EMLSAG00000000141, EMLSAG00000000141-682907 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000141
Unique NameEMLSAG00000000141-682907
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:bt "bent" species:7227 "Drosophila melanogaster" [GO:0005737 "cytoplasm" evidence=ISS] [GO:0004687 "myosin light chain kinase activity" evidence=NAS] [GO:0005200 "structural constituent of cytoskeleton" evidence=ISS] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;NAS] [GO:0006468 "protein phosphorylation" evidence=IEA;NAS] [GO:0007498 "mesoderm development" evidence=IEP] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008307 "structural constituent of muscle" evidence=IDA] [GO:0030018 "Z disc" evidence=IDA] [GO:0045214 "sarcomere organization" evidence=IMP] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0030018 GO:GO:0007498 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0045214 GO:GO:0008307 InterPro:IPR013098 Pfam:PF07679 EMBL:AE014135 OrthoDB:EOG72C4ZC GeneTree:ENSGT00720000108588 GO:GO:0004687 OMA:GCKLKWK RefSeq:NP_001162825.1 UniGene:Dm.4645 ProteinModelPortal:D1YSG0 SMR:D1YSG0 EnsemblMetazoa:FBtr0301340 GeneID:43814 KEGG:dme:Dmel_CG32019 CTD:43814 FlyBase:FBgn0005666 SignaLink:D1YSG0 GenomeRNAi:43814 NextBio:836022 PRO:PR:D1YSG0 Bgee:D1YSG0 Uniprot:D1YSG0)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 458/1288 (35.56%), Postives = 659/1288 (51.16%), Query Frame = 0
Query:   46 EDVEWEWENESIPLRP--EGKVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRK-----------------------KVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLH-PRY--ERSVRG-----------EKLGLVMNQL---------------------------------------ELDDA-GVI-----GXEI-----LEYVKDGEDD---VTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDC-----GPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW-YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +D+E      S PLR   +G  P +V+ Q+ +S  E    Y+   +EG P P  +++KG  ++    R+K  T+G  NTI L +   +  +E  YK+++ N +GE   E + +V+   GMDFRAML KR+                          +KVE KV  ++   +DQ  +E K  KVV  AR S PN K KW  R               E+    +F++    D+Y LI+  P +E++GK+T+    E    ++   + V   DP + F K L  K  G T       C ++ + AN+ W +N   L    PRY   + + G           +  GL   QL                                       E+DDA G +     G EI     ++ VKDG      +  CK+    DAG+  C TN D++ S + + + N+F  ++    E VERE  + +++++D +AP D+  NG+ IVP     +E+K MG GKHQLI   + M + G+I   +    G  +  C    ++  GE  P + DC     GP+S     +    V + V G KQ+ +E  +FKDGK + V +DV +    D+V   +  P R+ SG Y+I I N QG D + + +   D P PP+ +++T + + SCVV  +PP DDGGT I  Y+IE  D+S   + W  VA+     P   K+++LI K +YRFR RA N IG SDP       I+ KDPWDEP KP    + DW  +  DL W  PE+DGG PIT Y +EYKEK    W  G+           +V+G      T  GL EG +Y FR++AVN+ G   PS+ + S++AK R++KPF+   G+ N+ +KKG+T R+DI + GEP P+ TW +    L  D+ RI ++         E+N+ +T+ K+ R  DTG Y + L    GT ++   V VLD P  P     P+EIRA HI + W  P DDGG  I+ Y ++ MD + G W+ A E    +T    KGL P   Y+F V A+NKEGESEP  T + I A NPY PPS P +P I D+DN+SV L+W++P  DGGRPITHYI++ KDKF   W +  KTDD + E  ++       GL E   YQFR+ AVNKAG S PS  T  HLC+HKNL P ID+ +    TIK  RT  W + V GEP PE  W +++ I + + D + I   +Y         ++     D+G Y+L AENRNG D+  ++L+VL
Sbjct: 1475 QDLEDLINKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKD-------------EVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTI----EIGGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLECSVSSSMANVHWFKNNTKLESDDPRYLISKDINGNLKLIIKDSVLDDAGLYRCQLDKQPDKTECNLKVTEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQWLRNGEEIKPDKRIQIVKDGRKRKLVIKDCKVT---DAGQFKCTTNADTTESEIIINYQNRFNKKLK-DTEAVEREKLILDIELQDQTAPCDWKFNGEPIVPSES--IEIKNMGGGKHQLIFSSLDMSNEGEITCES----GQLSSKC--KLSIRKGESRPNI-DCPDKFSGPISAPVLLE----VPFKVSGTKQTPVEAKLFKDGKPLPV-KDVEVAVTDDKVTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLSKK-HGWESVAEVLPSEPCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNT-ILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGK-----------EVDGDART-ATVDGLKEGQQYEFRVRAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAATWVKGTDNLKFDNQRICLDQL-------ERNSSITIKKSVRK-DTGKYKLVLSNSSGTIESEAQVVVLDRPLPPGGPFEPEEIRASHIKMKWKRPDDDGGCEISGYALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKEGESEPLETFDAIVARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKTDDPNPECNVE-------GLKEKMVYQFRVRAVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVTIKSGRTHKWSVDVLGEPIPELHWSWRDDIPLTNGDRIKIENVDYH----TDFSITNVLRKDSGFYTLKAENRNGIDRETVELVVL 2694          

HSP 2 Score: 409.068 bits (1050), Expect = 4.802e-116
Identity = 252/696 (36.21%), Postives = 377/696 (54.17%), Query Frame = 0
Query:  542 QSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADG-KGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW--LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            + DI L+   +G  +K+    N+++H    D ++ N  R+ SG Y +   N  G D   + + ++ KP  PK  + V+ ++ + C ++   P+DDGG  IK Y++E +D  +++ +W +V ++ G K P S  V  L     Y FR  A N  G S+P   +   ++ KDP+DEP+KPG P V D+ + S  L WA P +DGGAPI  Y IE K K+   W++        +EI  D      +  T  GL E  EY FR+ AVNK G S PS+ S   + K + LKP + +  +  + I+ G+  RYD+   GEPAP +TW +N   L  +    S E+  K   Y  K +++   + +    TG Y I  + + G  +AT  VN+L  P KPR  L+  ++  +   L W  P DDGG PI++Y ++  D   G W  L      DT+  VKGL+ GH YQF V A+N+EGES+P  + + I A+NPY   S+P  PNIVD++   V L+W+ P  DGG PI+ YII+KKDKF   +D + + + S        EA + GL EG  YQFR+ AVNKAG S PS  T+PHL + +NL P I++       ++  +   + + VKGEP P  TW+    ++ ST +V +   +Y      KL +  +    +G Y L AEN NG D+  +++I+LD
Sbjct: 2639 RDDIPLT---NGDRIKIE---NVDYH---TDFSITNVLRKDSGFYTLKAENRNGIDRETVELVVLGKPSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMD--TATGKWVRVGRSPGEKEPPSFDVTGLSLGSEYMFRVSAVNEEGESEPL-TTLVGVVAKDPFDEPNKPGTPEVTDYDNQSISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKA-------LEIPGD-----QLEATVAGLQEYGEYQFRVIAVNKAGLSPPSDASVPQIVKYKKLKPRIDRSNLKPLLIRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEI--KNIPYNTKISIIETVRKH----TGIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISAYQVEKFDKKQGRWVPLGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLDSDDSIIAKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTNTSVP------EATVEGLVEGNIYQFRVRAVNKAGFSDPSDATEPHLAKPRNLKPYINRDKMKPIKVRAGQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVRLENIDYN----TKLTLLDTDRKQSGQYKLRAENINGVDEAVVEVIILD 3294          

HSP 3 Score: 394.815 bits (1013), Expect = 2.275e-111
Identity = 239/658 (36.32%), Postives = 344/658 (52.28%), Query Frame = 0
Query:  577 NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            NP+R+ +G YKI   N  G D+    +NI+ KP  P+  +EV+ + K+ C +K   P DDGG  ++ Y++E  D    +  W  V ++DG       V+ L+  H Y+FR +A N+ G S+P E  G  II KDP+  P KPG P   DW++N  +LAW  P SDGG+PI  Y +E K+K   LW++    N+            P    T +GL+EGNEY FR+ A+NKGG S PS+ S    AK RYL P + +  + NI +  G   + D    GEPAP V W+ + +  L     ++IE         +  T L +    RS D+G Y +      G       V + D P  P   L   ++  E  +L W  P DDGGTPI  + I  ++ + G W+ +  + + +  V GL PG+ Y+F V AVN EGES+P    E I A NP+  P +P+     D+D   V L W  P  DGG PI+ YII+K+DK+G W  AL       +   D+ +A IP L EG+ Y+FR+ AVN AG   PS  T P + + +N  P ID+ S     IK  ++  +  KV GEP P+  W     ++ S D V +T  +Y      KL V+ +   D+G Y++ AEN NG+D  D+ + V+D
Sbjct: 4452 NPERKDTGLYKISAHNFYGQDQVEFQINIITKPGKPEGPLEVSEVHKDGCKLKWKKPKDDGGEPVESYLVEKFD--PDTGIWLPVGRSDGP---EYNVDGLVPGHDYKFRVKAVNKEGESEPLETLGS-IIAKDPFSVPTKPGVPEPTDWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNS------------PTPTATVQGLIEGNEYQFRVVALNKGGLSEPSDPSKIFTAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWKLS-NYHLQSGKNVTIET-------PDYYTKLVIRPTQRS-DSGEYLVTATNTSGKDSVLVNVVITDKPSPPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLEPETGCWIPSCRSTEPQVDVTGLSPGNEYKFRVSAVNAEGESQPLVGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEKQDKYGKWERAL-------DVPADQCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNKPPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYN----TKLKVNSATRSDSGIYTVFAENANGEDSADVKVTVID 5071          

HSP 4 Score: 388.267 bits (996), Expect = 3.185e-109
Identity = 253/672 (37.65%), Postives = 355/672 (52.83%), Query Frame = 0
Query:  569 DRVDLN----VINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVL-ITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            D VD N    V+  +R +SG Y I   N  G DE  + V ++ KP  PK  ++V  I+K+SC +K   PDDDGG+ I +Y IE +D    + QW    ++    P++ KV  L     Y+FR RA N+ G S+  E + + II K+P+DEPD+PG+P   +W  +  DLAW  P++DGGAPI  Y I+ ++KS   W     +                 +GT  G+ EG+EY FRI AVNK G S PS+ S SV+AK R+LKP + +  +    ++ G+    D     EP   VTW  N + +   SD I IE    KT +        + K  R+ D G Y +    D G+      + VL  P KP+  L    + AE ++L W  P DDGG PI  Y+++ MD + G W+  + TK  +A V GL  G  Y F V AVN EGESEP  T  P KA+NP+     P +P IVD+      L+W+ P DDGG  IT YI+++KD   G W  AL+T    C+AR+++L A       G  YQFRI+AVNKAG+S PS  +     + +   P ID+ +    TIK  +   + IKV GEPP    W  N  ++ + D    I  E Y+     KL V  S+   +G Y+L AEN +G+D+   ++IVLD
Sbjct: 3550 DNVDYNTKFFVMRAQRSQSGKYIIKATNEVGEDEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLD--PHTGQWLPCGKS--TEPEA-KVIGLHEGKAYKFRVRAVNKEGESEDLE-TEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDPPKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGD------------KCNGTVTGVEEGHEYEFRIVAVNKAGPSDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEI-KTSDHIKIENEDYKTTFI-------MPKVKRA-DRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLAVSNVTAETLHLKWEKPEDDGGDPIEQYLVERMDTETGRWVPVLTTKTPEADVTGLTEGKEYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDGGASITGYIVERKDPNTGKWQKALETSTPDCKARVNDLIA-------GNKYQFRIMAVNKAGKSKPSEPSDQMTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSNYNIDMESYR----TKLTVPISKRFHSGKYTLKAENESGRDEASFEVIVLD 4183          

HSP 5 Score: 379.022 bits (972), Expect = 3.163e-106
Identity = 240/672 (35.71%), Postives = 349/672 (51.93%), Query Frame = 0
Query:  563 NINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            NI+++     L +++  R++SG YK+   N  G DE ++ V I+DKP  P+  IEV+ I K  C +K   P DDGG  I  Y+IE +D  +++ +W      D +    I++  L   HRY+FR +A N  G S+P E     I  K+P+D    PG P + DW  +   L W  P  DGG+PIT+Y IE  +K  G + +          ++TD    P+  G  K L EG +Y FR++AVNK G S PSE ++  +AK R+LKP + +  +  + +K G +   DI   GEPAP V W  N S +  D   + I+         + NT   V +A RS  +G Y IK   + G  +A   V VL  P KP+  L  ++I      L W  P DDGG+PI  Y I+ +D   G WL   ++ + +A V GL  G  Y+F V AVNKEGESE   T +PI A+NPY  P  P +P   ++D   V L W  P +DGG PI  Y+IQ +DK G  W D+       C   +        G+ EG  Y+FRI+AVNKAG S PS  +K  + + + L P ID+ +   K ++  +       +K EPP + TW  N  +I ++D + I  E+Y+        + K +  D G Y + A+N +G D  +++L VL
Sbjct: 3253 NIDYN---TKLTLLDTDRKQSGQYKLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVIEKMD--TATGKWVPAGSVDPEK-YDIEIKGLDPNHRYQFRVKAVNEEGESEPLETESA-ITAKNPFDVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDKDSGEFVKA---------VETD---SPVCKGVVKKLEEGQQYKFRVRAVNKAGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLDINIRGEPAPKVEWFFNNSSVTSDEHSVKID-------NVDYNTKFFVMRAQRS-QSGKYIIKATNEVGEDEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIGLHEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDPPKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNGTVT-------GVEEGHEYEFRIVAVNKAGPSDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEIKTSDHIKIENEDYK----TTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVL 3886          

HSP 6 Score: 377.867 bits (969), Expect = 7.849e-106
Identity = 233/684 (34.06%), Postives = 351/684 (51.32%), Query Frame = 0
Query:  554 KEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREE---YQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            KEV    +V +        L V +  R  SG Y +   NA G D   + V ++DKP PP   ++V  I+  SC +  +PPDDDGG  I +Y++E +D   ++ +W    + DG    ++KV  L   H+Y+FR RA NR G S+P   + Q II K+P+D P KPG P++ D+     DL W  PE+DGG+PIT Y +E ++K    W++         EI  D+      +     L+EG +Y FR++AVNK G   PS+ +++ +A+ +   P + +  + +I+IK G  F +D+   GEP PS  W   G++++ ++DR+ I  F  +T        + +  A RS DTG YT+      GT +    V +LD P  P   L   ++    I L W  P DDGG+ IT YV++ MD +   W+   +  DT+     L   H Y F V AVNK+G+S+P  T +PI A++PY  P +P +P   D+    V L W  P  DGG PI+ YII+K+ KFG W  A      +C       +A +P L+ G  Y+FR+IAVN+ G S PS  +   +C+ + L P  DK   +  T+   +   W + ++  P P  TW  NG +I S      +R E   +Q   T ++  S     D G Y+L+ +N +G         VLD
Sbjct: 5018 KEVYSKDNVKVTNVDYNTKLKVNSATRSDSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLD--ETTGRWIPAGETDGPV-TALKVGGLTPGHKYKFRVRAKNRQGTSEPL-TTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDKFSPDWEKC-------AEISDDI-----TNAHVPDLIEGLKYEFRVRAVNKAGPGSPSDATETHVARPKNTPPKIDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMII-NTDRVKISNFDDRTK-------IRILDAKRS-DTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNLIENHDYSFRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWERAAVVLGDNC-------KAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSN-----SRGESGLFQNELTFEIVSSLRS--DEGRYTLILKNEHGSFDASAHATVLD 5662          

HSP 7 Score: 372.089 bits (954), Expect = 5.213e-104
Identity = 246/703 (34.99%), Postives = 353/703 (50.21%), Query Frame = 0
Query:  556 VKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSK---KTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD--TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECECDMFKTGDLECN 1250
            ++ G++V I        L +   +R  SG Y +   N  G D  L+NV I DKP PP   ++++ + K  C +K   P DDGGT I+++ I+ ++  +    W  +       P+ + V  L   + Y+FR  A N  G S P  +  + I+ ++P+DEP KP      DW  +  DLAW  P  DGG+PI+ Y IE ++K  G W++        +++  D         T   LVEG  Y FR+ AVN  G   PS+++  ++AK R   P + +  +  + IK G++F +D    GEPAP   W      LL        E++SK   K    + NT L V  A RS D+G YT+      G   A   V V+D P  P   L  DEI +E   L W  P DDGG PI +YV++ +D   G W+ A ET    T   V GL PGH Y+F V A N++G SEP  T + I A+NP+  P++P  P I DFD + V L W +P  DGG PIT Y+++K+DKF   W    +  D       D   A +P L EG  Y+FR+ AVNKAG  SPS  T+ H+ R KN  P ID+   S   IK      + + V GEP P   W   G  I +TD V I+  + +     K+ +  ++  D G Y+L A N NG D+ ++ + +LD     E  + + GD+  N
Sbjct: 4726 LQSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPSPPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLEPETGC--W--IPSCRSTEPQ-VDVTGLSPGNEYKFRVSAVNAEGESQPL-VGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEKQDK-YGKWERA-------LDVPAD-----QCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNKPPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKW------LLKKK-----EVYSKDNVKVTNVDYNTKLKVNSATRS-DSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLDETTGRWIPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISD-------DITNAHVPDLIEGLKYEFRVRAVNKAGPGSPSDATETHVARPKNTPPKIDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVKISNFDDR----TKIRILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPL-RNGDVSKN 5385          

HSP 8 Score: 367.081 bits (941), Expect = 1.930e-102
Identity = 230/679 (33.87%), Postives = 349/679 (51.40%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            E+K    + I     +    +   KR   G Y +  +N  G D   + + ++ KP  PK  + V++++  +  +K   P+DDGG  I+ Y++E +D  + + +W  V     K P++  V  L     Y FR +A N  G S+P  ++      K+P+D  D PG+P ++DWS N CDL W  PE DGGA IT Y +E K+ + G WQ+   L TS  + K  VN           L+ GN+Y FRI AVNK G S PSE SD + AK R+  P + +  I +I IK G+  R+DI   GEP  +  W  N + L  D    +I++ S +T        LTV  + R   +G YT+K   + G  +A+  V VLD P  P   L   ++  E   L W  P DDGG PI  Y+I+ MD+++G WL +   K++ A +  L+P H Y+F V+AVN EGESEP    + + A+NP+  P +P  P  VD+D   V L W+ P +DGG PIT Y+++K++K  G    +K  + +     +E +A +P L+E   Y+FR+ A+N AG   PS  +KP + + + L P ID+ +  +   K        I + GEP P+ TW +N   + +T    I    Y      K   +  +  D G Y + A N  GQD+ +  + ++
Sbjct: 3835 EIKTSDHIKIENEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLAVSNVTAETLHLKWEKPEDDGGDPIEQYLVERMD--TETGRWVPVLTT--KTPEA-DVTGLTEGKEYLFRVKAVNSEGESEPL-VTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDGGASITGYIVERKDPNTGKWQKA--LETSTPDCKARVND----------LIAGNKYQFRIMAVNKAGKSKPSEPSDQMTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSNYNIDMESYRTK-------LTVPISKR-FHSGKYTLKAENESGRDEASFEVIVLDKPGPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWLPSGRFKESFAELNNLEPSHEYKFRVLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPITGYVVEKREK--GTDKWIKGTEITIPCLGEECKATVPTLNENCEYEFRVKAINAAGPGEPSDASKPIITKPRKLAPKIDRKNIRTYNFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTTSFSHIENLPYN----TKYINNNPERKDTGLYKISAHNFYGQDQVEFQINII 4481          

HSP 9 Score: 357.451 bits (916), Expect = 2.478e-99
Identity = 229/677 (33.83%), Postives = 338/677 (49.93%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKG----LVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            V I+   DR  + +++ KR  +G Y +  RN  G D   + V I+D P  P+  +    +SKNS V++  PP DDGG+EI HY++E +D  + + +W  V          I+ +NLI  H Y FR RA N+ G S P   S Q I  KDP+  PDKPG+P   DW  +  DL W+ P+ DGGAPI+ Y IE + K  G W++  ++                +   CK     L  G EY FR+ AVN+GG S PS+ S +++ K R+L PF  +  + +I +  G+   + +     P P +TW  NG  + G + R    LF  +  +        +  + RS D G YT+ L  + G+  A+ +  VLD P  P+  L+  +I  +  +L+W  P DDGG+PI  Y+I+ MD+    W  A  +      V  L     Y F V AVN  GES+P   +  I A+N +  P  P +P I D+D   + L+W  P  DGG PI+ YIIQKK+K   ++  ++          ++    IP L+EG+ Y+FR+IAVN+AG+S PS  +   + + + L P I    +  + IK        I   GEP PE TW  N   + S D   IT   +        C    Q  D+G Y L+  N +G D+   +L+VLD
Sbjct: 5323 VKISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGSEITHYVVEKMD--NEAMRWVPVGDCTDT---EIRADNLIENHDYSFRVRAVNKQGQSQPLTTS-QPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPK-FGQWERAAVV----------------LGDNCKAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEI-GSNSRGESGLFQNELTF-------EIVSSLRS-DEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDGCHLTWNVPDDDGGSPILHYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYWTNVR------HVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEVR-IKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNC----QRSDSGIYHLLLRNSSGIDEGSFELVVLD 5956          

HSP 10 Score: 328.176 bits (840), Expect = 5.683e-90
Identity = 225/693 (32.47%), Postives = 342/693 (49.35%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD-WLXAM---ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVN--RTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLC-VSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +GKE+            + +   +++  R   G Y +I++N  G  +   +  ++D+P PPK  +++T I+++ C +  + PDDDGG+ I HYIIE +D+S S+  WS    +         V  L+++  Y FR +A N IG SDP E +   II K+ +DEPD PG+P + DW  +  DL WA+P+SDGGAPI+ Y I+ KEK    W              T+V   P    T     L EG EY FR+ AVN+ G S PSE SD ++AK RYL P +  P +  + IK G  F  DI F GEPAP  TW  N + LL + DR +I            ++V+      RS D+G Y + L    G  + +  + VLD P  P   +  +EI A  + +SW  P D+GG+ I+SYVI+  D+ +G  W+ A+     K   A V  L  G +Y+  V+A N +G S+P  + +P+ A++ Y  P  P +P + D D   +T++W++P  +GG PI  Y I+++D   G W         + E + D        ++    YQ+RI AVN AG    S  +     R     P         K IKV         I + G P P   W +  +++     +      Y+  +   L  +  S   D+G Y++ A N  G+D  D+++IV+D
Sbjct: 5607 NGKEIGSNSRGESGLFQNELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDGCHLTWNVPDDDGGSPILHYIIEKMDLSRST--WSDAGMSTHI---VHDVTRLVHRKEYLFRVKAVNAIGESDPLE-AVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYW--------------TNVRHVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITP-LNEVRIKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSN-DRSTITSIGH-------HSVVHTVNCQRS-DSGIYHLLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDLTHGGGWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPGKPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEYQDDR-------VTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGLIGKRIKVRAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRI-----SYETNSERTLFRIDDSNRRDSGKYTVTAANEFGKDTADIEVIVVD 6257          

