGTAAGTACTATATACT ACTTTTCTACCATTTCTTTTTAAGTATTTAATAATTGTTCCTTCTGTAGA AAAGTTAAGCCCGTTGCTCTCCCAAAAAAGGACCAAGAATTCACTGGTGA TGTTGTTGTGTCCGGATGGGGAACTATCTCATCTAATGGACTATCTTCTC CAGTCCTTAGATCAGTTACTGTCCAAGTTGTTTCTGATGAGTGTGAGACT ATAAAATATATTCTTACCTTGAAAACGAGTTTACCTCTGTAATGTATAAT ATAATAGACTGTAGCGATGCTTACTATGGATCAAACGATGAGACCAACAT CTGTGCTGCTGCCCCTGGAAAGGACTCCTGCCAAGGTGATTCTGGTGGTC CATTGGCTCAAGACGGAACCCTCGTTGGTATTGTTTCTTGGGGATATGGT TGTGCTACTCCTGGATACCCGGGTGTCTACGCAAAGGTATCCATGTTCAT TGACTGGATTGCTCAACACAAATAG
back to top
Add to Basket