HSP 11 Score: 285.034 bits (728), Expect = 1.251e-76
Identity = 191/582 (32.82%), Postives = 298/582 (51.20%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQP-GIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEAR---IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            V+ +   D   + V N KR  SG Y++ ++N  GFD   INV ++D+P PP  +     S +S  +  +PP+DDGG+ I++YIIE  +  SS+  WS+V+         +++ NL+    Y FR  A N+ G SDP   S + I+ + P+D P+ PG P  +D + +S  +AW  P+ DGG+PIT Y IE +  S   W +       D+  K               L+E  EY FR+ AVN  G S  S +SD +  +     P +     I ++ +  G  FR  + +   P P+ +W  NG L +   +RI  +     ++Y          K+ +  +TG YTI L  + G+  A+ +V V+D P  P+  LN  +I  +   L+W TP DDGG+PIT+YV++ +D ++G W+      ++T   V GL+P + Y F V A N+ G S+P   +EPI A++ +  P EP +P ++D+D+ +VTL W +P  DGG  I  Y I+ +D           +D+S  A    I + + ++  L  G  Y+FRI A N AG S PS  +     + K   PS
Sbjct: 6607 VHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGFDTATINVRVLDRPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSST--WSKVSSFCTV--PFVRIRNLVLNKEYDFRVIAENKYGQSDPANTS-EPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTKAVHALCPDLSCK------------IPNLIENAEYEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNG-LEVIPGERIKFDSNDYASMY--------YNKSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGPLNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLD-NSGSWVKISSFVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDIL---------NDSSWNAYDYIIKDTKYQLYNLINGSEYEFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPS 7152          

HSP 12 Score: 265.003 bits (676), Expect = 2.873e-70
Identity = 176/567 (31.04%), Postives = 275/567 (48.50%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKG--LVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHK 1132
            ++ +N +R  SG Y +++RN+ G DE    + ++D+P PP+  +E   I+ NS  +   PP D+GG+EI  Y+IE  D++        V     K   ++ V  L+    Y  R  A N  G SDP   S Q ++ K  +  P  PG+P + D   N   + W  P S+GG+PI  Y+IE ++ + G W +              +NG+P+     +   +   ++Y +RI AVN  G    SE S    A+    KP  +  G+    I+++ G     +I   G P P++ W+R G L L +  RIS E  S++T++        +  +NR  D+G YT+    + G   A   V V+D P  P   L+  E   +HI+L W +P DDGG+ IT Y+I+  +    DW     T  +T  TVK L  G  Y F + A N  G SE     +P+ A++P+ PP  P +P I  +   S  L W  P D GG+PIT YI++++++ G W         +    +  L        +G  Y+FR++AVN+AG   PS  + P    H+
Sbjct: 5922 VHTVNCQRSDSGIYHLLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEKRDLTHGGGWVPAVNYVSAKYNHAV-VPRLLEGTMYELRVMAENLQGRSDPL-TSDQPVVAKSQYTVPGAPGKPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIK--------------INGQPVPTAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGLIGKRIKVRAGEPVNLNIPISGAPTPTIEWKR-GDLKLEEGKRISYETNSERTLF-------RIDDSNRR-DSGKYTVTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRIRAENIYGASEALEG-KPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRERGGEWIKCNNYPTPNTSYTVSNLR-------DGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQ 6455          

HSP 13 Score: 228.409 bits (581), Expect = 8.401e-59
Identity = 188/664 (28.31%), Postives = 286/664 (43.07%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDW------SSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDD---ASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS-SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMID-AGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I   N  G  E L    ++     D P  P    ++  + NS  ++  PPDD GG  I  YI+E         +W +          S  V+NL +  RY FR  A N  G   P + S       DP     +  RP   +       + N   L+W  P +DG + I  Y +E + K+   W+       +DI I + V        T   L EG EY FR+ A N+ G S PS+ S  +  + +  KP +    + +I  + G  F   + +   P P+  W  N ++L  D++R+   L          +    V K ++  D+G Y ++L    G   AT  V VLD P  P  L  DE   + + L W  P+DDGG+ I +Y+I+  +  +  W             ++ L     Y F VIA NK G+S+P  T EPI A +P+  P+ P  P+ +D    S+T+ W KP  DGG PIT YII+K+         L +DD    +  A   +L  +IP L E   Y+FR+ AVN AG+S+ S  +    CR     P I    S    T+         +     P P  +W  NG+++   + +     +Y     A +  +KS   D  G+Y++   N  G D     + V+D
Sbjct: 6331 FRIRAENIYGASEALEGKPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVER---RERGGEWIKCNNYPTPN-TSYTVSNLRDGARYEFRVLAVNEAGPGHPSKPS-------DPMTAEHQRYRPDPPEPPKPDRITRNGVTLSWRPPRTDGKSRIKGYYVEMRPKNGKDWK-----TVNDIPINSTVY-------TVPSLKEGEEYSFRVVAENEVGRSDPSKPSQPITIEEQPNKPCMELGKVRDIVCRAGDDFSIHVPYLAFPKPNAFWYSNDNML-DDNNRVHKHLTD--------DAASVVVKNSKRADSGQYRLQLKNTSGFDTATINVRVLDRPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSSTWSKVSSFCTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPANTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKR---------LLSDDKWTKAVHALCPDLSCKIPNLIENAEYEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLEVIPGERIKFDSNDY-----ASMYYNKSAKRDETGSYTITLTNNKGSDTASCHVTVVD 6948          

HSP 14 Score: 161.77 bits (408), Expect = 2.246e-38
Identity = 109/346 (31.50%), Postives = 173/346 (50.00%), Query Frame = 0
Query:  892 VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD-WLXAMETKDTKATVK---GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
               + K +R + +G Y IK+    G       +   DVP+ P+ ++  ++      +S+  P DDGGTPIT YVI+  D+     W    E   ++  +K    L P   Y+F + AVN  G+S+P      I A++P+  P +PK  ++ D+D     L+W+ P  DGG PIT YI++ K+KF   W    + D  +  A +D       GL EG+ Y+FR+ AVN+AG   PS +TK  + + + + P I      + T+K  +T  + IK  GEP P  TW K G      D   I  ++ +  ++  + + KS   D G Y LV  N +G  +++  ++VLD
Sbjct: 2063 TFKIKKPSRDL-SGPYQIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLSKKHGWESVAEVLPSEPCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGKEVDGDARTATVD-------GLKEGQQYEFRVRAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAATWVK-GTDNLKFDNQRICLDQLERNSS--ITIKKSVRKDTGKYKLVLSNSSGTIESEAQVVVLD 2397          

HSP 15 Score: 151.754 bits (382), Expect = 2.805e-35
Identity = 170/675 (25.19%), Postives = 266/675 (39.41%), Query Frame = 0
Query:  586 YKIIIRNAQGFDE------RLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLA------WALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVN-----KGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-----IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD--RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG---ESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            ++I  +NA G  +      R         P PP   +VT + KN   +K   P  DGG+ I  YIIE  D+  +   W +    +        V NLI    Y FR  A N  G S+P                       S+       C++       W     D  AP        K+ ++     G+   T+    +   NGK +     +   +  + VFR+   N      G  +  +  S   +  + YLK  +  P I N     +++ +G   +  I++ G+   +V  ++N  ++   +D   + + +F        +N V +        D G Y I+   + G+     YV++  +P  P   +    I      L+W  P  DGG  ++ YVI+  D+ +  W+    T KDT   V+GL     Y F V+AVN+ G   P   L PI+A++P  PPS P  P I +     V L W+KP  DGG  I  Y I K++     +   + +   C A     +     L EG+ Y+FRI A N AG   ESS S   K  +       P I K    +  I+ N  A +   + G P P  +WYK   +I++     +    Y  G    L ++     DA  Y   A N+ G   T   L ++
Sbjct: 7122 FRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAV--WVKCNDYNVLD-TEYTVMNLIEMGDYEFRVFAVNSAGRSEP-----------------------SLCTMPIKVCEVLGGKKPDWITRLQDKVAPFG------KDYTLQCAASGKPSPTA----RWLRNGKEIQMNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLK--IGSPPIINRCPSELKLPEGDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKS--------DGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQ--RVNATICAAN----QINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVK-IIDPQAASPPLIVKPLRDANCIQ-NHNAQFTCTINGVPKPTISWYKGAREISNGARYHM----YSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAIM 7738          

HSP 16 Score: 143.28 bits (360), Expect = 8.851e-33
Identity = 144/567 (25.40%), Postives = 227/567 (40.04%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-LAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPE--KPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQ--FEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            V +N   D V + + N  +   G Y+I   N  G       V+I   P  P   + +++I+KNSC++   PP  DGG ++ HY+IE  DVSS    W  V+        +  V  LI    Y FR  A N  G+  P E     I  KDP D P  PG P + +   +   L W  PESDGGA I  Y I+ +E     WQ+   +N + I     +N        C  L+EG +Y FRI A N  G S  S  S +V +   +   P L    + +    +    ++     G P P+++W + G+  + +  R  +        Y E +            D   Y  + +   G +     + ++  P+   P          +  N+    P      P   +V    +I++G     +E K+  A +      H+    + + A N+ G       ++     +P      P+ P I     +S++L W+ P  DG   IT+Y +++++     W     T   S           + GL+ GK Y FRI A N  G S  S
Sbjct: 7397 VKVNIFDDYVAIYIRNIVKSDGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSP--HWITVSSTCKD--TAFNVQGLIENQEYIFRVMAVNENGMGPPLE-GLNPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQR---VNAT-ICAANQIN--------CINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQNHNAQFTCTINGVPKPTISWYK-GAREISNGARYHM--------YSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENIESGGHY-TVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDP------PRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMA---------VSGLTPGKEYDFRIFADNVYGRSDAS 7921          

HSP 17 Score: 119.398 bits (298), Expect = 1.557e-25
Identity = 141/540 (26.11%), Postives = 218/540 (40.37%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDV--SSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPS--------------ETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKAN-RSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDI---DNGDWLXAMETKD------TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQ-SVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            PD P   +V      +  +  + P  DGG+ I+ Y IE  D+   SS N +  + + D K     ++ NLIN   Y FR +A N  GLS P   S +   +K  +  P  PG P V     N  DL W  P  DGG+ IT Y IE ++    +W +    N  D E             T   L+E  +Y FR+ AVN  G S PS              +  D +      + PF             G+ +       G+P+P+  W RNG  +  +  R++ +          K+ V  +  +N ++ D G YT + +   G    +GY+ +   P   R   P E++    + S       G  P+T  + K  ++    N D    +   D       +  VK    G  YQ E    +     E    +  +        PS P  P  + + N+ S  L W+ PS DGG  ++HY+I++KD     W     T  ++C+    +    + GL E + Y FR++AVN+ G   P
Sbjct: 7050 PDEPGQPKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYIIK-DTK----YQLYNLINGSEYEFRIKAKNAAGLSKPSSPSLR-FKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAVWVKCNDYNVLDTEY------------TVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPF-------------GKDYTLQCAASGKPSPTARWLRNGKEIQMNGGRMTCD---------SKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRC--PSELKLPEGDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKS--DGGPYQIEFTNESGSATGEFYVHITGM--------PSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSPHWI----TVSSTCK----DTAFNVQGLIENQEYIFRVMAVNENGMGPP 7529          

HSP 18 Score: 119.398 bits (298), Expect = 1.843e-25
Identity = 85/269 (31.60%), Postives = 129/269 (47.96%), Query Frame = 0
Query:  559 GQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS-IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK-TRY 824
            G+ ++   + +R    + +  R  SG Y +   N  G D   I V ++DKP PP+  +  T  + +   +    P DDGG++I  YIIE  +     + W  V    G  P +   V NL+   +Y FR RA N  G S+  E  G+ ++ K P+D P  P +P++  ++ NS +L W  P+  GG PIT Y +E +E+  G W            IK +    P    T   L +G  Y FR+ AVN+ G   PS+ SD + A+  RY
Sbjct: 6209 GKRISYETNSERTLFRIDDSNRRDSGKYTVTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYIIEFTEF--GVDDWKPVP---GTCPNTNFTVKNLVEGKKYVFRIRAENIYGASEALE--GKPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRERG-GEW------------IKCNNYPTPNTSYTVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQRY 6457          

HSP 19 Score: 107.842 bits (268), Expect = 5.673e-22
Identity = 138/546 (25.27%), Postives = 215/546 (39.38%), Query Frame = 0
Query:  499 SCTGSFNV-IMGEKAPKLGDCGPVSGVAHKDC--NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGL------WQQG--EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYK 1027
            S TG F V I G  +   G  G +S +    C  NW       G K S   +    + K+V     + ++        NV      +   ++++  N  G    L  +N +      D P PP + ++T I  +   ++   P+ DGG  I+ Y I+  +V S  N W +V  A       I   NLI   +Y FR  A N  GLS     S Q + I DP     +   P ++             P  D    I ++  ++     G+      W +G  EI N +   + ++ +   +      G  + +EYV R  AVNK GA     T   + A    + P       ++    KG      I F G P P + W R+G          +IE     TV  ++   + + +    +D+G Y I    + G+  A   V + D P+ PR    + I  E ++LSW  P  DG + IT+Y ++  +     W+    T+ T   V GL PG  Y F + A N  G S+   T   IK +   K
Sbjct: 7431 SATGEFYVHITGMPSAPTGPMG-ISYINKNSCMLNWRPPSYDGGLKVSHYVI----ERKDVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGS--NTWQRV-NATICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSAS-QAVKIIDP-----QAASPPLI-----------VKPLRDANC-IQNHNAQFTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNHFLNINDVFG-EDADEYVCR--AVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFD----KGENVVIKIPFTGFPKPRIHWVRDGE---------NIESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYGRSDASDTSTLIKTKESVK 7934          

HSP 20 Score: 102.064 bits (253), Expect = 3.765e-20
Identity = 88/298 (29.53%), Postives = 129/298 (43.29%), Query Frame = 0
Query:  926 VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP-HLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNG 1220
            V D P +P+ ++ D   + ++ L W  P  DGG+ I  Y I+  DI N     A +   KDTK  +  L  G  Y+F + A N  G S+P       K +  +  PS P  P +       V L+W+KP  DGG  IT YII+++D  G  +  +K +D +    + + E  +  L E   Y+FR+ AVN AG S PS  T P  +C                K     +    Q    G+P P   W +NG +I      +    +       +L +S  Q  D G Y+  A N  G
Sbjct: 7049 VPDEPGQPKVIDWD---SGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYNLINGSEYEFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAVW--VKCNDYN----VLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEIQMNGGRMTCDSK---DGVFRLHISNVQTGDDGDYTCEAMNSLG 7334          

HSP 21 Score: 57.7658 bits (138), Expect = 9.157e-7
Identity = 69/265 (26.04%), Postives = 106/265 (40.00%), Query Frame = 0
Query:  439 PSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC--NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS 701
            P   + ++   + I  GA  R  +   GD  H L ++ +  ED  +   R     G K+   T +   IM   APKL         A+ D   N  +     G+ +  I     +DG+ ++ G    +        L + +     SG Y+I   N  G D  +I V I D+PDPP+   +  I   S  +    P  DG ++I +Y +E  +   SS  W +V         S+ V+ L     Y FR  A N  G SD  + S
Sbjct: 7675 PKPTISWYKGAREISNGA--RYHMYSEGDN-HFLNINDVFGEDADEYVCRAVNKAGAKSTRATLA---IM--TAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHW--VRDGENIESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSS--WIRVGNTRF---TSMAVSGLTPGKEYDFRIFADNVYGRSDASDTS 7924          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:unc-22 species:6239 "Caenorhabditis elegans" [GO:0040011 "locomotion" evidence=IMP] [GO:0000003 "reproduction" evidence=IMP] [GO:0040027 "negative regulation of vulval development" evidence=IMP] [GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP] [GO:0030163 "protein catabolic process" evidence=IMP] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0046872 eggNOG:COG0515 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0018105 GO:GO:0018107 InterPro:IPR013098 Pfam:PF07679 GO:GO:0031672 EMBL:Z73899 GeneTree:ENSGT00720000108588 EMBL:Z73897 EMBL:X15423 PIR:A88852 PIR:S57242 PIR:T27935 RefSeq:NP_001122835.2 RefSeq:NP_001255603.1 RefSeq:NP_001255604.1 RefSeq:NP_502273.2 RefSeq:NP_502274.2 UniGene:Cel.23028 PDB:1KOA PDB:1WIT PDB:1WIU PDB:3UTO PDBsum:1KOA PDBsum:1WIT PDBsum:1WIU PDBsum:3UTO ProteinModelPortal:Q23551 SMR:Q23551 BioGrid:43229 STRING:6239.ZK617.1b PaxDb:Q23551 PRIDE:Q23551 EnsemblMetazoa:ZK617.1b.1 EnsemblMetazoa:ZK617.1b.2 GeneID:178135 KEGG:cel:CELE_ZK617.1 UCSC:ZK617.1a.2 CTD:178135 WormBase:ZK617.1a WormBase:ZK617.1b WormBase:ZK617.1c WormBase:ZK617.1d WormBase:ZK617.1e InParanoid:Q23551 OMA:GCKLKWK SignaLink:Q23551 EvolutionaryTrace:Q23551 NextBio:899860 ArrayExpress:Q23551 Uniprot:Q23551)

HSP 1 Score: 399.823 bits (1026), Expect = 4.828e-113
Identity = 246/715 (34.41%), Postives = 374/715 (52.31%), Query Frame = 0
Query:  520 PVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P+SG    +C W V                  +GK +K    V ++    +  + + N  R  SG + I ++N+ G  +    V ++ +P PPK  +++  +  +   +  +PPDDDGG  +  YI+EA D+ +   ++ +V + D     ++KVN L NK  Y+FR +A N  G S+P   + Q   IKDPWDEP KPGRP + D+ ++  D+AW  P  DGGAPI  Y +E ++     W++              V   P  + +  GL EG EY FR++AVNK G   PSE S+  LAK +++  +L    + +I +K G T R+++  GGEP P V W +    L    + I + + ++K     ++T+L +  A RS D G Y + +    G  +    + VLD P KP   L   ++  +++NLSW  P DDGG PI  Y ++ +D   G W+   + KDTKA + GLK G  YQF V AVNKEG S+   T +  KA+NPY  P +   P++VD+D   V+L W+ P  DGG PIT Y+I+KK K G  W +  K          D+  A I GL EG+ YQFR+ AVNKAG    S  ++  + + +NL P ID+ +  + TIKV     + + V+GEPPP+  W  N   +    ++ I  E+Y+     +  +  +    AG Y+L A N +G DK  +++IVL
Sbjct: 1818 PISGEPLPECLWVV------------------NGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKG-KYIEVGKVD-PNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLS-ADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKE--------------VKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQL---ENGIQLTIDTRKN----EHTILCIPSAMRS-DVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSG-------DQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPV-DDQKIRIESEDYK----TRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVL 2477          

HSP 2 Score: 380.178 bits (975), Expect = 1.005e-106
Identity = 237/686 (34.55%), Postives = 359/686 (52.33%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            D +E++ G  V ++    +  L V   +R  SG++ I   NA G DE  + +N++DKP  P   ++V+ +  +   +    PDDDGG  I++Y+IE  D  ++S +W   A+  G    ++ V+ LI  H Y+FR  A N  G SDP E  G   + KDP+D+P K   P + DW  +  DL W  P +DGGAPI  Y +E K++    W               DV   P    + T   L EG++Y FRI+A NK G   PS+++ S +AK R + P + +  I  I++K G+ F  +I   GEP P++TW   G+ +  D DR+ +     KT +        V +A RS DTG Y IK   + GT  A   V VLD P  PR  L+   I  +  +L+W  P DDGG  I+ YVI+  D   G W    E+KDT   V  L  GH Y+F V AVN+ G+S+P    E I A++P+    +P  P IVD+D     L+W  P+DDGG PI  Y+++ +   G W  A+            EL A + GL  G+ YQFR+ A+NKAGES+PS  ++  + + ++L P I++    ++ +K  +T  + + V+GEP P+  W+ NG  ++S     I   +       KL    +   D+G Y +VA N +G+D+ ++D+ +LD+
Sbjct: 3010 DNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYD--TASGRWVPAAKVAGDKTTAV-VDGLIPGHEYKFRVAAVNAEGESDPLETFGT-TLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN--------------DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSA-SAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESD-DRMKLNNEDGKTKF-------HVKRALRS-DTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAG-------ELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHI---DNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDI 3657          

HSP 3 Score: 374.785 bits (961), Expect = 5.820e-105
Identity = 259/815 (31.78%), Postives = 392/815 (48.10%), Query Frame = 0
Query:  424 GVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDG-KHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC-NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS-LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            G   E YV  V++KD  +P   F N    VP   T   V  + +G K++            +I A+     GD + S +    V      P + D   +  +  K   ++ ++  V G     I  +   +G  V+    + +N    +   +V    R  +G+Y I   N  G D   + V ++D P  P+  ++VT+I K+ C +    P+DDGG EI HY+IE  D  +++ +W+   ++      +  V++L   H Y+FR +A NR G SDP E + + II KDP+D  DKPG P ++DW  +  DL W  P  DGGAPI  Y +E +  S G W     +   ++              T  GL  G  Y FR+KA+NK G S PS+ S +++AK R+L P +++       +K G+T  +D+   GEPAP + W  NGS L  G +  I            + NT LT TK+    D+G Y I    + G  +    VN+LD+P  P   L   +I  E + L W  P DDGG+PIT+YV++  + D G W+   ET DT   V  L  GH Y+F V AVN++G S P  +   I A+NP+  P  P +   VD+D   V L W+ P++DGG PI  YI++KKDKFG W +  + D  + +A  D        L+ G+ YQFR+ AVNKAG   PS  T   + + + + P ++        IK        I  +GEP P   W  N   I +     +T        ++ + +  +   D G Y ++ EN +G+D    ++ VLD+
Sbjct: 3197 GAPIEEYV--VEMKDEFSP---FWNDVAHVPAGQTNATVGNLKEGSKYEF-----------RIRAKNKAGLGDPSDSASA---VAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF--EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQD--AATGRWTACGESKDT---NFHVDDLTQGHEYKFRVKAVNRHGDSDPLE-AREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPS-GDWVPAVTVGAGELT------------ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNN--------TDNNTKLT-TKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQE-DGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATAD-------NLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP----TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDV 3950          

HSP 4 Score: 358.221 bits (918), Expect = 1.562e-99
Identity = 267/863 (30.94%), Postives = 414/863 (47.97%), Query Frame = 0
Query:  383 KLIVEG----DAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLG-DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEV--KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKT-IEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN-GDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLI-TREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +LI+ G    D GE  C T  D + + L V   NKF+  +    E +E++      Q KD   P  +F NGK I      + E  Q  +G H L +  I M +    E       G    SC  +  V+  EK P L      +   A + C   V + ++G ++ D +  + K+GK +  ++ + V +    D  ++   NP+   +G + + + N+ G       + + DKP PPK  +E  +++     +    PD D G  +K YIIE  +    S  W++V +  G      KV +L     Y+FR +A N  GLSDP  ++G+ ++ K+P+  P KP     +D   + C LAW  PE DGGAPIT Y IE +EKS   W Q         E+            T K +VE  EY++R+KAVNK G   P +    +  K +   P     GI ++ +K G T +YD+   GEP P   W  NG  L        +++ S++  +     ++ +  A R+ D+G +TI L    G+  +T  V V+  P  P+  L+  ++ A+   LSW  P DDGG P+T Y+++  D+DN G ++    ++   T   V GL+    Y+F V AVN EGESEP    +  + ++P+  P +P  P I DFD   + + W+ P  DGG PI  YI++ +D     +  +K        R+ +  A I GL EGK YQFR+ AVNKAG   PS  ++  L + K +   +   +  S T+K   T  W++K+ GEP PE  W+K   Q+ +  ++ I TR+         LC+  +   D G Y L  +N +G D+   +L VLD
Sbjct: 1370 RLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALK-DTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFET-QSRNGTHTLKIGKIEMNEADVYEIDQAGLRG----SC--NVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQE--GRSGNWAKVGETKGT---DFKVKDLKEHGEYKFRVKALNECGLSDP--LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCEL------------TDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG---RVKMSSERGKH-----IMKIENAVRA-DSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVK--------RVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEH----TILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLD 2184          

HSP 5 Score: 348.591 bits (893), Expect = 1.520e-96
Identity = 223/656 (33.99%), Postives = 339/656 (51.68%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW-YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            R+ +G Y +   NA G D+  + V ++ KP  P   +EV+++ ++   ++   P+DDGG  I HY IE +D+++   +W    +++        V NL   H Y+FR RA N+ G SDP   +   I+ K+P++ P K  +P ++DW  +  DLAW  P+ DGGAPI  + IE K+K+ G W++  ++       KT          T   L EG EY FRI A NK G   PS+ SD V+AK R L P +H+  + +  +K G T ++ +   GEPAP VTW  NG  +     +I  E +  +           + KA R   +G YTI      GT   T  + V   P KP+  +   ++  +   L W  P DDGG PI  Y I+ M+  +G W+    + DT  TV  L  G  Y+F V AVN EG S+P  T   I A+NP+  P  P  P   D+D+  V L+W  P  DGG PI  Y I+K+ K+G W  A+            +  A +P L+  + Y+FR++AVNK G S PS  +K  + + +NL P ID+ +  + TIK  ++  + + V GEP P  TW + +  +I +   V +   EYQ    +KL V + +  D+GT+++ A N NG+D+  + + V+D
Sbjct: 2451 RKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATG--RWVPCGRSETT---KTTVPNLQPGHEYKFRVRAVNKEGESDPL-TTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPD-DGGAPIEAFVIEKKDKN-GRWEEALVVPGDQ---KT---------ATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISR---------FALPKALRK-QSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGG-------QTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQ----SKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID 3065          

HSP 6 Score: 340.502 bits (872), Expect = 6.991e-94
Identity = 240/701 (34.24%), Postives = 345/701 (49.22%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDR-VDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVY-CEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VEG     IE   F +G  +  G + +I+ + D    L   +  R  SG YKI+  N  G DE  ++VNI+D P  P+  +    I+K S V+K   P DDGG+ I +Y++E         +W    +       S+KVN L   H Y+FR +A NR G S P   S   I+ K+P+DEPD P   + +DW  +  DL W  P +DGGAPI  Y +E K+K  G W +              V+GK     T   L  G  Y FR+KAVNK G   PS+ + +V+AK R + P L+  G+ ++ IK G   + DI F GEPAP   W+ N +         +I+  ++  V     ++ + +  A R  DTG Y I +  + G   A   V VLDVP  P   L  DEI  E   L+W  P D+GGT +  Y+++ MD   G W       D  A V  L PG  Y F V AVN +GES+P    EPI A+N +  P    +P + D+D   + ++W   +++GG P+T YI++KK+K    W +A KT   +  A  D L+   PG+     Y+FR+IAVN AG S PS  T P + + + L P I   S   K IK   T   ++   G P P  TW       A   E+L+  +     +T  +    ++  D+G Y L  +N  G+D+   ++IV D
Sbjct: 3587 VEGEPAPKIEW--FLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEK---QEDGGRWVPCGETSDT---SLKVNKLSEGHEYKFRVKAVNRQGTSAPL-TSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDK-FGDWVEC-----------ARVDGK-TTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDA---------TIDTGARADVTNTPTSSAIHIFSAVRG-DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSA--DNLK---PGVE----YEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK-IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAK----SSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQD 4241          

HSP 7 Score: 298.13 bits (762), Expect = 1.089e-80
Identity = 203/665 (30.53%), Postives = 315/665 (47.37%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK-TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++ +  R  +G YKII+ N  G D    NV ++D P  P+  +++  I K  C +   PP D+GGT++ HYI+E +D S  +  W +V    G  P  + KVN L+    Y FR +A N  G S P E   + II K+ +D PD   +P V DW  +  D+ W    ++GGAP+T Y +E KEK   +W              T+    P    +   L  G EY FR+ AVN  G S PS+ +D  + K RYLKP +       I+IK G T   ++ F G P P+ TW       +GDS      L  +  V  + +T      + +  D+G+Y +K+  + G  +A   V V D P  P   L   ++  +   L+W  P DDGG  I++YV++  D     W+        T  TV  L  GH Y+F V+A N  G S+   T EP+ A++P+  P +P  P IVD DN  + ++W  P D+GG P+ HY I++KD   G +  + T      A  D        + +G  Y++R++AVNKAG   PS  +     +  +  P  D      +  +K     +  I     P P+ +W K G +  +  E   ++         KL +  ++  D+G   + A N  G+ + ++ + V+D
Sbjct: 3915 IHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGT--WQEV----GTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAE-EPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIW--------------TEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILT-ASRKIKIKAGFTHNLEVDFIGAPDPTATW------TVGDS---GAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTR------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQ--------TKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVID 4534          

HSP 8 Score: 274.633 bits (701), Expect = 2.299e-73
Identity = 183/560 (32.68%), Postives = 271/560 (48.39%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTC---KGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP-FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCE-ARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG+YK+ ++N  G DE +  V + D+P  P+  +EV+ ++K+SCV+   PP DDGG EI +Y++E  D  + +N W  V A   G    SI V  L   H Y FR  A N  G SD    + + ++ KDP+  P KPGRP ++D  ++  D+ W  P  +GG+P+ HY+IE K+   G W +              VN  P V GT      + +G+ Y +R+ AVNK G   PS++S +  AK  +  P F          +K G      I F   P P ++W + G   L   +              +  T L +    RS D+G   IK +   G  +A   + V+D P  P  +    +      L+W  P DDGG  I  Y I+  ++ +  W         T  TV+GL+ G  Y+F + A N  G S+ C+ + P+  ++P+ PP  P  P I  +D   V+L W  P DDGG PI  Y++++ +K GG       D A  +   +   E  +PGL E + YQFR+ AVN AG   PS  ++P  CR
Sbjct: 4213 KRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRD--TKTNTWVPVSAFVTGT---SITVPKLTEGHEYEFRVMAENTFGRSDSLN-TDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIK--------------VNTSP-VQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVE------------TTDSQTKLVIPSTRRS-DSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGV-PVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGG------GDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCR 4731          

HSP 9 Score: 248.054 bits (632), Expect = 5.268e-65
Identity = 198/659 (30.05%), Postives = 301/659 (45.68%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT--CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI-WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I   NA G  +    V ++     D P  P T E+T    N   +  +PP DDGG+ I  Y++E  +       W+ V     KG + I V  L     Y+FR RA N  G  +P   +G + +   P+ ++P  P  P V   + NS +L W  P  DGGAPI  Y +E K+     W              T  N KP+       K L E  EY FR+ AVN  G   PS+ SD VL + +  +P      + +I ++ G T +  I + GG P P +    NG+  + +++R  +++   + V       +T T + RS D G Y I      G       V VLD P KP   +   +I+A+ + LSW  P D+GG  IT+YV++      GDW+       T   V+ L     Y+F V A N+ G  EP  T + I A+NP+  P  P +P  V+   +++TL+W +P+ DGG PI  Y+I+K++     W  A           I + + R+ GL+  K Y+FR+ A N AG+   S  + P    +    P I+ G  +   +      A   +     P P+ T+ K   +I+ TD  +  + EY     A L + KS++ D G Y +  EN  G D   + L V+D
Sbjct: 4607 FRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFE-KRGGGDWAPVKMPMVKGTECI-VPGLHENETYQFRVRAVNAAGHGEPS--NGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDW--------------TRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDL-FNGNSPIFENERTVVDVNPGEIV-------ITTTGSKRS-DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKR-TPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKA-------AFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRV--KVEYS-DFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVD 5227          

HSP 10 Score: 230.72 bits (587), Expect = 1.621e-59
Identity = 192/714 (26.89%), Postives = 315/714 (44.12%), Query Frame = 0
Query:  431 VFNVQVKDPSAPVDFFLNGKIIV-----------PGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAP-----KLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDI--DNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
             +N  ++D  AP+D ++  K  +           P  DT  EVK +G+ K +     I +   G+ E   P++             +++ E+ P      + +   ++  A +     + YA  G  +  I+L  F     +   +   ++ +   + +     KR  +G YKI   N  G D   +NV ++D P  P   I  T I  ++  +   PP D+GG  I +Y++E     +    W  V    G    +++V NL     Y FR RA N+ G+ +P E +   I+ K+P+D P  PG+P  ++ S  +  L W  P SDGGAPI  Y IE +E     W +    N  D + +              GL     Y FR+ A N  G    S  S  + A     +P ++  G+   +I    G   +  + F   PAP VT+ +  + +     R+ +E       Y +    LT+ K+  + D G Y ++L    G+  A+  + V+D P  P+ +  ++I  +   L W  P  DGG+PIT+Y+++ +D+   +G W       ++   TV GL   + Y+F V A  + G SEPC   + + A+  ++ P++P+ P + D D+    L W  P  DGG  I  Y +Q +D   G W +A       C AR+        GL +   ++FRIIA N AG S PS
Sbjct: 4756 TWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE-KEEYEFRVIAVNSAGEGEPSKPSD-------------LVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYA-GGNPKPIIDL--FNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEK---RTPGGDWVTVGHPVGT---TLRVRNLDANTPYEFRVRAENQYGVGEPLE-TDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHR------------VTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINM-GMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVE-------YSDFLATLTIEKSELT-DGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPR-DGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVT-------GLRQNGEFEFRIIAKNAAGFSKPS 5416          

HSP 11 Score: 154.066 bits (388), Expect = 4.856e-36
Identity = 154/578 (26.64%), Postives = 248/578 (42.91%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIE-YKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI----EIKKGR---TFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLC-----DGGTQQATGYVNVLDVPEKP----RXLNPDEIRAE---HINLSWATPHD-------DGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            L + + +R  SG  KI   N  G  E  I + ++DKP  P+ I    +S+++C +    P DDGG EI  Y IE  +V S    W +V         +  V  L +  +YRFR RA N +GLSD     G  ++IKDP+D P  P  P +  + +N   LAW  P  DGG+PI  Y +E ++++  G W   ++               PMV GT     GL E   Y FR++AVN  G   PS  S+ V       +P++ +PG  +     +I K     T+   +  GG P      E+     LGD+D      +++      ++T   V       +   Y  +++      +G   + +  V + + P +P      L    +RA     I + +A  +        +G +PI      ++D++ G+ +          T  G K      +++ A NK G+ + C+ L     + P KP    +     D    ++TL W+ P D+GG  IT+Y+++K+   G W             R+  L+A  P       Y+FR+ A N+ G   P
Sbjct: 4500 LVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQI--WDKVPGLISG--TAYTVRGLEHGQQYRFRIRAENAVGLSD--YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKM---------------PMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTC-----RPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKK---LGDND------WTRCNDKPVRDTAFEVKNLG---EKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV---------ITTTGSKRSDAGPYKISATNKYGK-DTCK-LNVFVLDAPGKPTGPIR---ATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTV--GHPVGTTLRVRNLDANTP-------YEFRVRAENQYGVGEP 5016          

HSP 12 Score: 145.976 bits (367), Expect = 1.485e-33
Identity = 164/665 (24.66%), Postives = 270/665 (40.60%), Query Frame = 0
Query:  586 YKIIIRNAQGFD------ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGG-----APITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKK-DKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS------FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++II +NA GF       ER    +    P PP  +    I +N C +    P +DGG++I  Y +E  +  S+   W+  +  + + P+   V+ L   + Y FR  A N          +G+ I        P  P  P  +  S  S       PE         A  T   +   E +    + G  L  S        +G  +   T K + + +   + ++  N  G       SD+  A      P + +  + N  +  G   R  I+F G      T     SL+L + + I ++  + + V  + + ++T+  A    + G Y   +  D G      ++NV  +PE P+  L+   I      LSW  P  DGG+ ITSYV++  D+   +W+      KD    V GL   H Y+F V A N+ G   P  +  PI A  P+ PP+ P    IV      VTL WQ+P  DGG  +  YI++K+ ++   WF   +                +P L +G+ Y++R+ AVN AG S  +      F+        K ++P  D         +V R   ++ ++ G P PE+ W+K   ++  T +  +  +    G    L ++     DA  Y+  A N +G   T  +L +
Sbjct: 5402 FRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGST--LWTVASDYNVREPE-FTVDKLREFNDYEFRVVAIN---------AAGKGI--------PSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG--VYKFTIKEVWDIDAGEYTVEVSNPYG-------SDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSG------TAPFRHSLVL-NREEIDMDHPTIRIVEFDDHILITIP-ALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPN-------NYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNE------EVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINK----GDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRI 6012          

HSP 13 Score: 133.65 bits (335), Expect = 7.092e-30
Identity = 82/245 (33.47%), Postives = 130/245 (53.06%), Query Frame = 0
Query:  584 GSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIII-KDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            G Y + + N+QG D   I + ++DKP  P+ I V  I+ + C +   PP  DGG+ I +YI+E +D+  S  +W +V+        +  V  LI  +RYRFR RA  + G+S+P E++  D+++ K  ++ P++P  P+V D  S   +L W  P  DGG+ I  Y+++Y++ S G W          I  K D++ +   H    GL +  E+ FRI A N  G S PS  S+    K+R+  P
Sbjct: 5204 GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRN--LNYTVGGLIKDNRYRFRVRAETQYGVSEPCELA--DVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWD-PPRDGGSKIIGYQVQYRDTSSGRW----------INAKMDLSEQ--CHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPP 5431          

HSP 14 Score: 132.109 bits (331), Expect = 2.624e-29
Identity = 143/558 (25.63%), Postives = 234/558 (41.94%), Query Frame = 0
Query:  582 KSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVL-AKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP-------DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGH--IYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            ++G Y+  + N  G       +N+   P+ P+  + +++I  ++  +   PP  DGG++I  Y++E  D+S   ++W  V  ++ K    I V  L   H Y FR  A N  G+  P  +S   II + P+D P  P    ++    +   L+W  P SDGG  +  Y +E +E+    W             + + N  P  +     L++G +Y +R+ AVN  G S  +E   ++  A      P +  P + ++  + GR   ++    G P P   W +    L+  S    I    K+ +     T         S D   YT +     GT+        L +  KPR   P       +  + E I L    P+         +      I+N     ++ T D  AT++          ++ V+  N  G      T+    A+ P +PP  P   NI+D   ++V L W+ P+ DGG  +T+Y I+K++  GG +       + C A+       I GL  GK Y+FRIIA NK G+S P   T P L
Sbjct: 5693 EAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSK--DEWVTVT-SNVKDMNYI-VTGLFENHEYEFRVSAQNENGIGAPL-VSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEW------------FRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSP-LSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT---------SDDADEYTCRATNSSGTRSTRAN---LRIKTKPRVFIPPKYHGGYEAQKGETIELK--IPYKAYPQGEARWTKDGEKIENNSKF-SITTDDKFATLRISNASREDYGEYRVVVENSVGSD--SGTVNVTVADVP-EPPRFPIIENILD---EAVILSWKPPALDGGSLVTNYTIEKREAMGGSW-------SPC-AKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVL 6203          

HSP 15 Score: 119.783 bits (299), Expect = 1.457e-25
Identity = 124/483 (25.67%), Postives = 206/483 (42.65%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEI---------SGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLR 1048
            +++  +N  G    L++ + +      D P  P  +E+  +  +   +    P  DGG  ++ YI+E  +     ++W +  Q +   P +  V NLI+  +YR+R  A N  GLSD  E+         SG+   I  P  D  ++ GR    +     C+++        G+P   Y           W +G  E+++TS   +    + + ++      L   +   +  +A N  G      T  ++  KT   KP +  P  Y+   E +KG T    I +   P     W ++G  +  +S       FS  T   +K   L ++ A+R  D G Y + +    G+   T  V V DVPE PR    + I  E + LSW  P  DGG+ +T+Y I+  +   G W    +++ T  T++GL+ G  Y+F +IA NK G+S+PC    P+       P  E K     D D Q   +R
Sbjct: 5792 FRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQE--EEHDEWFRCNQ-NPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFE-----CEIS--------GSPRPEYR----------WFKGCKELVDTSKYTLINKGDKQVLI---INDLTSDDADEYTCRATNSSGTR---STRANLRIKT---KPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSK------FSITT--DDKFATLRISNASRE-DYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPV-----LIPGDERKRRRGYDVDEQGKIVR 6225          

HSP 16 Score: 105.145 bits (261), Expect = 3.512e-21
Identity = 137/517 (26.50%), Postives = 208/517 (40.23%), Query Frame = 0
Query:  632 PDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-LAKTRYLKPFL-------HQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVP----EKPRXLNP--DEIRAEHINLSWATPHDDGGTPITSYVIKMMDID-NGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEP-NIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDD-ASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            P  DGG++I  Y ++  D  +SS +W   A+ D       +V  L     + FR  A N  G S P   S +   +K  +  P  P          N C + W  P  DGG+ IT Y +E +E    LW      N  + E   D             L E N+Y FR+ A+N  G  +PS  S  + + ++   +P +        QP  YN      R   +     G P P+  W RNG  L  +S R   E  +   VY  K T+  V      ID G YT+++    G+  AT  + V   P    + P  + P  D +R + I  S   P         S V+   +ID +   +  +E  D    T+  L      ++E    N  GE+     L      N    P  P+ P +I +    + TL W+ P  DGG  IT Y+++K+D        L  D+  +  + + ++   + GL E   Y+FR+ A N+ G  +P     P + R
Sbjct: 5353 PPRDGGSKIIGYQVQYRD--TSSGRWIN-AKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS-ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVD------------KLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP--YN------RRAVFTCEAVGRPEPTARWLRNGRELP-ESSRYRFE--ASDGVY--KFTIKEVW----DIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLK-IYFSGTAPFRH------SLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWL------NVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRD--------LSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIAR 5815          

HSP 17 Score: 104.375 bits (259), Expect = 6.950e-21
Identity = 110/484 (22.73%), Postives = 195/484 (40.29%), Query Frame = 0
Query:   46 EDVEWEWENESIPLRPEG---KVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRK-------------------------KVQRKVEV----KVHDWIETPVDQEVQENKVDKVV-LTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPL-HPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIV----EGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGV-ERESYVFNVQVKDPSAPVDFFLNGKII-VPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEART 489
            E V+   E  S PL P G     PK+V   +  +  E +   +  ++ G P P  +WFKG +++    R+K  T+G E+T+ L +   R ++EG Y + ++N +G    + K  VT + G+DFRAML  R+                         + +R+  +    KV  W + P+ ++  + +VDK+       S PN K +WY             D         +++ +  ++  TLI++NP ++++GK+T     E     T   + V+ P  ++ F   L   +     +     C +N   A + W R    +    PR+                           I+E     +D V  C L +    E D  E T    +D  S       + +    V  +++ V E +       V D  A V ++ +GK I + G   ++E       K +LI++   +ED+G+ +  T
Sbjct:  957 ESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKW-DIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWY------------KDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTC----EANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRF---------------------------IIE-----KDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNR---KRRLIINGARIEDHGEYKCTT 1388          

HSP 18 Score: 103.99 bits (258), Expect = 8.366e-21
Identity = 93/361 (25.76%), Postives = 154/361 (42.66%), Query Frame = 0
Query:  926 VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-------VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD---LMQECECDMFKTGDL-----ECNCSNGFRHGEVGGKHLLEID 1269
            V + PE P   + D   AE   L W  P D GG+ I  Y ++  D  +G W+ A    ++   A V GL+    ++F +IA N  G S+P    E  + ++ + PP  P             T+ W  P +DGG  IT Y ++ ++ +G     + +D       + E E  +  L E   Y+FR++A+N AG+  PS  + P   +          GS     +K        NR A++  +  G P P   W +NG ++  +      R E   G   K  + +   IDAG Y++   N  G D    +L+V     + ++    +  +GDL       + +  FRH  V  +  +++D
Sbjct: 5330 VPNQPEAPTVRDKDSTWAE---LEWDPPRD-GGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIRE-YGSTLWTVASD-----YNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESG-------GSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRY---RFEASDGV-YKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMD 5669          

HSP 19 Score: 69.707 bits (169), Expect = 2.334e-10
Identity = 74/300 (24.67%), Postives = 129/300 (43.00%), Query Frame = 0
Query:  413 KFVSEVSSQNEGVERESYVFNVQVK-DPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSG--VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            K VS +S  NE V R    F  ++   P     +F   K +V    ++  +   GD K  LI++ +T +D  +   R   + G ++       N+ +  K P++       G   A K     +    + Y Q +   +  KDG++++     +I        L + N  RE  G Y++++ N+ G D   +NV + D P+PP+   + +I   + ++   PP  DGG+ + +Y IE  +    S  WS  A++         +  L    +Y FR  A N+ G S P E +   +I  D
Sbjct: 5924 KIVSPLSDLNEEVGR-CVTFECEISGSPRPEYRWFKGCKELV--DTSKYTLINKGD-KQVLIINDLTSDDADEYTCRATNSSGTRSTRA----NLRIKTK-PRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWT--KDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGS--WSPCAKSRY---TYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGD 6207          

HSP 20 Score: 52.7582 bits (125), Expect = 2.882e-5
Identity = 78/327 (23.85%), Postives = 125/327 (38.23%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI-----KAENP--YKPPSEPKEP--NIVDFD-----NQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             D P  P  L   ++  +++ LSW  P  DGG  +  Y+++  + ++ +W    +  +      V  L  G  Y++ V AVN  G S+     + +       E P    P S+  E     V F+     +     RW K   +      + +I K DK     + L +DDA      DE   R               A N +G  S       +TKP +     + P    G  + K      T   +I  K  P  E  W K+G +I +  +  IT ++      A L +S +   D G Y +V EN  G D   +++ V D+
Sbjct: 5818 FDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA------DEYTCR---------------ATNSSGTRSTRANLRIKTKPRVF----IPPKYHGGYEAQK----GETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDD----KFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADV 6111          

HSP 21 Score: 48.9062 bits (115), Expect = 4.984e-4
Identity = 35/112 (31.25%), Postives = 50/112 (44.64%), Query Frame = 0
Query: 1131 HKNLTPSIDKGSSSSK----------TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEV--LITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
             K  TP +  G+S S           T+  N TAI   KV G P P F W+K   ++ S      +   +E+    T  L + K +  D G Y+L  EN +G D  D+ L+V
Sbjct:  964 EKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEH----TVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLV 1071          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:unc-22 "Twitchin" species:6239 "Caenorhabditis elegans" [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0004672 "protein kinase activity" evidence=IEA] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA] [GO:0005516 "calmodulin binding" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA] [GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA] [GO:0018105 "peptidyl-serine phosphorylation" evidence=IDA] [GO:0018107 "peptidyl-threonine phosphorylation" evidence=IDA] [GO:0031672 "A band" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0046872 eggNOG:COG0515 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0018105 GO:GO:0018107 InterPro:IPR013098 Pfam:PF07679 GO:GO:0031672 EMBL:Z73899 GeneTree:ENSGT00720000108588 EMBL:Z73897 EMBL:X15423 PIR:A88852 PIR:S57242 PIR:T27935 RefSeq:NP_001122835.2 RefSeq:NP_001255603.1 RefSeq:NP_001255604.1 RefSeq:NP_502273.2 RefSeq:NP_502274.2 UniGene:Cel.23028 PDB:1KOA PDB:1WIT PDB:1WIU PDB:3UTO PDBsum:1KOA PDBsum:1WIT PDBsum:1WIU PDBsum:3UTO ProteinModelPortal:Q23551 SMR:Q23551 BioGrid:43229 STRING:6239.ZK617.1b PaxDb:Q23551 PRIDE:Q23551 EnsemblMetazoa:ZK617.1b.1 EnsemblMetazoa:ZK617.1b.2 GeneID:178135 KEGG:cel:CELE_ZK617.1 UCSC:ZK617.1a.2 CTD:178135 WormBase:ZK617.1a WormBase:ZK617.1b WormBase:ZK617.1c WormBase:ZK617.1d WormBase:ZK617.1e InParanoid:Q23551 OMA:GCKLKWK SignaLink:Q23551 EvolutionaryTrace:Q23551 NextBio:899860 ArrayExpress:Q23551 Uniprot:Q23551)

HSP 1 Score: 399.823 bits (1026), Expect = 4.828e-113
Identity = 246/715 (34.41%), Postives = 374/715 (52.31%), Query Frame = 0
Query:  520 PVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P+SG    +C W V                  +GK +K    V ++    +  + + N  R  SG + I ++N+ G  +    V ++ +P PPK  +++  +  +   +  +PPDDDGG  +  YI+EA D+ +   ++ +V + D     ++KVN L NK  Y+FR +A N  G S+P   + Q   IKDPWDEP KPGRP + D+ ++  D+AW  P  DGGAPI  Y +E ++     W++              V   P  + +  GL EG EY FR++AVNK G   PSE S+  LAK +++  +L    + +I +K G T R+++  GGEP P V W +    L    + I + + ++K     ++T+L +  A RS D G Y + +    G  +    + VLD P KP   L   ++  +++NLSW  P DDGG PI  Y ++ +D   G W+   + KDTKA + GLK G  YQF V AVNKEG S+   T +  KA+NPY  P +   P++VD+D   V+L W+ P  DGG PIT Y+I+KK K G  W +  K          D+  A I GL EG+ YQFR+ AVNKAG    S  ++  + + +NL P ID+ +  + TIKV     + + V+GEPPP+  W  N   +    ++ I  E+Y+     +  +  +    AG Y+L A N +G DK  +++IVL
Sbjct: 1818 PISGEPLPECLWVV------------------NGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKG-KYIEVGKVD-PNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLS-ADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKE--------------VKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQL---ENGIQLTIDTRKN----EHTILCIPSAMRS-DVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSG-------DQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPV-DDQKIRIESEDYK----TRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVL 2477          

HSP 2 Score: 380.178 bits (975), Expect = 1.005e-106
Identity = 237/686 (34.55%), Postives = 359/686 (52.33%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            D +E++ G  V ++    +  L V   +R  SG++ I   NA G DE  + +N++DKP  P   ++V+ +  +   +    PDDDGG  I++Y+IE  D  ++S +W   A+  G    ++ V+ LI  H Y+FR  A N  G SDP E  G   + KDP+D+P K   P + DW  +  DL W  P +DGGAPI  Y +E K++    W               DV   P    + T   L EG++Y FRI+A NK G   PS+++ S +AK R + P + +  I  I++K G+ F  +I   GEP P++TW   G+ +  D DR+ +     KT +        V +A RS DTG Y IK   + GT  A   V VLD P  PR  L+   I  +  +L+W  P DDGG  I+ YVI+  D   G W    E+KDT   V  L  GH Y+F V AVN+ G+S+P    E I A++P+    +P  P IVD+D     L+W  P+DDGG PI  Y+++ +   G W  A+            EL A + GL  G+ YQFR+ A+NKAGES+PS  ++  + + ++L P I++    ++ +K  +T  + + V+GEP P+  W+ NG  ++S     I   +       KL    +   D+G Y +VA N +G+D+ ++D+ +LD+
Sbjct: 3010 DNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYD--TASGRWVPAAKVAGDKTTAV-VDGLIPGHEYKFRVAAVNAEGESDPLETFGT-TLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN--------------DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSA-SAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESD-DRMKLNNEDGKTKF-------HVKRALRS-DTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAG-------ELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHI---DNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDI 3657          

HSP 3 Score: 374.785 bits (961), Expect = 5.820e-105
Identity = 259/815 (31.78%), Postives = 392/815 (48.10%), Query Frame = 0
Query:  424 GVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDG-KHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC-NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS-LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            G   E YV  V++KD  +P   F N    VP   T   V  + +G K++            +I A+     GD + S +    V      P + D   +  +  K   ++ ++  V G     I  +   +G  V+    + +N    +   +V    R  +G+Y I   N  G D   + V ++D P  P+  ++VT+I K+ C +    P+DDGG EI HY+IE  D  +++ +W+   ++      +  V++L   H Y+FR +A NR G SDP E + + II KDP+D  DKPG P ++DW  +  DL W  P  DGGAPI  Y +E +  S G W     +   ++              T  GL  G  Y FR+KA+NK G S PS+ S +++AK R+L P +++       +K G+T  +D+   GEPAP + W  NGS L  G +  I            + NT LT TK+    D+G Y I    + G  +    VN+LD+P  P   L   +I  E + L W  P DDGG+PIT+YV++  + D G W+   ET DT   V  L  GH Y+F V AVN++G S P  +   I A+NP+  P  P +   VD+D   V L W+ P++DGG PI  YI++KKDKFG W +  + D  + +A  D        L+ G+ YQFR+ AVNKAG   PS  T   + + + + P ++        IK        I  +GEP P   W  N   I +     +T        ++ + +  +   D G Y ++ EN +G+D    ++ VLD+
Sbjct: 3197 GAPIEEYV--VEMKDEFSP---FWNDVAHVPAGQTNATVGNLKEGSKYEF-----------RIRAKNKAGLGDPSDSASA---VAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF--EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQD--AATGRWTACGESKDT---NFHVDDLTQGHEYKFRVKAVNRHGDSDPLE-AREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPS-GDWVPAVTVGAGELT------------ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNN--------TDNNTKLT-TKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQE-DGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATAD-------NLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP----TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDV 3950          

HSP 4 Score: 358.221 bits (918), Expect = 1.562e-99
Identity = 267/863 (30.94%), Postives = 414/863 (47.97%), Query Frame = 0
Query:  383 KLIVEG----DAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLG-DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEV--KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKT-IEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN-GDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLI-TREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +LI+ G    D GE  C T  D + + L V   NKF+  +    E +E++      Q KD   P  +F NGK I      + E  Q  +G H L +  I M +    E       G    SC  +  V+  EK P L      +   A + C   V + ++G ++ D +  + K+GK +  ++ + V +    D  ++   NP+   +G + + + N+ G       + + DKP PPK  +E  +++     +    PD D G  +K YIIE  +    S  W++V +  G      KV +L     Y+FR +A N  GLSDP  ++G+ ++ K+P+  P KP     +D   + C LAW  PE DGGAPIT Y IE +EKS   W Q         E+            T K +VE  EY++R+KAVNK G   P +    +  K +   P     GI ++ +K G T +YD+   GEP P   W  NG  L        +++ S++  +     ++ +  A R+ D+G +TI L    G+  +T  V V+  P  P+  L+  ++ A+   LSW  P DDGG P+T Y+++  D+DN G ++    ++   T   V GL+    Y+F V AVN EGESEP    +  + ++P+  P +P  P I DFD   + + W+ P  DGG PI  YI++ +D     +  +K        R+ +  A I GL EGK YQFR+ AVNKAG   PS  ++  L + K +   +   +  S T+K   T  W++K+ GEP PE  W+K   Q+ +  ++ I TR+         LC+  +   D G Y L  +N +G D+   +L VLD
Sbjct: 1370 RLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALK-DTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFET-QSRNGTHTLKIGKIEMNEADVYEIDQAGLRG----SC--NVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQE--GRSGNWAKVGETKGT---DFKVKDLKEHGEYKFRVKALNECGLSDP--LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCEL------------TDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG---RVKMSSERGKH-----IMKIENAVRA-DSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVK--------RVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEH----TILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLD 2184          

HSP 5 Score: 348.591 bits (893), Expect = 1.520e-96
Identity = 223/656 (33.99%), Postives = 339/656 (51.68%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW-YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            R+ +G Y +   NA G D+  + V ++ KP  P   +EV+++ ++   ++   P+DDGG  I HY IE +D+++   +W    +++        V NL   H Y+FR RA N+ G SDP   +   I+ K+P++ P K  +P ++DW  +  DLAW  P+ DGGAPI  + IE K+K+ G W++  ++       KT          T   L EG EY FRI A NK G   PS+ SD V+AK R L P +H+  + +  +K G T ++ +   GEPAP VTW  NG  +     +I  E +  +           + KA R   +G YTI      GT   T  + V   P KP+  +   ++  +   L W  P DDGG PI  Y I+ M+  +G W+    + DT  TV  L  G  Y+F V AVN EG S+P  T   I A+NP+  P  P  P   D+D+  V L+W  P  DGG PI  Y I+K+ K+G W  A+            +  A +P L+  + Y+FR++AVNK G S PS  +K  + + +NL P ID+ +  + TIK  ++  + + V GEP P  TW + +  +I +   V +   EYQ    +KL V + +  D+GT+++ A N NG+D+  + + V+D
Sbjct: 2451 RKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATG--RWVPCGRSETT---KTTVPNLQPGHEYKFRVRAVNKEGESDPL-TTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPD-DGGAPIEAFVIEKKDKN-GRWEEALVVPGDQ---KT---------ATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISR---------FALPKALRK-QSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGG-------QTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQ----SKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID 3065          

HSP 6 Score: 340.502 bits (872), Expect = 6.991e-94
Identity = 240/701 (34.24%), Postives = 345/701 (49.22%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDR-VDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVY-CEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VEG     IE   F +G  +  G + +I+ + D    L   +  R  SG YKI+  N  G DE  ++VNI+D P  P+  +    I+K S V+K   P DDGG+ I +Y++E         +W    +       S+KVN L   H Y+FR +A NR G S P   S   I+ K+P+DEPD P   + +DW  +  DL W  P +DGGAPI  Y +E K+K  G W +              V+GK     T   L  G  Y FR+KAVNK G   PS+ + +V+AK R + P L+  G+ ++ IK G   + DI F GEPAP   W+ N +         +I+  ++  V     ++ + +  A R  DTG Y I +  + G   A   V VLDVP  P   L  DEI  E   L+W  P D+GGT +  Y+++ MD   G W       D  A V  L PG  Y F V AVN +GES+P    EPI A+N +  P    +P + D+D   + ++W   +++GG P+T YI++KK+K    W +A KT   +  A  D L+   PG+     Y+FR+IAVN AG S PS  T P + + + L P I   S   K IK   T   ++   G P P  TW       A   E+L+  +     +T  +    ++  D+G Y L  +N  G+D+   ++IV D
Sbjct: 3587 VEGEPAPKIEW--FLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEK---QEDGGRWVPCGETSDT---SLKVNKLSEGHEYKFRVKAVNRQGTSAPL-TSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDK-FGDWVEC-----------ARVDGK-TTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDA---------TIDTGARADVTNTPTSSAIHIFSAVRG-DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSA--DNLK---PGVE----YEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK-IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAK----SSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQD 4241          

HSP 7 Score: 298.13 bits (762), Expect = 1.089e-80
Identity = 203/665 (30.53%), Postives = 315/665 (47.37%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK-TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++ +  R  +G YKII+ N  G D    NV ++D P  P+  +++  I K  C +   PP D+GGT++ HYI+E +D S  +  W +V    G  P  + KVN L+    Y FR +A N  G S P E   + II K+ +D PD   +P V DW  +  D+ W    ++GGAP+T Y +E KEK   +W              T+    P    +   L  G EY FR+ AVN  G S PS+ +D  + K RYLKP +       I+IK G T   ++ F G P P+ TW       +GDS      L  +  V  + +T      + +  D+G+Y +K+  + G  +A   V V D P  P   L   ++  +   L+W  P DDGG  I++YV++  D     W+        T  TV  L  GH Y+F V+A N  G S+   T EP+ A++P+  P +P  P IVD DN  + ++W  P D+GG P+ HY I++KD   G +  + T      A  D        + +G  Y++R++AVNKAG   PS  +     +  +  P  D      +  +K     +  I     P P+ +W K G +  +  E   ++         KL +  ++  D+G   + A N  G+ + ++ + V+D
Sbjct: 3915 IHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGT--WQEV----GTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAE-EPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIW--------------TEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILT-ASRKIKIKAGFTHNLEVDFIGAPDPTATW------TVGDS---GAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTR------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQ--------TKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVID 4534          

HSP 8 Score: 274.633 bits (701), Expect = 2.299e-73
Identity = 183/560 (32.68%), Postives = 271/560 (48.39%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTC---KGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP-FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCE-ARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG+YK+ ++N  G DE +  V + D+P  P+  +EV+ ++K+SCV+   PP DDGG EI +Y++E  D  + +N W  V A   G    SI V  L   H Y FR  A N  G SD    + + ++ KDP+  P KPGRP ++D  ++  D+ W  P  +GG+P+ HY+IE K+   G W +              VN  P V GT      + +G+ Y +R+ AVNK G   PS++S +  AK  +  P F          +K G      I F   P P ++W + G   L   +              +  T L +    RS D+G   IK +   G  +A   + V+D P  P  +    +      L+W  P DDGG  I  Y I+  ++ +  W         T  TV+GL+ G  Y+F + A N  G S+ C+ + P+  ++P+ PP  P  P I  +D   V+L W  P DDGG PI  Y++++ +K GG       D A  +   +   E  +PGL E + YQFR+ AVN AG   PS  ++P  CR
Sbjct: 4213 KRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRD--TKTNTWVPVSAFVTGT---SITVPKLTEGHEYEFRVMAENTFGRSDSLN-TDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIK--------------VNTSP-VQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVE------------TTDSQTKLVIPSTRRS-DSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGV-PVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGG------GDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCR 4731          

HSP 9 Score: 248.054 bits (632), Expect = 5.268e-65
Identity = 198/659 (30.05%), Postives = 301/659 (45.68%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT--CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI-WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I   NA G  +    V ++     D P  P T E+T    N   +  +PP DDGG+ I  Y++E  +       W+ V     KG + I V  L     Y+FR RA N  G  +P   +G + +   P+ ++P  P  P V   + NS +L W  P  DGGAPI  Y +E K+     W              T  N KP+       K L E  EY FR+ AVN  G   PS+ SD VL + +  +P      + +I ++ G T +  I + GG P P +    NG+  + +++R  +++   + V       +T T + RS D G Y I      G       V VLD P KP   +   +I+A+ + LSW  P D+GG  IT+YV++      GDW+       T   V+ L     Y+F V A N+ G  EP  T + I A+NP+  P  P +P  V+   +++TL+W +P+ DGG PI  Y+I+K++     W  A           I + + R+ GL+  K Y+FR+ A N AG+   S  + P    +    P I+ G  +   +      A   +     P P+ T+ K   +I+ TD  +  + EY     A L + KS++ D G Y +  EN  G D   + L V+D
Sbjct: 4607 FRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFE-KRGGGDWAPVKMPMVKGTECI-VPGLHENETYQFRVRAVNAAGHGEPS--NGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDW--------------TRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDL-FNGNSPIFENERTVVDVNPGEIV-------ITTTGSKRS-DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKR-TPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKA-------AFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRV--KVEYS-DFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVD 5227          

HSP 10 Score: 230.72 bits (587), Expect = 1.621e-59
Identity = 192/714 (26.89%), Postives = 315/714 (44.12%), Query Frame = 0
Query:  431 VFNVQVKDPSAPVDFFLNGKIIV-----------PGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAP-----KLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDI--DNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
             +N  ++D  AP+D ++  K  +           P  DT  EVK +G+ K +     I +   G+ E   P++             +++ E+ P      + +   ++  A +     + YA  G  +  I+L  F     +   +   ++ +   + +     KR  +G YKI   N  G D   +NV ++D P  P   I  T I  ++  +   PP D+GG  I +Y++E     +    W  V    G    +++V NL     Y FR RA N+ G+ +P E +   I+ K+P+D P  PG+P  ++ S  +  L W  P SDGGAPI  Y IE +E     W +    N  D + +              GL     Y FR+ A N  G    S  S  + A     +P ++  G+   +I    G   +  + F   PAP VT+ +  + +     R+ +E       Y +    LT+ K+  + D G Y ++L    G+  A+  + V+D P  P+ +  ++I  +   L W  P  DGG+PIT+Y+++ +D+   +G W       ++   TV GL   + Y+F V A  + G SEPC   + + A+  ++ P++P+ P + D D+    L W  P  DGG  I  Y +Q +D   G W +A       C AR+        GL +   ++FRIIA N AG S PS
Sbjct: 4756 TWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE-KEEYEFRVIAVNSAGEGEPSKPSD-------------LVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYA-GGNPKPIIDL--FNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEK---RTPGGDWVTVGHPVGT---TLRVRNLDANTPYEFRVRAENQYGVGEPLE-TDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHR------------VTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINM-GMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVE-------YSDFLATLTIEKSELT-DGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPR-DGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVT-------GLRQNGEFEFRIIAKNAAGFSKPS 5416          

HSP 11 Score: 154.066 bits (388), Expect = 4.856e-36
Identity = 154/578 (26.64%), Postives = 248/578 (42.91%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIE-YKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI----EIKKGR---TFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLC-----DGGTQQATGYVNVLDVPEKP----RXLNPDEIRAE---HINLSWATPHD-------DGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            L + + +R  SG  KI   N  G  E  I + ++DKP  P+ I    +S+++C +    P DDGG EI  Y IE  +V S    W +V         +  V  L +  +YRFR RA N +GLSD     G  ++IKDP+D P  P  P +  + +N   LAW  P  DGG+PI  Y +E ++++  G W   ++               PMV GT     GL E   Y FR++AVN  G   PS  S+ V       +P++ +PG  +     +I K     T+   +  GG P      E+     LGD+D      +++      ++T   V       +   Y  +++      +G   + +  V + + P +P      L    +RA     I + +A  +        +G +PI      ++D++ G+ +          T  G K      +++ A NK G+ + C+ L     + P KP    +     D    ++TL W+ P D+GG  IT+Y+++K+   G W             R+  L+A  P       Y+FR+ A N+ G   P
Sbjct: 4500 LVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQI--WDKVPGLISG--TAYTVRGLEHGQQYRFRIRAENAVGLSD--YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKM---------------PMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTC-----RPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKK---LGDND------WTRCNDKPVRDTAFEVKNLG---EKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV---------ITTTGSKRSDAGPYKISATNKYGK-DTCK-LNVFVLDAPGKPTGPIR---ATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTV--GHPVGTTLRVRNLDANTP-------YEFRVRAENQYGVGEP 5016          

HSP 12 Score: 145.976 bits (367), Expect = 1.485e-33
Identity = 164/665 (24.66%), Postives = 270/665 (40.60%), Query Frame = 0
Query:  586 YKIIIRNAQGFD------ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGG-----APITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKK-DKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS------FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++II +NA GF       ER    +    P PP  +    I +N C +    P +DGG++I  Y +E  +  S+   W+  +  + + P+   V+ L   + Y FR  A N          +G+ I        P  P  P  +  S  S       PE         A  T   +   E +    + G  L  S        +G  +   T K + + +   + ++  N  G       SD+  A      P + +  + N  +  G   R  I+F G      T     SL+L + + I ++  + + V  + + ++T+  A    + G Y   +  D G      ++NV  +PE P+  L+   I      LSW  P  DGG+ ITSYV++  D+   +W+      KD    V GL   H Y+F V A N+ G   P  +  PI A  P+ PP+ P    IV      VTL WQ+P  DGG  +  YI++K+ ++   WF   +                +P L +G+ Y++R+ AVN AG S  +      F+        K ++P  D         +V R   ++ ++ G P PE+ W+K   ++  T +  +  +    G    L ++     DA  Y+  A N +G   T  +L +
Sbjct: 5402 FRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGST--LWTVASDYNVREPE-FTVDKLREFNDYEFRVVAIN---------AAGKGI--------PSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG--VYKFTIKEVWDIDAGEYTVEVSNPYG-------SDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSG------TAPFRHSLVL-NREEIDMDHPTIRIVEFDDHILITIP-ALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPN-------NYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNE------EVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINK----GDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRI 6012          

HSP 13 Score: 133.65 bits (335), Expect = 7.092e-30
Identity = 82/245 (33.47%), Postives = 130/245 (53.06%), Query Frame = 0
Query:  584 GSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIII-KDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            G Y + + N+QG D   I + ++DKP  P+ I V  I+ + C +   PP  DGG+ I +YI+E +D+  S  +W +V+        +  V  LI  +RYRFR RA  + G+S+P E++  D+++ K  ++ P++P  P+V D  S   +L W  P  DGG+ I  Y+++Y++ S G W          I  K D++ +   H    GL +  E+ FRI A N  G S PS  S+    K+R+  P
Sbjct: 5204 GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRN--LNYTVGGLIKDNRYRFRVRAETQYGVSEPCELA--DVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWD-PPRDGGSKIIGYQVQYRDTSSGRW----------INAKMDLSEQ--CHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPP 5431          

HSP 14 Score: 132.109 bits (331), Expect = 2.624e-29
Identity = 143/558 (25.63%), Postives = 234/558 (41.94%), Query Frame = 0
Query:  582 KSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVL-AKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP-------DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGH--IYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            ++G Y+  + N  G       +N+   P+ P+  + +++I  ++  +   PP  DGG++I  Y++E  D+S   ++W  V  ++ K    I V  L   H Y FR  A N  G+  P  +S   II + P+D P  P    ++    +   L+W  P SDGG  +  Y +E +E+    W             + + N  P  +     L++G +Y +R+ AVN  G S  +E   ++  A      P +  P + ++  + GR   ++    G P P   W +    L+  S    I    K+ +     T         S D   YT +     GT+        L +  KPR   P       +  + E I L    P+         +      I+N     ++ T D  AT++          ++ V+  N  G      T+    A+ P +PP  P   NI+D   ++V L W+ P+ DGG  +T+Y I+K++  GG +       + C A+       I GL  GK Y+FRIIA NK G+S P   T P L
Sbjct: 5693 EAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSK--DEWVTVT-SNVKDMNYI-VTGLFENHEYEFRVSAQNENGIGAPL-VSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEW------------FRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSP-LSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT---------SDDADEYTCRATNSSGTRSTRAN---LRIKTKPRVFIPPKYHGGYEAQKGETIELK--IPYKAYPQGEARWTKDGEKIENNSKF-SITTDDKFATLRISNASREDYGEYRVVVENSVGSD--SGTVNVTVADVP-EPPRFPIIENILD---EAVILSWKPPALDGGSLVTNYTIEKREAMGGSW-------SPC-AKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVL 6203          

HSP 15 Score: 119.783 bits (299), Expect = 1.457e-25
Identity = 124/483 (25.67%), Postives = 206/483 (42.65%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEI---------SGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLR 1048
            +++  +N  G    L++ + +      D P  P  +E+  +  +   +    P  DGG  ++ YI+E  +     ++W +  Q +   P +  V NLI+  +YR+R  A N  GLSD  E+         SG+   I  P  D  ++ GR    +     C+++        G+P   Y           W +G  E+++TS   +    + + ++      L   +   +  +A N  G      T  ++  KT   KP +  P  Y+   E +KG T    I +   P     W ++G  +  +S       FS  T   +K   L ++ A+R  D G Y + +    G+   T  V V DVPE PR    + I  E + LSW  P  DGG+ +T+Y I+  +   G W    +++ T  T++GL+ G  Y+F +IA NK G+S+PC    P+       P  E K     D D Q   +R
Sbjct: 5792 FRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQE--EEHDEWFRCNQ-NPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFE-----CEIS--------GSPRPEYR----------WFKGCKELVDTSKYTLINKGDKQVLI---INDLTSDDADEYTCRATNSSGTR---STRANLRIKT---KPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSK------FSITT--DDKFATLRISNASRE-DYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPV-----LIPGDERKRRRGYDVDEQGKIVR 6225          

HSP 16 Score: 105.145 bits (261), Expect = 3.512e-21
Identity = 137/517 (26.50%), Postives = 208/517 (40.23%), Query Frame = 0
Query:  632 PDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-LAKTRYLKPFL-------HQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVP----EKPRXLNP--DEIRAEHINLSWATPHDDGGTPITSYVIKMMDID-NGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEP-NIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDD-ASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            P  DGG++I  Y ++  D  +SS +W   A+ D       +V  L     + FR  A N  G S P   S +   +K  +  P  P          N C + W  P  DGG+ IT Y +E +E    LW      N  + E   D             L E N+Y FR+ A+N  G  +PS  S  + + ++   +P +        QP  YN      R   +     G P P+  W RNG  L  +S R   E  +   VY  K T+  V      ID G YT+++    G+  AT  + V   P    + P  + P  D +R + I  S   P         S V+   +ID +   +  +E  D    T+  L      ++E    N  GE+     L      N    P  P+ P +I +    + TL W+ P  DGG  IT Y+++K+D        L  D+  +  + + ++   + GL E   Y+FR+ A N+ G  +P     P + R
Sbjct: 5353 PPRDGGSKIIGYQVQYRD--TSSGRWIN-AKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS-ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVD------------KLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP--YN------RRAVFTCEAVGRPEPTARWLRNGRELP-ESSRYRFE--ASDGVY--KFTIKEVW----DIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLK-IYFSGTAPFRH------SLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWL------NVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRD--------LSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIAR 5815          

HSP 17 Score: 104.375 bits (259), Expect = 6.950e-21
Identity = 110/484 (22.73%), Postives = 195/484 (40.29%), Query Frame = 0
Query:   46 EDVEWEWENESIPLRPEG---KVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRK-------------------------KVQRKVEV----KVHDWIETPVDQEVQENKVDKVV-LTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPL-HPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIV----EGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGV-ERESYVFNVQVKDPSAPVDFFLNGKII-VPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEART 489
            E V+   E  S PL P G     PK+V   +  +  E +   +  ++ G P P  +WFKG +++    R+K  T+G E+T+ L +   R ++EG Y + ++N +G    + K  VT + G+DFRAML  R+                         + +R+  +    KV  W + P+ ++  + +VDK+       S PN K +WY             D         +++ +  ++  TLI++NP ++++GK+T     E     T   + V+ P  ++ F   L   +     +     C +N   A + W R    +    PR+                           I+E     +D V  C L +    E D  E T    +D  S       + +    V  +++ V E +       V D  A V ++ +GK I + G   ++E       K +LI++   +ED+G+ +  T
Sbjct:  957 ESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKW-DIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWY------------KDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTC----EANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRF---------------------------IIE-----KDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNR---KRRLIINGARIEDHGEYKCTT 1388          

HSP 18 Score: 103.99 bits (258), Expect = 8.366e-21
Identity = 93/361 (25.76%), Postives = 154/361 (42.66%), Query Frame = 0
Query:  926 VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-------VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD---LMQECECDMFKTGDL-----ECNCSNGFRHGEVGGKHLLEID 1269
            V + PE P   + D   AE   L W  P D GG+ I  Y ++  D  +G W+ A    ++   A V GL+    ++F +IA N  G S+P    E  + ++ + PP  P             T+ W  P +DGG  IT Y ++ ++ +G     + +D       + E E  +  L E   Y+FR++A+N AG+  PS  + P   +          GS     +K        NR A++  +  G P P   W +NG ++  +      R E   G   K  + +   IDAG Y++   N  G D    +L+V     + ++    +  +GDL       + +  FRH  V  +  +++D
Sbjct: 5330 VPNQPEAPTVRDKDSTWAE---LEWDPPRD-GGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIRE-YGSTLWTVASD-----YNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESG-------GSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRY---RFEASDGV-YKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMD 5669          

HSP 19 Score: 69.707 bits (169), Expect = 2.334e-10
Identity = 74/300 (24.67%), Postives = 129/300 (43.00%), Query Frame = 0
Query:  413 KFVSEVSSQNEGVERESYVFNVQVK-DPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSG--VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            K VS +S  NE V R    F  ++   P     +F   K +V    ++  +   GD K  LI++ +T +D  +   R   + G ++       N+ +  K P++       G   A K     +    + Y Q +   +  KDG++++     +I        L + N  RE  G Y++++ N+ G D   +NV + D P+PP+   + +I   + ++   PP  DGG+ + +Y IE  +    S  WS  A++         +  L    +Y FR  A N+ G S P E +   +I  D
Sbjct: 5924 KIVSPLSDLNEEVGR-CVTFECEISGSPRPEYRWFKGCKELV--DTSKYTLINKGD-KQVLIINDLTSDDADEYTCRATNSSGTRSTRA----NLRIKTK-PRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWT--KDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGS--WSPCAKSRY---TYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGD 6207          

HSP 20 Score: 52.7582 bits (125), Expect = 2.882e-5
Identity = 78/327 (23.85%), Postives = 125/327 (38.23%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI-----KAENP--YKPPSEPKEP--NIVDFD-----NQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             D P  P  L   ++  +++ LSW  P  DGG  +  Y+++  + ++ +W    +  +      V  L  G  Y++ V AVN  G S+     + +       E P    P S+  E     V F+     +     RW K   +      + +I K DK     + L +DDA      DE   R               A N +G  S       +TKP +     + P    G  + K      T   +I  K  P  E  W K+G +I +  +  IT ++      A L +S +   D G Y +V EN  G D   +++ V D+
Sbjct: 5818 FDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA------DEYTCR---------------ATNSSGTRSTRANLRIKTKPRVF----IPPKYHGGYEAQK----GETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDD----KFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADV 6111          

HSP 21 Score: 48.9062 bits (115), Expect = 4.984e-4
Identity = 35/112 (31.25%), Postives = 50/112 (44.64%), Query Frame = 0
Query: 1131 HKNLTPSIDKGSSSSK----------TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEV--LITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
             K  TP +  G+S S           T+  N TAI   KV G P P F W+K   ++ S      +   +E+    T  L + K +  D G Y+L  EN +G D  D+ L+V
Sbjct:  964 EKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEH----TVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLV 1071          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:unc-22 "Protein UNC-22, isoform f" species:6239 "Caenorhabditis elegans" [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0004672 "protein kinase activity" evidence=IEA] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA] [GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA] [GO:0031672 "A band" evidence=IDA] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 GO:GO:0031672 EMBL:Z73899 GeneTree:ENSGT00720000108588 EMBL:Z73897 UniGene:Cel.23028 GeneID:178135 KEGG:cel:CELE_ZK617.1 CTD:178135 RefSeq:NP_001255601.1 ProteinModelPortal:H2FLH2 SMR:H2FLH2 EnsemblMetazoa:ZK617.1f.1 EnsemblMetazoa:ZK617.1f.2 WormBase:ZK617.1f SignaLink:H2FLH2 ArrayExpress:H2FLH2 Uniprot:H2FLH2)

HSP 1 Score: 399.438 bits (1025), Expect = 5.129e-113
Identity = 246/715 (34.41%), Postives = 374/715 (52.31%), Query Frame = 0
Query:  520 PVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P+SG    +C W V                  +GK +K    V ++    +  + + N  R  SG + I ++N+ G  +    V ++ +P PPK  +++  +  +   +  +PPDDDGG  +  YI+EA D+ +   ++ +V + D     ++KVN L NK  Y+FR +A N  G S+P   + Q   IKDPWDEP KPGRP + D+ ++  D+AW  P  DGGAPI  Y +E ++     W++              V   P  + +  GL EG EY FR++AVNK G   PSE S+  LAK +++  +L    + +I +K G T R+++  GGEP P V W +    L    + I + + ++K     ++T+L +  A RS D G Y + +    G  +    + VLD P KP   L   ++  +++NLSW  P DDGG PI  Y ++ +D   G W+   + KDTKA + GLK G  YQF V AVNKEG S+   T +  KA+NPY  P +   P++VD+D   V+L W+ P  DGG PIT Y+I+KK K G  W +  K          D+  A I GL EG+ YQFR+ AVNKAG    S  ++  + + +NL P ID+ +  + TIKV     + + V+GEPPP+  W  N   +    ++ I  E+Y+     +  +  +    AG Y+L A N +G DK  +++IVL
Sbjct: 1587 PISGEPLPECLWVV------------------NGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKG-KYIEVGKVD-PNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLS-ADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKE--------------VKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQL---ENGIQLTIDTRKN----EHTILCIPSAMRS-DVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSG-------DQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPV-DDQKIRIESEDYK----TRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVL 2246          

HSP 2 Score: 380.178 bits (975), Expect = 1.097e-106
Identity = 237/688 (34.45%), Postives = 360/688 (52.33%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            + D +E++ G  V ++    +  L V   +R  SG++ I   NA G DE  + +N++DKP  P   ++V+ +  +   +    PDDDGG  I++Y+IE  D  ++S +W   A+  G    ++ V+ LI  H Y+FR  A N  G SDP E  G   + KDP+D+P K   P + DW  +  DL W  P +DGGAPI  Y +E K++    W               DV   P    + T   L EG++Y FRI+A NK G   PS+++ S +AK R + P + +  I  I++K G+ F  +I   GEP P++TW   G+ +  D DR+ +     KT +        V +A RS DTG Y IK   + GT  A   V VLD P  PR  L+   I  +  +L+W  P DDGG  I+ YVI+  D   G W    E+KDT   V  L  GH Y+F V AVN+ G+S+P    E I A++P+    +P  P IVD+D     L+W  P+DDGG PI  Y+++ +   G W  A+            EL A + GL  G+ YQFR+ A+NKAGES+PS  ++  + + ++L P I++    ++ +K  +T  + + V+GEP P+  W+ NG  ++S     I   +       KL    +   D+G Y +VA N +G+D+ ++D+ +LD+
Sbjct: 2777 WPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYD--TASGRWVPAAKVAGDKTTAV-VDGLIPGHEYKFRVAAVNAEGESDPLETFGT-TLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN--------------DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSA-SAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESD-DRMKLNNEDGKTKF-------HVKRALRS-DTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAG-------ELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHI---DNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDI 3426          

HSP 3 Score: 375.17 bits (962), Expect = 5.213e-105
Identity = 259/815 (31.78%), Postives = 392/815 (48.10%), Query Frame = 0
Query:  424 GVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDG-KHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC-NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS-LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            G   E YV  V++KD  +P   F N    VP   T   V  + +G K++            +I A+     GD + S +    V      P + D   +  +  K   ++ ++  V G     I  +   +G  V+    + +N    +   +V    R  +G+Y I   N  G D   + V ++D P  P+  ++VT+I K+ C +    P+DDGG EI HY+IE  D  +++ +W+   ++      +  V++L   H Y+FR +A NR G SDP E + + II KDP+D  DKPG P ++DW  +  DL W  P  DGGAPI  Y +E +  S G W     +   ++              T  GL  G  Y FR+KA+NK G S PS+ S +++AK R+L P +++       +K G+T  +D+   GEPAP + W  NGS L  G +  I            + NT LT TK+    D+G Y I    + G  +    VN+LD+P  P   L   +I  E + L W  P DDGG+PIT+YV++  + D G W+   ET DT   V  L  GH Y+F V AVN++G S P  +   I A+NP+  P  P +   VD+D   V L W+ P++DGG PI  YI++KKDKFG W +  + D  + +A  D        L+ G+ YQFR+ AVNKAG   PS  T   + + + + P ++        IK        I  +GEP P   W  N   I +     +T        ++ + +  +   D G Y ++ EN +G+D    ++ VLD+
Sbjct: 2966 GAPIEEYV--VEMKDEFSP---FWNDVAHVPAGQTNATVGNLKEGSKYEF-----------RIRAKNKAGLGDPSDSASA---VAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF--EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQD--AATGRWTACGESKDT---NFHVDDLTQGHEYKFRVKAVNRHGDSDPLE-AREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPS-GDWVPAVTVGAGELT------------ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNN--------TDNNTKLT-TKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQE-DGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATAD-------NLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP----TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDV 3719          

HSP 4 Score: 358.221 bits (918), Expect = 1.453e-99
Identity = 267/863 (30.94%), Postives = 414/863 (47.97%), Query Frame = 0
Query:  383 KLIVEG----DAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLG-DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEV--KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKT-IEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN-GDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLI-TREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +LI+ G    D GE  C T  D + + L V   NKF+  +    E +E++      Q KD   P  +F NGK I      + E  Q  +G H L +  I M +    E       G    SC  +  V+  EK P L      +   A + C   V + ++G ++ D +  + K+GK +  ++ + V +    D  ++   NP+   +G + + + N+ G       + + DKP PPK  +E  +++     +    PD D G  +K YIIE  +    S  W++V +  G      KV +L     Y+FR +A N  GLSDP  ++G+ ++ K+P+  P KP     +D   + C LAW  PE DGGAPIT Y IE +EKS   W Q         E+            T K +VE  EY++R+KAVNK G   P +    +  K +   P     GI ++ +K G T +YD+   GEP P   W  NG  L        +++ S++  +     ++ +  A R+ D+G +TI L    G+  +T  V V+  P  P+  L+  ++ A+   LSW  P DDGG P+T Y+++  D+DN G ++    ++   T   V GL+    Y+F V AVN EGESEP    +  + ++P+  P +P  P I DFD   + + W+ P  DGG PI  YI++ +D     +  +K        R+ +  A I GL EGK YQFR+ AVNKAG   PS  ++  L + K +   +   +  S T+K   T  W++K+ GEP PE  W+K   Q+ +  ++ I TR+         LC+  +   D G Y L  +N +G D+   +L VLD
Sbjct: 1139 RLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALK-DTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFET-QSRNGTHTLKIGKIEMNEADVYEIDQAGLRG----SC--NVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQE--GRSGNWAKVGETKGT---DFKVKDLKEHGEYKFRVKALNECGLSDP--LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCEL------------TDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG---RVKMSSERGKH-----IMKIENAVRA-DSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVK--------RVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEH----TILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLD 1953          

HSP 5 Score: 348.977 bits (894), Expect = 1.306e-96
Identity = 223/656 (33.99%), Postives = 339/656 (51.68%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW-YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            R+ +G Y +   NA G D+  + V ++ KP  P   +EV+++ ++   ++   P+DDGG  I HY IE +D+++   +W    +++        V NL   H Y+FR RA N+ G SDP   +   I+ K+P++ P K  +P ++DW  +  DLAW  P+ DGGAPI  + IE K+K+ G W++  ++       KT          T   L EG EY FRI A NK G   PS+ SD V+AK R L P +H+  + +  +K G T ++ +   GEPAP VTW  NG  +     +I  E +  +           + KA R   +G YTI      GT   T  + V   P KP+  +   ++  +   L W  P DDGG PI  Y I+ M+  +G W+    + DT  TV  L  G  Y+F V AVN EG S+P  T   I A+NP+  P  P  P   D+D+  V L+W  P  DGG PI  Y I+K+ K+G W  A+            +  A +P L+  + Y+FR++AVNK G S PS  +K  + + +NL P ID+ +  + TIK  ++  + + V GEP P  TW + +  +I +   V +   EYQ    +KL V + +  D+GT+++ A N NG+D+  + + V+D
Sbjct: 2220 RKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATG--RWVPCGRSETT---KTTVPNLQPGHEYKFRVRAVNKEGESDPL-TTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPD-DGGAPIEAFVIEKKDKN-GRWEEALVVPGDQ---KT---------ATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISR---------FALPKALRK-QSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGG-------QTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQ----SKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID 2834          

HSP 6 Score: 340.502 bits (872), Expect = 6.923e-94
Identity = 240/701 (34.24%), Postives = 345/701 (49.22%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDR-VDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVY-CEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VEG     IE   F +G  +  G + +I+ + D    L   +  R  SG YKI+  N  G DE  ++VNI+D P  P+  +    I+K S V+K   P DDGG+ I +Y++E         +W    +       S+KVN L   H Y+FR +A NR G S P   S   I+ K+P+DEPD P   + +DW  +  DL W  P +DGGAPI  Y +E K+K  G W +              V+GK     T   L  G  Y FR+KAVNK G   PS+ + +V+AK R + P L+  G+ ++ IK G   + DI F GEPAP   W+ N +         +I+  ++  V     ++ + +  A R  DTG Y I +  + G   A   V VLDVP  P   L  DEI  E   L+W  P D+GGT +  Y+++ MD   G W       D  A V  L PG  Y F V AVN +GES+P    EPI A+N +  P    +P + D+D   + ++W   +++GG P+T YI++KK+K    W +A KT   +  A  D L+   PG+     Y+FR+IAVN AG S PS  T P + + + L P I   S   K IK   T   ++   G P P  TW       A   E+L+  +     +T  +    ++  D+G Y L  +N  G+D+   ++IV D
Sbjct: 3356 VEGEPAPKIEW--FLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEK---QEDGGRWVPCGETSDT---SLKVNKLSEGHEYKFRVKAVNRQGTSAPL-TSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDK-FGDWVEC-----------ARVDGK-TTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDA---------TIDTGARADVTNTPTSSAIHIFSAVRG-DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSA--DNLK---PGVE----YEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK-IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAK----SSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQD 4010          

HSP 7 Score: 298.13 bits (762), Expect = 9.759e-81
Identity = 203/665 (30.53%), Postives = 315/665 (47.37%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK-TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++ +  R  +G YKII+ N  G D    NV ++D P  P+  +++  I K  C +   PP D+GGT++ HYI+E +D S  +  W +V    G  P  + KVN L+    Y FR +A N  G S P E   + II K+ +D PD   +P V DW  +  D+ W    ++GGAP+T Y +E KEK   +W              T+    P    +   L  G EY FR+ AVN  G S PS+ +D  + K RYLKP +       I+IK G T   ++ F G P P+ TW       +GDS      L  +  V  + +T      + +  D+G+Y +K+  + G  +A   V V D P  P   L   ++  +   L+W  P DDGG  I++YV++  D     W+        T  TV  L  GH Y+F V+A N  G S+   T EP+ A++P+  P +P  P IVD DN  + ++W  P D+GG P+ HY I++KD   G +  + T      A  D        + +G  Y++R++AVNKAG   PS  +     +  +  P  D      +  +K     +  I     P P+ +W K G +  +  E   ++         KL +  ++  D+G   + A N  G+ + ++ + V+D
Sbjct: 3684 IHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGT--WQEV----GTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAE-EPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIW--------------TEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILT-ASRKIKIKAGFTHNLEVDFIGAPDPTATW------TVGDS---GAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTR------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQ--------TKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVID 4303          

HSP 8 Score: 274.633 bits (701), Expect = 1.953e-73
Identity = 180/557 (32.32%), Postives = 273/557 (49.01%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP-FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCE-ARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG+YK+ ++N  G DE +  V + D+P  P+  +EV+ ++K+SCV+   PP DDGG EI +Y++E  D  + +N W  V A   G    SI V  L   H Y FR  A N  G SD    + + ++ KDP+  P KPGRP ++D  ++  D+ W  P  +GG+P+ HY+IE K+   G W +   +NTS ++     + +         + +G+ Y +R+ AVNK G   PS++S +  AK  +  P F          +K G      I F   P P ++W + G   L   +              +  T L +    RS D+G   IK +   G  +A   + V+D P  P  +    +      L+W  P DDGG  I  Y I+  ++ +  W         T  TV+GL+ G  Y+F + A N  G S+ C+ + P+  ++P+ PP  P  P I  +D   V+L W  P DDGG PI  Y++++ +K GG       D A  +   +   E  +PGL E + YQFR+ AVN AG   PS  ++P  CR
Sbjct: 3982 KRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRD--TKTNTWVPVSAFVTGT---SITVPKLTEGHEYEFRVMAENTFGRSDSLN-TDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIK---VNTSPVQGTAFSDTR---------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVE------------TTDSQTKLVIPSTRRS-DSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGV-PVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGG------GDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCR 4500          

HSP 9 Score: 248.44 bits (633), Expect = 4.761e-65
Identity = 198/659 (30.05%), Postives = 301/659 (45.68%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT--CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI-WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I   NA G  +    V ++     D P  P T E+T    N   +  +PP DDGG+ I  Y++E  +       W+ V     KG + I V  L     Y+FR RA N  G  +P   +G + +   P+ ++P  P  P V   + NS +L W  P  DGGAPI  Y +E K+     W              T  N KP+       K L E  EY FR+ AVN  G   PS+ SD VL + +  +P      + +I ++ G T +  I + GG P P +    NG+  + +++R  +++   + V       +T T + RS D G Y I      G       V VLD P KP   +   +I+A+ + LSW  P D+GG  IT+YV++      GDW+       T   V+ L     Y+F V A N+ G  EP  T + I A+NP+  P  P +P  V+   +++TL+W +P+ DGG PI  Y+I+K++     W  A           I + + R+ GL+  K Y+FR+ A N AG+   S  + P    +    P I+ G  +   +      A   +     P P+ T+ K   +I+ TD  +  + EY     A L + KS++ D G Y +  EN  G D   + L V+D
Sbjct: 4376 FRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFE-KRGGGDWAPVKMPMVKGTECI-VPGLHENETYQFRVRAVNAAGHGEPS--NGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDW--------------TRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDL-FNGNSPIFENERTVVDVNPGEIV-------ITTTGSKRS-DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKR-TPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKA-------AFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRV--KVEYS-DFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVD 4996          

HSP 10 Score: 230.72 bits (587), Expect = 1.358e-59
Identity = 192/714 (26.89%), Postives = 315/714 (44.12%), Query Frame = 0
Query:  431 VFNVQVKDPSAPVDFFLNGKIIV-----------PGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAP-----KLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDI--DNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
             +N  ++D  AP+D ++  K  +           P  DT  EVK +G+ K +     I +   G+ E   P++             +++ E+ P      + +   ++  A +     + YA  G  +  I+L  F     +   +   ++ +   + +     KR  +G YKI   N  G D   +NV ++D P  P   I  T I  ++  +   PP D+GG  I +Y++E     +    W  V    G    +++V NL     Y FR RA N+ G+ +P E +   I+ K+P+D P  PG+P  ++ S  +  L W  P SDGGAPI  Y IE +E     W +    N  D + +              GL     Y FR+ A N  G    S  S  + A     +P ++  G+   +I    G   +  + F   PAP VT+ +  + +     R+ +E       Y +    LT+ K+  + D G Y ++L    G+  A+  + V+D P  P+ +  ++I  +   L W  P  DGG+PIT+Y+++ +D+   +G W       ++   TV GL   + Y+F V A  + G SEPC   + + A+  ++ P++P+ P + D D+    L W  P  DGG  I  Y +Q +D   G W +A       C AR+        GL +   ++FRIIA N AG S PS
Sbjct: 4525 TWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE-KEEYEFRVIAVNSAGEGEPSKPSD-------------LVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYA-GGNPKPIIDL--FNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEK---RTPGGDWVTVGHPVGT---TLRVRNLDANTPYEFRVRAENQYGVGEPLE-TDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHR------------VTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINM-GMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVE-------YSDFLATLTIEKSELT-DGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPR-DGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVT-------GLRQNGEFEFRIIAKNAAGFSKPS 5185          

HSP 11 Score: 154.066 bits (388), Expect = 4.298e-36
Identity = 154/578 (26.64%), Postives = 248/578 (42.91%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIE-YKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI----EIKKGR---TFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLC-----DGGTQQATGYVNVLDVPEKP----RXLNPDEIRAE---HINLSWATPHD-------DGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            L + + +R  SG  KI   N  G  E  I + ++DKP  P+ I    +S+++C +    P DDGG EI  Y IE  +V S    W +V         +  V  L +  +YRFR RA N +GLSD     G  ++IKDP+D P  P  P +  + +N   LAW  P  DGG+PI  Y +E ++++  G W   ++               PMV GT     GL E   Y FR++AVN  G   PS  S+ V       +P++ +PG  +     +I K     T+   +  GG P      E+     LGD+D      +++      ++T   V       +   Y  +++      +G   + +  V + + P +P      L    +RA     I + +A  +        +G +PI      ++D++ G+ +          T  G K      +++ A NK G+ + C+ L     + P KP    +     D    ++TL W+ P D+GG  IT+Y+++K+   G W             R+  L+A  P       Y+FR+ A N+ G   P
Sbjct: 4269 LVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQI--WDKVPGLISG--TAYTVRGLEHGQQYRFRIRAENAVGLSD--YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKM---------------PMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTC-----RPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKK---LGDND------WTRCNDKPVRDTAFEVKNLG---EKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV---------ITTTGSKRSDAGPYKISATNKYGK-DTCK-LNVFVLDAPGKPTGPIR---ATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTV--GHPVGTTLRVRNLDANTP-------YEFRVRAENQYGVGEP 4785          

HSP 12 Score: 146.362 bits (368), Expect = 1.188e-33
Identity = 164/665 (24.66%), Postives = 270/665 (40.60%), Query Frame = 0
Query:  586 YKIIIRNAQGFD------ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGG-----APITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKK-DKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS------FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++II +NA GF       ER    +    P PP  +    I +N C +    P +DGG++I  Y +E  +  S+   W+  +  + + P+   V+ L   + Y FR  A N          +G+ I        P  P  P  +  S  S       PE         A  T   +   E +    + G  L  S        +G  +   T K + + +   + ++  N  G       SD+  A      P + +  + N  +  G   R  I+F G      T     SL+L + + I ++  + + V  + + ++T+  A    + G Y   +  D G      ++NV  +PE P+  L+   I      LSW  P  DGG+ ITSYV++  D+   +W+      KD    V GL   H Y+F V A N+ G   P  +  PI A  P+ PP+ P    IV      VTL WQ+P  DGG  +  YI++K+ ++   WF   +                +P L +G+ Y++R+ AVN AG S  +      F+        K ++P  D         +V R   ++ ++ G P PE+ W+K   ++  T +  +  +    G    L ++     DA  Y+  A N +G   T  +L +
Sbjct: 5171 FRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGST--LWTVASDYNVREPE-FTVDKLREFNDYEFRVVAIN---------AAGKGI--------PSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG--VYKFTIKEVWDIDAGEYTVEVSNPYG-------SDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSG------TAPFRHSLVL-NREEIDMDHPTIRIVEFDDHILITIP-ALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPN-------NYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNE------EVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINK----GDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRI 5781          

HSP 13 Score: 134.035 bits (336), Expect = 6.125e-30
Identity = 82/245 (33.47%), Postives = 130/245 (53.06%), Query Frame = 0
Query:  584 GSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIII-KDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            G Y + + N+QG D   I + ++DKP  P+ I V  I+ + C +   PP  DGG+ I +YI+E +D+  S  +W +V+        +  V  LI  +RYRFR RA  + G+S+P E++  D+++ K  ++ P++P  P+V D  S   +L W  P  DGG+ I  Y+++Y++ S G W          I  K D++ +   H    GL +  E+ FRI A N  G S PS  S+    K+R+  P
Sbjct: 4973 GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRN--LNYTVGGLIKDNRYRFRVRAETQYGVSEPCELA--DVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWD-PPRDGGSKIIGYQVQYRDTSSGRW----------INAKMDLSEQ--CHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPP 5200          

HSP 14 Score: 132.109 bits (331), Expect = 2.344e-29
Identity = 143/558 (25.63%), Postives = 234/558 (41.94%), Query Frame = 0
Query:  582 KSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVL-AKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEI-------RAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGH--IYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            ++G Y+  + N  G       +N+   P+ P+  + +++I  ++  +   PP  DGG++I  Y++E  D+S   ++W  V  ++ K    I V  L   H Y FR  A N  G+  P  +S   II + P+D P  P    ++    +   L+W  P SDGG  +  Y +E +E+    W             + + N  P  +     L++G +Y +R+ AVN  G S  +E   ++  A      P +  P + ++  + GR   ++    G P P   W +    L+  S    I    K+ +     T         S D   YT +     GT+        L +  KPR   P +        + E I L    P+         +      I+N     ++ T D  AT++          ++ V+  N  G      T+    A+ P +PP  P   NI+D   ++V L W+ P+ DGG  +T+Y I+K++  GG +       + C A+       I GL  GK Y+FRIIA NK G+S P   T P L
Sbjct: 5462 EAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSK--DEWVTVT-SNVKDMNYI-VTGLFENHEYEFRVSAQNENGIGAPL-VSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEW------------FRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSP-LSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT---------SDDADEYTCRATNSSGTRSTRAN---LRIKTKPRVFIPPKYHGGYEAQKGETIELK--IPYKAYPQGEARWTKDGEKIENNSKF-SITTDDKFATLRISNASREDYGEYRVVVENSVGSD--SGTVNVTVADVP-EPPRFPIIENILD---EAVILSWKPPALDGGSLVTNYTIEKREAMGGSW-------SPC-AKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVL 5972          

HSP 15 Score: 119.783 bits (299), Expect = 1.314e-25
Identity = 124/483 (25.67%), Postives = 206/483 (42.65%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEI---------SGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLR 1048
            +++  +N  G    L++ + +      D P  P  +E+  +  +   +    P  DGG  ++ YI+E  +     ++W +  Q +   P +  V NLI+  +YR+R  A N  GLSD  E+         SG+   I  P  D  ++ GR    +     C+++        G+P   Y           W +G  E+++TS   +    + + ++      L   +   +  +A N  G      T  ++  KT   KP +  P  Y+   E +KG T    I +   P     W ++G  +  +S       FS  T   +K   L ++ A+R  D G Y + +    G+   T  V V DVPE PR    + I  E + LSW  P  DGG+ +T+Y I+  +   G W    +++ T  T++GL+ G  Y+F +IA NK G+S+PC    P+       P  E K     D D Q   +R
Sbjct: 5561 FRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQE--EEHDEWFRCNQ-NPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFE-----CEIS--------GSPRPEYR----------WFKGCKELVDTSKYTLINKGDKQVLI---INDLTSDDADEYTCRATNSSGTR---STRANLRIKT---KPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSK------FSITT--DDKFATLRISNASRE-DYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPV-----LIPGDERKRRRGYDVDEQGKIVR 5994          

HSP 16 Score: 105.531 bits (262), Expect = 2.936e-21
Identity = 137/517 (26.50%), Postives = 208/517 (40.23%), Query Frame = 0
Query:  632 PDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-LAKTRYLKPFL-------HQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVP----EKPRXLNP--DEIRAEHINLSWATPHDDGGTPITSYVIKMMDID-NGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEP-NIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDD-ASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            P  DGG++I  Y ++  D  +SS +W   A+ D       +V  L     + FR  A N  G S P   S +   +K  +  P  P          N C + W  P  DGG+ IT Y +E +E    LW      N  + E   D             L E N+Y FR+ A+N  G  +PS  S  + + ++   +P +        QP  YN      R   +     G P P+  W RNG  L  +S R   E  +   VY  K T+  V      ID G YT+++    G+  AT  + V   P    + P  + P  D +R + I  S   P         S V+   +ID +   +  +E  D    T+  L      ++E    N  GE+     L      N    P  P+ P +I +    + TL W+ P  DGG  IT Y+++K+D        L  D+  +  + + ++   + GL E   Y+FR+ A N+ G  +P     P + R
Sbjct: 5122 PPRDGGSKIIGYQVQYRD--TSSGRWIN-AKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS-ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVD------------KLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP--YN------RRAVFTCEAVGRPEPTARWLRNGRELP-ESSRYRFE--ASDGVY--KFTIKEVW----DIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLK-IYFSGTAPFRH------SLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWL------NVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRD--------LSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIAR 5584          

HSP 17 Score: 104.375 bits (259), Expect = 6.111e-21
Identity = 110/484 (22.73%), Postives = 195/484 (40.29%), Query Frame = 0
Query:   46 EDVEWEWENESIPLRPEG---KVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRK-------------------------KVQRKVEV----KVHDWIETPVDQEVQENKVDKVV-LTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPL-HPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIV----EGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGV-ERESYVFNVQVKDPSAPVDFFLNGKII-VPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEART 489
            E V+   E  S PL P G     PK+V   +  +  E +   +  ++ G P P  +WFKG +++    R+K  T+G E+T+ L +   R ++EG Y + ++N +G    + K  VT + G+DFRAML  R+                         + +R+  +    KV  W + P+ ++  + +VDK+       S PN K +WY             D         +++ +  ++  TLI++NP ++++GK+T     E     T   + V+ P  ++ F   L   +     +     C +N   A + W R    +    PR+                           I+E     +D V  C L +    E D  E T    +D  S       + +    V  +++ V E +       V D  A V ++ +GK I + G   ++E       K +LI++   +ED+G+ +  T
Sbjct:  726 ESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKW-DIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWY------------KDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTC----EANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRF---------------------------IIE-----KDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNR---KRRLIINGARIEDHGEYKCTT 1157          

HSP 18 Score: 104.375 bits (259), Expect = 7.172e-21
Identity = 91/362 (25.14%), Postives = 155/362 (42.82%), Query Frame = 0
Query:  926 VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-------VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGG-ATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD---LMQECECDMFKTGDL-----ECNCSNGFRHGEVGGKHLLEID 1269
            V + PE P   + D   AE   L W  P D GG+ I  Y ++  D  +G W+ A    ++   A V GL+    ++F +IA N  G S+P    E  + ++ + PP  P             T+ W  P +DGG  IT Y ++ ++ +G     + +D       + E E  +  L E   Y+FR++A+N AG+  PS  + P   +          GS     +K        NR A++  +  G P P   W +NG ++  +     +R  ++      K  + +   IDAG Y++   N  G D    +L+V     + ++    +  +GDL       + +  FRH  V  +  +++D
Sbjct: 5099 VPNQPEAPTVRDKDSTWAE---LEWDPPRD-GGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIRE-YGSTLWTVASD-----YNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESG-------GSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPES-----SRYRFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMD 5438          

HSP 19 Score: 69.707 bits (169), Expect = 2.037e-10
Identity = 74/300 (24.67%), Postives = 129/300 (43.00%), Query Frame = 0
Query:  413 KFVSEVSSQNEGVERESYVFNVQVK-DPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSG--VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            K VS +S  NE V R    F  ++   P     +F   K +V    ++  +   GD K  LI++ +T +D  +   R   + G ++       N+ +  K P++       G   A K     +    + Y Q +   +  KDG++++     +I        L + N  RE  G Y++++ N+ G D   +NV + D P+PP+   + +I   + ++   PP  DGG+ + +Y IE  +    S  WS  A++         +  L    +Y FR  A N+ G S P E +   +I  D
Sbjct: 5693 KIVSPLSDLNEEVGR-CVTFECEISGSPRPEYRWFKGCKELV--DTSKYTLINKGD-KQVLIINDLTSDDADEYTCRATNSSGTRSTRA----NLRIKTK-PRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWT--KDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGS--WSPCAKSRY---TYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGD 5976          

HSP 20 Score: 52.7582 bits (125), Expect = 2.715e-5
Identity = 78/327 (23.85%), Postives = 125/327 (38.23%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI-----KAENP--YKPPSEPKEP--NIVDFD-----NQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             D P  P  L   ++  +++ LSW  P  DGG  +  Y+++  + ++ +W    +  +      V  L  G  Y++ V AVN  G S+     + +       E P    P S+  E     V F+     +     RW K   +      + +I K DK     + L +DDA      DE   R               A N +G  S       +TKP +     + P    G  + K      T   +I  K  P  E  W K+G +I +  +  IT ++      A L +S +   D G Y +V EN  G D   +++ V D+
Sbjct: 5587 FDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA------DEYTCR---------------ATNSSGTRSTRANLRIKTKPRVF----IPPKYHGGYEAQK----GETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDD----KFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADV 5880          

HSP 21 Score: 48.9062 bits (115), Expect = 4.774e-4
Identity = 35/111 (31.53%), Postives = 50/111 (45.05%), Query Frame = 0
Query: 1132 KNLTPSIDKGSSSSK----------TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEV--LITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            K  TP +  G+S S           T+  N TAI   KV G P P F W+K   ++ S      +   +E+    T  L + K +  D G Y+L  EN +G D  D+ L+V
Sbjct:  734 KTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEH----TVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLV 840          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:unc-22 "Protein UNC-22, isoform g" species:6239 "Caenorhabditis elegans" [GO:0000166 "nucleotide binding" evidence=IEA] [GO:0004672 "protein kinase activity" evidence=IEA] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016740 "transferase activity" evidence=IEA] [GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA] [GO:0031672 "A band" evidence=IDA] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 InterPro:IPR013098 Pfam:PF07679 GO:GO:0031672 EMBL:Z73899 GeneTree:ENSGT00720000108588 EMBL:Z73897 UniGene:Cel.23028 GeneID:178135 KEGG:cel:CELE_ZK617.1 CTD:178135 RefSeq:NP_001255602.1 ProteinModelPortal:H2FLH3 SMR:H2FLH3 EnsemblMetazoa:ZK617.1g.1 EnsemblMetazoa:ZK617.1g.2 WormBase:ZK617.1g SignaLink:H2FLH3 ArrayExpress:H2FLH3 Uniprot:H2FLH3)

HSP 1 Score: 399.053 bits (1024), Expect = 7.081e-113
Identity = 246/715 (34.41%), Postives = 374/715 (52.31%), Query Frame = 0
Query:  520 PVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P+SG    +C W V                  +GK +K    V ++    +  + + N  R  SG + I ++N+ G  +    V ++ +P PPK  +++  +  +   +  +PPDDDGG  +  YI+EA D+ +   ++ +V + D     ++KVN L NK  Y+FR +A N  G S+P   + Q   IKDPWDEP KPGRP + D+ ++  D+AW  P  DGGAPI  Y +E ++     W++              V   P  + +  GL EG EY FR++AVNK G   PSE S+  LAK +++  +L    + +I +K G T R+++  GGEP P V W +    L    + I + + ++K     ++T+L +  A RS D G Y + +    G  +    + VLD P KP   L   ++  +++NLSW  P DDGG PI  Y ++ +D   G W+   + KDTKA + GLK G  YQF V AVNKEG S+   T +  KA+NPY  P +   P++VD+D   V+L W+ P  DGG PIT Y+I+KK K G  W +  K          D+  A I GL EG+ YQFR+ AVNKAG    S  ++  + + +NL P ID+ +  + TIKV     + + V+GEPPP+  W  N   +    ++ I  E+Y+     +  +  +    AG Y+L A N +G DK  +++IVL
Sbjct: 1508 PISGEPLPECLWVV------------------NGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKG-KYIEVGKVD-PNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLS-ADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKE--------------VKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQL---ENGIQLTIDTRKN----EHTILCIPSAMRS-DVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSG-------DQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPV-DDQKIRIESEDYK----TRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVL 2167          

HSP 2 Score: 379.793 bits (974), Expect = 1.553e-106
Identity = 237/688 (34.45%), Postives = 360/688 (52.33%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            + D +E++ G  V ++    +  L V   +R  SG++ I   NA G DE  + +N++DKP  P   ++V+ +  +   +    PDDDGG  I++Y+IE  D  ++S +W   A+  G    ++ V+ LI  H Y+FR  A N  G SDP E  G   + KDP+D+P K   P + DW  +  DL W  P +DGGAPI  Y +E K++    W               DV   P    + T   L EG++Y FRI+A NK G   PS+++ S +AK R + P + +  I  I++K G+ F  +I   GEP P++TW   G+ +  D DR+ +     KT +        V +A RS DTG Y IK   + GT  A   V VLD P  PR  L+   I  +  +L+W  P DDGG  I+ YVI+  D   G W    E+KDT   V  L  GH Y+F V AVN+ G+S+P    E I A++P+    +P  P IVD+D     L+W  P+DDGG PI  Y+++ +   G W  A+            EL A + GL  G+ YQFR+ A+NKAGES+PS  ++  + + ++L P I++    ++ +K  +T  + + V+GEP P+  W+ NG  ++S     I   +       KL    +   D+G Y +VA N +G+D+ ++D+ +LD+
Sbjct: 2698 WPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYD--TASGRWVPAAKVAGDKTTAV-VDGLIPGHEYKFRVAAVNAEGESDPLETFGT-TLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN--------------DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSA-SAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESD-DRMKLNNEDGKTKF-------HVKRALRS-DTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAG-------ELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHI---DNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDI 3347          

HSP 3 Score: 374.4 bits (960), Expect = 7.641e-105
Identity = 259/815 (31.78%), Postives = 392/815 (48.10%), Query Frame = 0
Query:  424 GVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDG-KHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC-NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS-LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            G   E YV  V++KD  +P   F N    VP   T   V  + +G K++            +I A+     GD + S +    V      P + D   +  +  K   ++ ++  V G     I  +   +G  V+    + +N    +   +V    R  +G+Y I   N  G D   + V ++D P  P+  ++VT+I K+ C +    P+DDGG EI HY+IE  D  +++ +W+   ++      +  V++L   H Y+FR +A NR G SDP E + + II KDP+D  DKPG P ++DW  +  DL W  P  DGGAPI  Y +E +  S G W     +   ++              T  GL  G  Y FR+KA+NK G S PS+ S +++AK R+L P +++       +K G+T  +D+   GEPAP + W  NGS L  G +  I            + NT LT TK+    D+G Y I    + G  +    VN+LD+P  P   L   +I  E + L W  P DDGG+PIT+YV++  + D G W+   ET DT   V  L  GH Y+F V AVN++G S P  +   I A+NP+  P  P +   VD+D   V L W+ P++DGG PI  YI++KKDKFG W +  + D  + +A  D        L+ G+ YQFR+ AVNKAG   PS  T   + + + + P ++        IK        I  +GEP P   W  N   I +     +T        ++ + +  +   D G Y ++ EN +G+D    ++ VLD+
Sbjct: 2887 GAPIEEYV--VEMKDEFSP---FWNDVAHVPAGQTNATVGNLKEGSKYEF-----------RIRAKNKAGLGDPSDSASA---VAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF--EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQD--AATGRWTACGESKDT---NFHVDDLTQGHEYKFRVKAVNRHGDSDPLE-AREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPS-GDWVPAVTVGAGELT------------ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNN--------TDNNTKLT-TKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQE-DGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATAD-------NLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTP----TSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDV 3640          

HSP 4 Score: 357.836 bits (917), Expect = 1.760e-99
Identity = 267/863 (30.94%), Postives = 414/863 (47.97%), Query Frame = 0
Query:  383 KLIVEG----DAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLG-DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEV--KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKT-IEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN-GDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLI-TREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +LI+ G    D GE  C T  D + + L V   NKF+  +    E +E++      Q KD   P  +F NGK I      + E  Q  +G H L +  I M +    E       G    SC  +  V+  EK P L      +   A + C   V + ++G ++ D +  + K+GK +  ++ + V +    D  ++   NP+   +G + + + N+ G       + + DKP PPK  +E  +++     +    PD D G  +K YIIE  +    S  W++V +  G      KV +L     Y+FR +A N  GLSDP  ++G+ ++ K+P+  P KP     +D   + C LAW  PE DGGAPIT Y IE +EKS   W Q         E+            T K +VE  EY++R+KAVNK G   P +    +  K +   P     GI ++ +K G T +YD+   GEP P   W  NG  L        +++ S++  +     ++ +  A R+ D+G +TI L    G+  +T  V V+  P  P+  L+  ++ A+   LSW  P DDGG P+T Y+++  D+DN G ++    ++   T   V GL+    Y+F V AVN EGESEP    +  + ++P+  P +P  P I DFD   + + W+ P  DGG PI  YI++ +D     +  +K        R+ +  A I GL EGK YQFR+ AVNKAG   PS  ++  L + K +   +   +  S T+K   T  W++K+ GEP PE  W+K   Q+ +  ++ I TR+         LC+  +   D G Y L  +N +G D+   +L VLD
Sbjct: 1060 RLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALK-DTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFET-QSRNGTHTLKIGKIEMNEADVYEIDQAGLRG----SC--NVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQE--GRSGNWAKVGETKGT---DFKVKDLKEHGEYKFRVKALNECGLSDP--LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCEL------------TDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG---RVKMSSERGKH-----IMKIENAVRA-DSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVK--------RVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEH----TILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLD 1874          

HSP 5 Score: 348.591 bits (893), Expect = 1.921e-96
Identity = 223/656 (33.99%), Postives = 339/656 (51.68%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW-YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            R+ +G Y +   NA G D+  + V ++ KP  P   +EV+++ ++   ++   P+DDGG  I HY IE +D+++   +W    +++        V NL   H Y+FR RA N+ G SDP   +   I+ K+P++ P K  +P ++DW  +  DLAW  P+ DGGAPI  + IE K+K+ G W++  ++       KT          T   L EG EY FRI A NK G   PS+ SD V+AK R L P +H+  + +  +K G T ++ +   GEPAP VTW  NG  +     +I  E +  +           + KA R   +G YTI      GT   T  + V   P KP+  +   ++  +   L W  P DDGG PI  Y I+ M+  +G W+    + DT  TV  L  G  Y+F V AVN EG S+P  T   I A+NP+  P  P  P   D+D+  V L+W  P  DGG PI  Y I+K+ K+G W  A+            +  A +P L+  + Y+FR++AVNK G S PS  +K  + + +NL P ID+ +  + TIK  ++  + + V GEP P  TW + +  +I +   V +   EYQ    +KL V + +  D+GT+++ A N NG+D+  + + V+D
Sbjct: 2141 RKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATG--RWVPCGRSETT---KTTVPNLQPGHEYKFRVRAVNKEGESDPL-TTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPD-DGGAPIEAFVIEKKDKN-GRWEEALVVPGDQ---KT---------ATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISR---------FALPKALRK-QSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGG-------QTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQ----SKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID 2755          

HSP 6 Score: 340.117 bits (871), Expect = 8.825e-94
Identity = 240/701 (34.24%), Postives = 345/701 (49.22%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDR-VDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVY-CEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VEG     IE   F +G  +  G + +I+ + D    L   +  R  SG YKI+  N  G DE  ++VNI+D P  P+  +    I+K S V+K   P DDGG+ I +Y++E         +W    +       S+KVN L   H Y+FR +A NR G S P   S   I+ K+P+DEPD P   + +DW  +  DL W  P +DGGAPI  Y +E K+K  G W +              V+GK     T   L  G  Y FR+KAVNK G   PS+ + +V+AK R + P L+  G+ ++ IK G   + DI F GEPAP   W+ N +         +I+  ++  V     ++ + +  A R  DTG Y I +  + G   A   V VLDVP  P   L  DEI  E   L+W  P D+GGT +  Y+++ MD   G W       D  A V  L PG  Y F V AVN +GES+P    EPI A+N +  P    +P + D+D   + ++W   +++GG P+T YI++KK+K    W +A KT   +  A  D L+   PG+     Y+FR+IAVN AG S PS  T P + + + L P I   S   K IK   T   ++   G P P  TW       A   E+L+  +     +T  +    ++  D+G Y L  +N  G+D+   ++IV D
Sbjct: 3277 VEGEPAPKIEW--FLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEK---QEDGGRWVPCGETSDT---SLKVNKLSEGHEYKFRVKAVNRQGTSAPL-TSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDK-FGDWVEC-----------ARVDGK-TTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDA---------TIDTGARADVTNTPTSSAIHIFSAVRG-DTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSA--DNLK---PGVE----YEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK-IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAK----SSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQD 3931          

HSP 7 Score: 297.745 bits (761), Expect = 1.418e-80
Identity = 203/665 (30.53%), Postives = 315/665 (47.37%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK-TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++ +  R  +G YKII+ N  G D    NV ++D P  P+  +++  I K  C +   PP D+GGT++ HYI+E +D S  +  W +V    G  P  + KVN L+    Y FR +A N  G S P E   + II K+ +D PD   +P V DW  +  D+ W    ++GGAP+T Y +E KEK   +W              T+    P    +   L  G EY FR+ AVN  G S PS+ +D  + K RYLKP +       I+IK G T   ++ F G P P+ TW       +GDS      L  +  V  + +T      + +  D+G+Y +K+  + G  +A   V V D P  P   L   ++  +   L+W  P DDGG  I++YV++  D     W+        T  TV  L  GH Y+F V+A N  G S+   T EP+ A++P+  P +P  P IVD DN  + ++W  P D+GG P+ HY I++KD   G +  + T      A  D        + +G  Y++R++AVNKAG   PS  +     +  +  P  D      +  +K     +  I     P P+ +W K G +  +  E   ++         KL +  ++  D+G   + A N  G+ + ++ + V+D
Sbjct: 3605 IHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGT--WQEV----GTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAE-EPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIW--------------TEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILT-ASRKIKIKAGFTHNLEVDFIGAPDPTATW------TVGDS---GAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTR------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQ--------TKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVID 4224          

HSP 8 Score: 274.248 bits (700), Expect = 2.788e-73
Identity = 180/557 (32.32%), Postives = 273/557 (49.01%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP-FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCE-ARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG+YK+ ++N  G DE +  V + D+P  P+  +EV+ ++K+SCV+   PP DDGG EI +Y++E  D  + +N W  V A   G    SI V  L   H Y FR  A N  G SD    + + ++ KDP+  P KPGRP ++D  ++  D+ W  P  +GG+P+ HY+IE K+   G W +   +NTS ++     + +         + +G+ Y +R+ AVNK G   PS++S +  AK  +  P F          +K G      I F   P P ++W + G   L   +              +  T L +    RS D+G   IK +   G  +A   + V+D P  P  +    +      L+W  P DDGG  I  Y I+  ++ +  W         T  TV+GL+ G  Y+F + A N  G S+ C+ + P+  ++P+ PP  P  P I  +D   V+L W  P DDGG PI  Y++++ +K GG       D A  +   +   E  +PGL E + YQFR+ AVN AG   PS  ++P  CR
Sbjct: 3903 KRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRD--TKTNTWVPVSAFVTGT---SITVPKLTEGHEYEFRVMAENTFGRSDSLN-TDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIK---VNTSPVQGTAFSDTR---------VQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVE------------TTDSQTKLVIPSTRRS-DSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGV-PVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGG------GDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCR 4421          

HSP 9 Score: 247.669 bits (631), Expect = 6.501e-65
Identity = 198/659 (30.05%), Postives = 301/659 (45.68%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT--CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI-WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I   NA G  +    V ++     D P  P T E+T    N   +  +PP DDGG+ I  Y++E  +       W+ V     KG + I V  L     Y+FR RA N  G  +P   +G + +   P+ ++P  P  P V   + NS +L W  P  DGGAPI  Y +E K+     W              T  N KP+       K L E  EY FR+ AVN  G   PS+ SD VL + +  +P      + +I ++ G T +  I + GG P P +    NG+  + +++R  +++   + V       +T T + RS D G Y I      G       V VLD P KP   +   +I+A+ + LSW  P D+GG  IT+YV++      GDW+       T   V+ L     Y+F V A N+ G  EP  T + I A+NP+  P  P +P  V+   +++TL+W +P+ DGG PI  Y+I+K++     W  A           I + + R+ GL+  K Y+FR+ A N AG+   S  + P    +    P I+ G  +   +      A   +     P P+ T+ K   +I+ TD  +  + EY     A L + KS++ D G Y +  EN  G D   + L V+D
Sbjct: 4297 FRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFE-KRGGGDWAPVKMPMVKGTECI-VPGLHENETYQFRVRAVNAAGHGEPS--NGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDW--------------TRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDL-FNGNSPIFENERTVVDVNPGEIV-------ITTTGSKRS-DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKR-TPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKA-------AFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRV--KVEYS-DFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVD 4917          

HSP 10 Score: 230.335 bits (586), Expect = 2.030e-59
Identity = 192/714 (26.89%), Postives = 315/714 (44.12%), Query Frame = 0
Query:  431 VFNVQVKDPSAPVDFFLNGKIIV-----------PGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAP-----KLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDI--DNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
             +N  ++D  AP+D ++  K  +           P  DT  EVK +G+ K +     I +   G+ E   P++             +++ E+ P      + +   ++  A +     + YA  G  +  I+L  F     +   +   ++ +   + +     KR  +G YKI   N  G D   +NV ++D P  P   I  T I  ++  +   PP D+GG  I +Y++E     +    W  V    G    +++V NL     Y FR RA N+ G+ +P E +   I+ K+P+D P  PG+P  ++ S  +  L W  P SDGGAPI  Y IE +E     W +    N  D + +              GL     Y FR+ A N  G    S  S  + A     +P ++  G+   +I    G   +  + F   PAP VT+ +  + +     R+ +E       Y +    LT+ K+  + D G Y ++L    G+  A+  + V+D P  P+ +  ++I  +   L W  P  DGG+PIT+Y+++ +D+   +G W       ++   TV GL   + Y+F V A  + G SEPC   + + A+  ++ P++P+ P + D D+    L W  P  DGG  I  Y +Q +D   G W +A       C AR+        GL +   ++FRIIA N AG S PS
Sbjct: 4446 TWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGE-KEEYEFRVIAVNSAGEGEPSKPSD-------------LVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYA-GGNPKPIIDL--FNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEK---RTPGGDWVTVGHPVGT---TLRVRNLDANTPYEFRVRAENQYGVGEPLE-TDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHR------------VTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINM-GMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVE-------YSDFLATLTIEKSELT-DGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPR-DGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVT-------GLRQNGEFEFRIIAKNAAGFSKPS 5106          

HSP 11 Score: 153.68 bits (387), Expect = 5.920e-36
Identity = 154/578 (26.64%), Postives = 248/578 (42.91%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIE-YKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI----EIKKGR---TFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLC-----DGGTQQATGYVNVLDVPEKP----RXLNPDEIRAE---HINLSWATPHD-------DGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            L + + +R  SG  KI   N  G  E  I + ++DKP  P+ I    +S+++C +    P DDGG EI  Y IE  +V S    W +V         +  V  L +  +YRFR RA N +GLSD     G  ++IKDP+D P  P  P +  + +N   LAW  P  DGG+PI  Y +E ++++  G W   ++               PMV GT     GL E   Y FR++AVN  G   PS  S+ V       +P++ +PG  +     +I K     T+   +  GG P      E+     LGD+D      +++      ++T   V       +   Y  +++      +G   + +  V + + P +P      L    +RA     I + +A  +        +G +PI      ++D++ G+ +          T  G K      +++ A NK G+ + C+ L     + P KP    +     D    ++TL W+ P D+GG  IT+Y+++K+   G W             R+  L+A  P       Y+FR+ A N+ G   P
Sbjct: 4190 LVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQI--WDKVPGLISG--TAYTVRGLEHGQQYRFRIRAENAVGLSD--YCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKM---------------PMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTC-----RPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKK---LGDND------WTRCNDKPVRDTAFEVKNLG---EKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV---------ITTTGSKRSDAGPYKISATNKYGK-DTCK-LNVFVLDAPGKPTGPIR---ATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTV--GHPVGTTLRVRNLDANTP-------YEFRVRAENQYGVGEP 4706          

HSP 12 Score: 145.976 bits (367), Expect = 1.382e-33
Identity = 164/665 (24.66%), Postives = 270/665 (40.60%), Query Frame = 0
Query:  586 YKIIIRNAQGFD------ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGG-----APITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKK-DKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS------FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++II +NA GF       ER    +    P PP  +    I +N C +    P +DGG++I  Y +E  +  S+   W+  +  + + P+   V+ L   + Y FR  A N          +G+ I        P  P  P  +  S  S       PE         A  T   +   E +    + G  L  S        +G  +   T K + + +   + ++  N  G       SD+  A      P + +  + N  +  G   R  I+F G      T     SL+L + + I ++  + + V  + + ++T+  A    + G Y   +  D G      ++NV  +PE P+  L+   I      LSW  P  DGG+ ITSYV++  D+   +W+      KD    V GL   H Y+F V A N+ G   P  +  PI A  P+ PP+ P    IV      VTL WQ+P  DGG  +  YI++K+ ++   WF   +                +P L +G+ Y++R+ AVN AG S  +      F+        K ++P  D         +V R   ++ ++ G P PE+ W+K   ++  T +  +  +    G    L ++     DA  Y+  A N +G   T  +L +
Sbjct: 5092 FRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGST--LWTVASDYNVREPE-FTVDKLREFNDYEFRVVAIN---------AAGKGI--------PSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG--VYKFTIKEVWDIDAGEYTVEVSNPYG-------SDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSG------TAPFRHSLVL-NREEIDMDHPTIRIVEFDDHILITIP-ALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPN-------NYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNE------EVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINK----GDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRI 5702          

HSP 13 Score: 133.65 bits (335), Expect = 7.368e-30
Identity = 82/245 (33.47%), Postives = 130/245 (53.06%), Query Frame = 0
Query:  584 GSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIII-KDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            G Y + + N+QG D   I + ++DKP  P+ I V  I+ + C +   PP  DGG+ I +YI+E +D+  S  +W +V+        +  V  LI  +RYRFR RA  + G+S+P E++  D+++ K  ++ P++P  P+V D  S   +L W  P  DGG+ I  Y+++Y++ S G W          I  K D++ +   H    GL +  E+ FRI A N  G S PS  S+    K+R+  P
Sbjct: 4894 GLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRN--LNYTVGGLIKDNRYRFRVRAETQYGVSEPCELA--DVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWD-PPRDGGSKIIGYQVQYRDTSSGRW----------INAKMDLSEQ--CHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPP 5121          

HSP 14 Score: 131.724 bits (330), Expect = 2.941e-29
Identity = 143/558 (25.63%), Postives = 234/558 (41.94%), Query Frame = 0
Query:  582 KSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVL-AKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEI-------RAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGH--IYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            ++G Y+  + N  G       +N+   P+ P+  + +++I  ++  +   PP  DGG++I  Y++E  D+S   ++W  V  ++ K    I V  L   H Y FR  A N  G+  P  +S   II + P+D P  P    ++    +   L+W  P SDGG  +  Y +E +E+    W             + + N  P  +     L++G +Y +R+ AVN  G S  +E   ++  A      P +  P + ++  + GR   ++    G P P   W +    L+  S    I    K+ +     T         S D   YT +     GT+        L +  KPR   P +        + E I L    P+         +      I+N     ++ T D  AT++          ++ V+  N  G      T+    A+ P +PP  P   NI+D   ++V L W+ P+ DGG  +T+Y I+K++  GG +       + C A+       I GL  GK Y+FRIIA NK G+S P   T P L
Sbjct: 5383 EAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSK--DEWVTVT-SNVKDMNYI-VTGLFENHEYEFRVSAQNENGIGAPL-VSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEW------------FRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSP-LSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT---------SDDADEYTCRATNSSGTRSTRAN---LRIKTKPRVFIPPKYHGGYEAQKGETIELK--IPYKAYPQGEARWTKDGEKIENNSKF-SITTDDKFATLRISNASREDYGEYRVVVENSVGSD--SGTVNVTVADVP-EPPRFPIIENILD---EAVILSWKPPALDGGSLVTNYTIEKREAMGGSW-------SPC-AKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVL 5893          

HSP 15 Score: 119.398 bits (298), Expect = 1.567e-25
Identity = 124/483 (25.67%), Postives = 206/483 (42.65%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEI---------SGQDIIIKDPW-DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLR 1048
            +++  +N  G    L++ + +      D P  P  +E+  +  +   +    P  DGG  ++ YI+E  +     ++W +  Q +   P +  V NLI+  +YR+R  A N  GLSD  E+         SG+   I  P  D  ++ GR    +     C+++        G+P   Y           W +G  E+++TS   +    + + ++      L   +   +  +A N  G      T  ++  KT   KP +  P  Y+   E +KG T    I +   P     W ++G  +  +S       FS  T   +K   L ++ A+R  D G Y + +    G+   T  V V DVPE PR    + I  E + LSW  P  DGG+ +T+Y I+  +   G W    +++ T  T++GL+ G  Y+F +IA NK G+S+PC    P+       P  E K     D D Q   +R
Sbjct: 5482 FRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQE--EEHDEWFRCNQ-NPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFE-----CEIS--------GSPRPEYR----------WFKGCKELVDTSKYTLINKGDKQVLI---INDLTSDDADEYTCRATNSSGTR---STRANLRIKT---KPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSK------FSITT--DDKFATLRISNASRE-DYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPV-----LIPGDERKRRRGYDVDEQGKIVR 5915          

HSP 16 Score: 105.145 bits (261), Expect = 3.652e-21
Identity = 137/517 (26.50%), Postives = 208/517 (40.23%), Query Frame = 0
Query:  632 PDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-LAKTRYLKPFL-------HQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVP----EKPRXLNP--DEIRAEHINLSWATPHDDGGTPITSYVIKMMDID-NGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEP-NIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDD-ASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            P  DGG++I  Y ++  D  +SS +W   A+ D       +V  L     + FR  A N  G S P   S +   +K  +  P  P          N C + W  P  DGG+ IT Y +E +E    LW      N  + E   D             L E N+Y FR+ A+N  G  +PS  S  + + ++   +P +        QP  YN      R   +     G P P+  W RNG  L  +S R   E  +   VY  K T+  V      ID G YT+++    G+  AT  + V   P    + P  + P  D +R + I  S   P         S V+   +ID +   +  +E  D    T+  L      ++E    N  GE+     L      N    P  P+ P +I +    + TL W+ P  DGG  IT Y+++K+D        L  D+  +  + + ++   + GL E   Y+FR+ A N+ G  +P     P + R
Sbjct: 5043 PPRDGGSKIIGYQVQYRD--TSSGRWIN-AKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPS-ERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVD------------KLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP--YN------RRAVFTCEAVGRPEPTARWLRNGRELP-ESSRYRFE--ASDGVY--KFTIKEVW----DIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLK-IYFSGTAPFRH------SLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWL------NVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRD--------LSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIAR 5505          

HSP 17 Score: 103.99 bits (258), Expect = 7.996e-21
Identity = 93/361 (25.76%), Postives = 154/361 (42.66%), Query Frame = 0
Query:  926 VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIK-------VNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD---LMQECECDMFKTGDL-----ECNCSNGFRHGEVGGKHLLEID 1269
            V + PE P   + D   AE   L W  P D GG+ I  Y ++  D  +G W+ A    ++   A V GL+    ++F +IA N  G S+P    E  + ++ + PP  P             T+ W  P +DGG  IT Y ++ ++ +G     + +D       + E E  +  L E   Y+FR++A+N AG+  PS  + P   +          GS     +K        NR A++  +  G P P   W +NG ++  +      R E   G   K  + +   IDAG Y++   N  G D    +L+V     + ++    +  +GDL       + +  FRH  V  +  +++D
Sbjct: 5020 VPNQPEAPTVRDKDSTWAE---LEWDPPRD-GGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIRE-YGSTLWTVASD-----YNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESG-------GSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRY---RFEASDGV-YKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMD 5359          

HSP 18 Score: 100.138 bits (248), Expect = 1.146e-19
Identity = 110/493 (22.31%), Postives = 194/493 (39.35%), Query Frame = 0
Query:   46 EDVEWEWENESIPLRPEG---KVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAML----LKRKKVQRKVEV----------------------------------KVHDWIETPVDQEVQENKVDKVV-LTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPL-HPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIV----EGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGV-ERESYVFNVQVKDPSAPVDFFLNGKII-VPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEART 489
            E V+   E  S PL P G     PK+V   +  +  E +   +  ++ G P P  +WFKG +++    R+K  T+G E+T+ L +   R ++EG Y + ++N +G    + K  VT + G+DFRAML     +R   +R+ +                                   KV  W + P+ ++  + +VDK+       S PN K +WY             D         +++ +  ++  TLI++NP ++++GK+T     E     T   + V+ P  ++ F   L   +     +     C +N   A + W R    +    PR+                           I+E     +D V  C L +    E D  E T    +D  S       + +    V  +++ V E +       V D  A V ++ +GK I + G   ++E       K +LI++   +ED+G+ +  T
Sbjct:  638 ESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHSNQQRANSKRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKW-DIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWY------------KDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTC----EANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRF---------------------------IIE-----KDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNR---KRRLIINGARIEDHGEYKCTT 1078          

HSP 19 Score: 69.707 bits (169), Expect = 1.969e-10
Identity = 74/300 (24.67%), Postives = 129/300 (43.00%), Query Frame = 0
Query:  413 KFVSEVSSQNEGVERESYVFNVQVK-DPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSG--VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            K VS +S  NE V R    F  ++   P     +F   K +V    ++  +   GD K  LI++ +T +D  +   R   + G ++       N+ +  K P++       G   A K     +    + Y Q +   +  KDG++++     +I        L + N  RE  G Y++++ N+ G D   +NV + D P+PP+   + +I   + ++   PP  DGG+ + +Y IE  +    S  WS  A++         +  L    +Y FR  A N+ G S P E +   +I  D
Sbjct: 5614 KIVSPLSDLNEEVGR-CVTFECEISGSPRPEYRWFKGCKELV--DTSKYTLINKGD-KQVLIINDLTSDDADEYTCRATNSSGTRSTRA----NLRIKTK-PRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWT--KDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGS--WSPCAKSRY---TYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGD 5897          

HSP 20 Score: 52.7582 bits (125), Expect = 2.714e-5
Identity = 78/327 (23.85%), Postives = 125/327 (38.23%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI-----KAENP--YKPPSEPKEP--NIVDFD-----NQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             D P  P  L   ++  +++ LSW  P  DGG  +  Y+++  + ++ +W    +  +      V  L  G  Y++ V AVN  G S+     + +       E P    P S+  E     V F+     +     RW K   +      + +I K DK     + L +DDA      DE   R               A N +G  S       +TKP +     + P    G  + K      T   +I  K  P  E  W K+G +I +  +  IT ++      A L +S +   D G Y +V EN  G D   +++ V D+
Sbjct: 5508 FDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDA------DEYTCR---------------ATNSSGTRSTRANLRIKTKPRVF----IPPKYHGGYEAQK----GETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDD----KFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADV 5801          

HSP 21 Score: 48.9062 bits (115), Expect = 4.977e-4
Identity = 35/112 (31.25%), Postives = 50/112 (44.64%), Query Frame = 0
Query: 1131 HKNLTPSIDKGSSSSK----------TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEV--LITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
             K  TP +  G+S S           T+  N TAI   KV G P P F W+K   ++ S      +   +E+    T  L + K +  D G Y+L  EN +G D  D+ L+V
Sbjct:  645 EKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEH----TVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLV 752          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:TTN "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000794 "condensed nuclear chromosome" evidence=IEA] [GO:0001701 "in utero embryonic development" evidence=IEA] [GO:0002020 "protease binding" evidence=IEA] [GO:0003300 "cardiac muscle hypertrophy" evidence=IEA] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA] [GO:0004713 "protein tyrosine kinase activity" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005865 "striated muscle thin filament" evidence=IEA] [GO:0007076 "mitotic chromosome condensation" evidence=IEA] [GO:0007512 "adult heart development" evidence=IEA] [GO:0008307 "structural constituent of muscle" evidence=IEA] [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0030018 "Z disc" evidence=IEA] [GO:0030240 "skeletal muscle thin filament assembly" evidence=IEA] [GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IEA] [GO:0031430 "M band" evidence=IEA] [GO:0042802 "identical protein binding" evidence=IEA] [GO:0043056 "forward locomotion" evidence=IEA] [GO:0043621 "protein self-association" evidence=IEA] [GO:0045214 "sarcomere organization" evidence=IEA] [GO:0045859 "regulation of protein kinase activity" evidence=IEA] [GO:0048739 "cardiac muscle fiber development" evidence=IEA] [GO:0048769 "sarcomerogenesis" evidence=IEA] [GO:0051015 "actin filament binding" evidence=IEA] [GO:0051371 "muscle alpha-actinin binding" evidence=IEA] [GO:0051592 "response to calcium ion" evidence=IEA] [GO:0055003 "cardiac myofibril assembly" evidence=IEA] [GO:0055008 "cardiac muscle tissue morphogenesis" evidence=IEA] [GO:0060048 "cardiac muscle contraction" evidence=IEA] InterPro:IPR015129 InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 GO:GO:0005794 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0031430 GO:GO:0030018 GO:GO:0005509 GO:GO:0051592 GO:GO:0003300 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0018108 GO:GO:0004674 GO:GO:0001701 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0004713 GO:GO:0005865 GO:GO:0030240 GO:GO:0055008 GO:GO:0055003 GO:GO:0060048 GO:GO:0045214 GO:GO:0008307 GO:GO:0007512 GO:GO:0000794 GO:GO:0007076 GO:GO:0045859 InterPro:IPR013098 Pfam:PF07679 GO:GO:0030241 GO:GO:0048739 GO:GO:0043056 GO:GO:0048769 GeneTree:ENSGT00720000108588 OrthoDB:EOG7N8ZTK TreeFam:TF316477 InterPro:IPR004168 Pfam:PF02818 Pfam:PF09042 OMA:VTIREPP EMBL:AAEX03017813 Ensembl:ENSCAFT00000022319 Uniprot:F1PV45)

HSP 1 Score: 265.774 bits (678), Expect = 1.755e-70
Identity = 200/658 (30.40%), Postives = 302/658 (45.90%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++I   N  G  + L++ ++  +     PD P    VT ++K+S +V  + P+D GG  I +YI+E  +  + S +W++V +         +V +L+   +Y FR  A N IG+ DP   S + +  KDP  +P  P  P  +D + NS DL W  P  DGG+ I  Y +EY++     W++      S  E K  V G          L +G  Y FR+ AVN+ G S P+   + VL K R   P   L         I+ G T R      G P P VTW++ G        RI +     K         L +  A    D G Y++ +    G++  +  V VLD P  PR L   EIR +   L+W  P DDGG+ IT+YV++  D+ +  W     T   K+ + K L  G+ Y F V A N+ G      T +PIKA +P  PP  PK+ + VD D   V+L W KP  DGG PIT Y+++ +++    +   KT        +  LE  + GL +GK Y+FR+ A N  G   P   T P  C+ K + PS+  D        +K   T  +   ++G P P   W  +G +I + +   +  + +    T K C+ +    D G Y +   N  G     + L VLD+
Sbjct: 18739 FRIHAENLYGISDPLVSDSMKARDRFRVPDAPDQPIVTEVTKDSALVTWNKPND-GGKPITNYILEKRE--TMSKRWARVTREPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPS-KPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTG----------LRDGQTYKFRVMAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAVIKGVPFPKVTWKK-GDREAPTKARIDVTPVGSK---------LEIRNAAHE-DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSTTSKKKSHLAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKT--------VTNLECVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDEHYTVETDSFSSVLTIKNCLRR----DTGEYQITVSNAAGSKTVAVHLTVLDV 19358          

HSP 2 Score: 264.618 bits (675), Expect = 4.182e-70
Identity = 176/555 (31.71%), Postives = 274/555 (49.37%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            L + N  R+ SG Y + + N  G     +NV ++D P P   ++V+ ++K SC +  +PP++DGG+++ HYI+E  +    +  WS V     K   S +V NL+  + Y FR  A N  G   P ++  + ++  DP  EPD P +  V + + NS  LAW  P  DGGA I  Y I Y+E+     +  E     D+ +               GL EG +Y FR+ A N  G SLP E      AK + L P +  P    I IK G+  R +    G+P P   W++      G+ D ++    +      + +++L +    R  D+G+Y++      GT      + V+D P  P+   +  +I A+  +LSW  P +DGG+ IT+Y+++  D+  GDW+ A+ +   T   +  L PG  Y F V A N+ G SEP  T   + A+ P+  PSEPK   +   +   + + W +P  DGG PIT Y+I++K++    +  +K +D      +  LE    GL EG  Y FRI A+NKAG S PS  T+
Sbjct: 20418 LVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVTDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKT--WSTVNPEVKK--TSCQVTNLVPGNEYYFRVTAVNEYGPGVPADVP-KPVLASDPLCEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSL------------VVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP--EQITIKAGKKLRVEAHVYGKPHPVCKWKK------GEDDVVTSSHLAVHK--ADTSSILIIKDVTRK-DSGYYSLTAENSSGTDTQKIKIIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRIGKLIPGQEYIFRVRAENRFGISEPL-TSPKMLAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLW--VKANDTP----VRSLEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 20937          

HSP 3 Score: 255.758 bits (652), Expect = 2.133e-67
Identity = 179/564 (31.74%), Postives = 273/564 (48.40%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP-HLCR 1130
            L + N   E  G Y + + N  G     + V ++DKP PP+ +EV+ I K+SC +    P DDGG+ I +Y++E  DV+S+  QWS ++    K  KS    +L   ++Y FR  A N+ G   P   + + I   DP   P  P     +D       L W  P+ DGG+PIT Y +EY+E+    W          I+ KT  N    +     GL +G  Y FR+KA N  G  LP +T+  +  + + + P   L    I  + +K G T R+     G P P+  W  +G+ +  D    +  + FS         +VLT+    R  DTG Y I +    G++    ++ VLDVP  P   +N  ++  E++ +SW  P DDGG+P+ +Y+++  D     W + +  +  TK  +  L+ G  Y F V A NK G   P  +  P  A++ + PPS P +P + D    + T+ W  P  DGG PIT Y +++++  G W    KT        I +L+ R+ GL EG  Y+FR+ A N AG S+PS  + P   CR
Sbjct: 19029 LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASA--QWSPLSTTSKK--KSHLAKHLNEGNQYLFRVAAENQYG-RGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTEDW----------IKFKTVTN----LECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDEHYTVETDSFS---------SVLTIKNCLRR-DTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYIFRVRAENKMGVGPPLDST-PTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTP-------IADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACR 19554          

HSP 4 Score: 249.98 bits (637), Expect = 1.415e-65
Identity = 197/639 (30.83%), Postives = 295/639 (46.17%), Query Frame = 0
Query:  603 VNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK---LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +N    P PP ++E+T ++K    +  S P+ DGG+EI  YIIE  +   +S +W +V +      + +K   L     Y +R  A N  GLS P E S   I  +DP   P  P +P ++D    +  ++W  P  DGGAP+T Y +EYK+     W+   I N    E             T  GL  G EYVFR+++VNK GAS PS++SD  +AK R  +P   L       + +K G +F   + F G P PSV+W +  + L     R  I+         +  T LT+  ANR+ D+G YT+ +         T  V VLD P  P  +   +I  E   LSW  P +DGG P+ +Y I+  +     W+      +  +  V  L+ G IY F V   N+ G   P  T E +K     + PS P++  +      SV+L W KP  DGG  I HYI++  +K    W            A +      + GL E   Y FR+ A N+AG S P     P L + +   P ID  +  S T+ V   +  +  I + G+P P+ T  ++G+ + +T         +    TA+   + + +S   DAG Y + A N +G  K  +++IVLD
Sbjct: 27716 LNPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIIERRE--KNSLRWVRVNKKPVYDLR-VKSTGLREGCEYEYRVYAENAAGLSLPSETSPL-IRAEDPVFLPSPPSKPKIVDSGKTNITISWVKPLFDGGAPVTGYTVEYKKSDETEWETA-IQNLRGTEY------------TIGGLTTGAEYVFRVRSVNKIGASDPSDSSDPQIAKEREEEPVFDLDSEMKKTLIVKAGSSFTMTVPFRGRPVPSVSWSKPDTDL---RTRAYID-------STDSRTSLTIENANRN-DSGKYTLTIQNILNAASLTLVVKVLDSPGPPANITVHDITKESAVLSWDVPENDGGAPVKNYHIEKREASKKSWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKIT---EKPSPPEKLGVTGVSKDSVSLTWLKPEHDGGSRIVHYIVEAVEKGQKNWVRC---------AVVKSTHHIVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPDIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKAT-------MRFNTEVTAENLTINLKESVTTDAGRYEITAANSSGTTKAFINIIVLD 28307          

HSP 5 Score: 247.284 bits (630), Expect = 1.023e-64
Identity = 189/623 (30.34%), Postives = 286/623 (45.91%), Query Frame = 0
Query:  616 EVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            E + I+K+S VV  + P DDGG EI+ YI+E  D      +W++  +      +  +V  L   H Y FR  A N  G+ +P E S   +  +  D    P  P  P V D S +S  LAW+ P  DGGAP+  Y +E KE S   W        +     T + GK     T   L E  EY FRI A+N  G   P+    SV+AK R   P +         + ++   T R  +   G P P V WE+   +L   ++R  IE+ S  T+    N    VT+     D+G Y + L  + G++ A   V VLD P  P  LN  E++ + + LSW  P  DGG  IT+Y+++  +     +       TK+T   ++ L+ G  Y F V+A N+ G   P  T EP+K     +PP  P    +VD    + T++W+KP  DGG  IT Y+++ + K         ++  S   ++  LEA I GL+ G+ Y FR+ AVN+ G   P     P + R   + PS++   ++      ++  I  +  KG P    +W K+G  +  T  V ++  +        L + ++   D GTY L   N  G     + +IVLD
Sbjct: 26648 EASAITKDSMVVTWARPVDDGGAEIEGYILEKRD--KEGIRWTKCNKKTLTDLR-FRVTGLTEGHSYEFRVAAENAAGVGEPSEPS---VFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEASADEW--------TTCTPPTGLQGK---QFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERLEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---TERAQIEVTSSYTMLVIDN----VTR----FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLNVREVKKDSVILSWEPPLIDGGAKITNYIVEKRETTRKAYATVTNNCTKNT-FKIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVS---EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK--------GSEKWSTCTQVKTLEATISGLTAGEEYTFRVAAVNEKGRGDPRQLGVPVIARDIEIKPSVELPFNTFNVKARDQLKI-DVPFKGRPQATVSWKKDGQILKETTRVNVSSSK----TVTSLSIKEASREDVGTYELCVSNSAGAITVPITVIVLD 27225          

HSP 6 Score: 246.899 bits (629), Expect = 1.260e-64
Identity = 177/562 (31.49%), Postives = 272/562 (48.40%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            L V N  R  SG Y + + N+ G     +NV ++D P PP+ ++V  ++K S  +   PP  DGG++IK+YI+E  +  S+   +S VA    K   S KV+ L     Y FR  A N  G+  P E +     +K   + P  PG+ +++D + NS  L+W  PE DGG+ I  Y +E + K    W     +  ++               T  GL++G EY FR+ A N+ G S P + S  V+AK   + P           +  G   + D+ F G P P+VTW ++  + L  + R++ E         E N++LT+ +A R  D GHYT+KL    G    T  V VLD P  P   +  DE+ A+ I LSW  P  DGG+ I +Y+++  D     W     T   + T+K   LK G  YQF + A N+ G+S    + EP+ A+ P+K P  P  P +  F   S+ ++W +P  DGG  +  Y +++K++    W    KT        I + + +  GL EG  Y+FR+ A N  G   PS  ++ ++ R
Sbjct: 23671 LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRE--STRKAYSTVATNCHK--TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES---VKAS-ERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTE--------------ATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL-LFTTFTVLAGEDLKVDVPFIGRPTPAVTWHKD-DVPLKQTTRVNAE-------STENNSLLTIKEACRE-DVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATV-ARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPVIAQYPFKVPGPPGTPFVTLFSKDSMEVQWNEPVSDGGSRVIGYHLERKERNSILWVKLNKTP-------IPQTKFKTTGLDEGIEYEFRVSAENIVGIGKPSKVSECYMAR 24191          

HSP 7 Score: 245.358 bits (625), Expect = 4.256e-64
Identity = 185/562 (32.92%), Postives = 274/562 (48.75%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI--EIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            L   N  +  +G Y + + N+ G  E  I V ++D P PP  + V  ISK+S  V   PP  DGG+ I +Y++E  D    S  WS V     K   S +V+NL     Y FR  A N  G+ DP E        +D     + PG      V+  + +SC++ W  P SDGG+ I  Y +++  +    WQ+  ++ +  ++             + K L EG EY FR+ A N+ G   PSE   + +AK   + P L    I ++    K+   FR  I   G+PAPSV+W++    L  D+ R+S+E  +        NT L V    +S D G YTI L    GT++ T  + V+  P  P   +  +E+ AE I L W  P DDGG+ IT+Y+++  D  N  W+  A   + T   V  L  G  Y F V A NK G  E  ++ +P+ A++P+  P  P  PNIV+  + SV+L W  P   GG PIT Y I+ K++    W  A KT        I   + ++ GL+EG  Y+FR++A+N AG   PS  ++P
Sbjct: 21506 LRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKS--WSTVTTECSK--TSFRVSNLEEGKSYFFRVFAENEYGIGDPGE-------TRDAVKASETPGPVVDLKVISVTKSSCNIGWKKPRSDGGSRIIGYVVDFLTED-NKWQR--VMKSLSLQY------------SAKDLTEGKEYTFRVSAENENGEGTPSEI--TAVAKDDIVAPDLDLKDIPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESTA-------VNTTLVVHDCQKS-DAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS-DPVVAKHPFDVPDAPPPPNIVEVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLMWKRANKTP-------IRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEP 22022          

HSP 8 Score: 244.973 bits (624), Expect = 5.153e-64
Identity = 176/563 (31.26%), Postives = 265/563 (47.07%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            L V N  R  +G Y   + N  G       V ++D P PP  I    +++ S  +    P  DGG  I HY++E  + S  S  W  +++   +  + +KV++L     Y FR  A N  G+ +P+E+    +      ++P  P R  V+D S +S  LAW  P+ DGG+ IT Y +E ++K    W               +      +  T + LVE  EY FR+KA N  G S P E   SV+ K   ++P     GI N  I  K G TF  D+   G PAP VTW+    + L ++DR+SI          +  T L+V  + R  D+G Y + L    G +  T  V V+  P      +    I AE   LSWA P DDGGT IT+Y+++  +     W L     K T+  V  L     Y F V + N+ G S+P  +  PI AE+P+ PPS P  P +      ++++RW++P  DGG  +  Y ++KK++    +  +K +   C     E   ++ GL EG  YQFR  A+N AG S  S  ++P + ++
Sbjct: 30154 LTVENCNRNDAGKYTFTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSVTLMWDAPILDGGARIHHYVVEKREASRRS--WQVISEKCTR--QILKVSDLAEGVPYYFRVSAENEYGVGEPYEMPEPIVAT----EQPAPPKRLDVIDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW--------------VEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPITGRPAPKVTWKLE-EMRLKETDRVSI-------TTTKDRTTLSVKDSMRG-DSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISAESCVLSWAEPKDDGGTDITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA-PIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILW--VKENKVPCL----ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQN 30678          

HSP 9 Score: 243.432 bits (620), Expect = 1.579e-63
Identity = 181/559 (32.38%), Postives = 271/559 (48.48%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-----KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG Y I  +N  G       V +MD P PPK ++V+ I++ SC +    PDDDGG  IK Y+IE   +   +  W++V      G  S  V +LI++ +Y FR RA NR G+  P E + Q    +DP   PD P +  +   + N+  L+W  P++DGG+P+THY +E             W+Q    N  D+E          +  T + L+EG EY FR+KAVN  G S PS T   V  K +   P +       +E+++G          G P P++TW +         + +  +    K V  +    L + ++ RS DTG YTI  + + GT      +NVL  P  P   +  + I A+ + LSW  P DDGG+ IT+YVI+  + +   W+  + E K+   T+  L  GH Y F ++A NK G  EP  + EP  A N +  P  P +P +      S+T+ W++P  DGG P+T Y ++ KD     +  +  D    +A    +  ++ GL EG  YQFR+ A+N AG    S  + P   R
Sbjct: 17636 KRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKA--WTKVNP--NCGSTSFVVPDLISEQQYFFRVRAENRFGIGPPVE-TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWKQ---CNKRDVE---------ELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIELKEF--MEVEEGTDVNIVAKIKGMPFPTLTWFKAPPRKPDKKEPVVYDTHVNKLV-VDDTCTLVIPQSRRS-DTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFENISADQMTLSWLPPLDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKFGVGEPLDS-EPETARNLFSVPGPPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD--PIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTAR 18170          

HSP 10 Score: 241.891 bits (616), Expect = 5.268e-63
Identity = 186/639 (29.11%), Postives = 282/639 (44.13%), Query Frame = 0
Query:  608 KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMV---HGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNG---SLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS-----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +PDPP   EVT +SK    V  +PP+ DGG  I  Y +E  +    S +W  V ++     + +KV NL+  H Y+FR +A N IG+ +P  +  + ++ KDP + P  P    V+D + +S  L W  P  DGGAPI  Y +E + K           +TS  E     N    +     T   L E  EY FR+ A N+ G   P+E  D++  K     P +         + ++ G   R      G PAP VTW R G    +  G  D +    F            L +  + R  D+G Y++ L+   G +     V VLD P     L   ++     ++SWA P +DGG+ +T Y+++  + +   W     E K T   V  L PG+ Y F V AVN+ G   P    +P+ A +P   P  P++  + +    S TL W  P  DGG  I  YII  ++      +    D  +  + + +L   + GL EGK Y+FR+ A N  G S P      +E K  L   K L P          TIK  +    +  V G+P P   W K    + ++  + +    ++   ++ L +      D+G YSL AEN +G D   + +IV+D
Sbjct: 20153 RPDPP---EVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKE--RHSTRWVPVNKS-AIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPS-LPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKRE---------DTSPDEGWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQAGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRRVGIDNVVRKGQVDLVDTMAF------------LVIPNSTRD-DSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVTDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKTWSTVNPEVKKTSCQVTNLVPGNEYYFRVTAVNEYGPGVPADVPKPVLASDPLCEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYRE------EEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP-------EQITIKAGKKLRVEAHVYGKPHPVCKWKKGEDDVVTSSHLAV----HKADTSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKIIVMD 20745          

HSP 11 Score: 241.121 bits (614), Expect = 1.044e-62
Identity = 195/645 (30.23%), Postives = 296/645 (45.89%), Query Frame = 0
Query:  522 SGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNI--------------NF------HGDRVDLN--------VINP-KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ-GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA-KTRYLKP---FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            +GV+      G   A + + +  ++LS FKDG EV V   + I              +F       GDRV +         VI+P +R   G Y + + N        I+VN++ +P  PK ++   I+++S  +   PPDDDGG+ +  Y+++  +VS  +  W++V   D        V +L+    Y F+  A N+ G  +P  +  + + +  P   PD P      D ++NS  L W  P+ DGG+ I  Y +E   +    W   GE +  + +E+               GL EG  Y +R+KA+N+ GAS PS+ +D + A  T+ L+    FL    +  + +K G          G+P P++TW +   +LL    RI+IE   KK+        +T+  + RS DTG Y I+ +   G   A   VNVLD P  P   +  E+  E   L+W  P DDGG+ IT+YV++    D+  W     T KDT      L P   Y F V A N  G  EP +   PI A+  + PP  P      D    +VTL W +P DDGG PIT Y +++ D     W    K         + +   R+ GL+  K Y+FR++A N AG   PS  T+P L +
Sbjct: 15122 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPHATWSFGDKVLEAGDRVKMKTISAYAELVISPSERPDKGIYTLKLENPVKAISGEIDVNVIARPSAPKELKFGEITRDSVHLTWEPPDDDGGSPLTGYVVQKREVSRKT--WTKVI--DLVTDLEFTVPDLVQGKEYLFKVCACNKCGPGEPAYVD-EPVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDRWVACGEPVADTKMEVT--------------GLEEGQWYAYRVKALNRQGASKPSKPTDEIQAVDTQVLEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPTITWTK-ADMLLKQDKRITIENVPKKST-------VTILDSKRS-DTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDVTEVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNYKATKLTPNKEYIFRVAAENMYGVGEPVQA-SPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMP-------VKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIK 15730          

HSP 12 Score: 240.736 bits (613), Expect = 1.189e-62
Identity = 198/658 (30.09%), Postives = 301/658 (45.74%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G  E L +  ++ K     P PPK++EVT+I+K+S  V  + PD DGG+EI  YI+E  D   S  +W + ++      + ++V  L   H Y FR  A N  G+ +P   S   +  K  DP  +P  P    ++D + NS  LAW  P  DGG+ I  Y +E  +     WQ           I T   G          L+E  EY  R+ A+NK G    +    +V  + +   P L         I ++ G + R  I F G P P +TW R        +D++ IE   K   Y    T L++   +R+ D G Y +KL    G++ A   V VLD P  P+ L   E++ + + L W  P  DGG  + +YVI   +     +   + +   T   V+ L  G IY F V+A N+ G   P  T++ +KA    +PPS P +  + D    S +L W+KP  DGG  +  Y+++ + K         T+  S  A      A I GLS G+ YQFR+ A N+ G+S P     P + +   + PS  K   ++ T++       +I V G P PE +W K+G     T     TR   +  AT+  L + +S   D G Y++ A N  G    +L +IVL+
Sbjct: 25530 FRIMAVNKYGVGEPLESAPVLMKNPFVPPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRD--RSGIRWIKCSKRRITDLR-LRVTGLTEDHEYEFRVSAENAAGVGEP---SPATVYYKACDPIFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEIIGYVVELCKADEEEWQ-----------IVTPQTGLRATRFEISKLIEHQEYKIRVSALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEF---TDKVQIE---KGVNY----TQLSIDNCDRN-DAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLTVKEVKKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCGKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAA---EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPK--------GTEKWSTVAESKVCSAVITGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSF-KLPFNTYTVQAGEDLKIEIPVIGRPRPEISWVKDGEPFKQT-----TRVNVEETATSTILHIKESNKDDFGKYTITATNSAGTATENLSIIVLE 26142          

HSP 13 Score: 239.965 bits (611), Expect = 2.051e-62
Identity = 189/659 (28.68%), Postives = 300/659 (45.52%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G  E L +  ++ K     PD PK  E+T ++K+S VV    P  DGG+EI  Y++E  D      +W++       G   ++V  L+  H Y FR  A N  GLS+P   S       DP  +P  P  P V+D + +S  L+W+ P  DGG  I  Y +E  + S+G W        +N ++IE++               L+E +EY FRI AVNK G    ++    V+ + +   P +         I I+ G + R  +   G P P V W   G +     D   I++ S         T L +   NR  D+G YT+ L    GT+ A   V VLD P  P  L   EI  + ++++W  P  DGG+ I +Y+++  +     +   +      +  ++ L+ G  Y F V A N+ G   P  T +PIK     +PP    +  + D    SV+L W KP  DGG  I  YI++ + K    W +          AR+  LEA I  L++G+ Y FR++AVN+ G S P     P + +   + P + + + S+ +++V +    ++ + G P P  TW K+G+ +  T  V +T           L + ++   D G Y +   N  GQ    +++I LD
Sbjct: 24464 FRIMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEITTVTKDSMVVVWERPASDGGSEILGYVLEKRD--KEGIRWTR-CHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSLPSAYQKAC-DPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEK--------------LLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIELDLELRKIINIRAGGSLRLFVPIKGRPTPEVKW---GKMDGEIRDAAIIDVTS-------SFTSLVLDNVNR-YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIEQLQEGCSYYFRVTAENEYGIGLPAHTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC---------ARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPVVAKDLVIEPDV-RPAFSNYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRVNVT----DSPDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEVITLD 25076          

HSP 14 Score: 238.424 bits (607), Expect = 5.836e-62
Identity = 193/650 (29.69%), Postives = 292/650 (44.92%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRX-LNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDK 1223
            ++I+ +N  G  E L        N+   P PP    V+ +++NS  V    P+ DGG+ +  Y +E  D  ++S +W +V +   K      S KV  LI    Y+FR  A N  G+  P  +    +  +DP   P  P    V DW+ +S DL W+ P  DGG+ +T Y +EYKE+    W+QG+           +V G  +V     GL EG  Y FR++AVN  G   P E +D +  K R + P L         I +  G   R   +  G+P P+VTW  N   L  ++   +IE  +  +    KN         RS   G Y++     GG ++ T  V+VLDVP           +  +   L+W +P DDGG+PIT+YVI+  + D   W     T   + ATV+GL  G  Y F + A N  G      T   +   +P   P  P++  + +    SVTL W  P  DGG  I +Y+++ +      F  +  D+      +   +  + GL EG  Y++R+ AVN  G+  PSF TKP  C+     P++D       TI+V        +  G+P P+ +W+K+   +   D   I         T  L   K++  D+G Y +V EN  G  K
Sbjct: 18043 FRIMAQNKFGVGEPLDSEPETARNLFSVPGPPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD--TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVG-PASLPSDPVTARDPIAPPGPPIP-KVTDWTKSSVDLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEQGK---------DKEVRGTKLV---VTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPQEA---TIETTAISSSMVIKN-------CQRS-HQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGIPFQAHNLTNDSCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSVGIGPFTETPTALVIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTKDN------LLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDDLAPPTLDLDFRDKITIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIK----TTPTTLALEKIKAKRSDSGKYCVVVENTTGSRK 18655          

HSP 15 Score: 238.424 bits (607), Expect = 6.308e-62
Identity = 203/659 (30.80%), Postives = 289/659 (43.85%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS----GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L     + VN    PDPPK  EVT I+K+S VV    PD DGG+EI +YI+E  D   +  +W +  +      +  KV+ L   H Y FR  A N  G+S P   S      D + K     P  PG P VLD S +S  +AW  P  DGG+ IT Y +E        WQ           I T   G      T   LVE  EY  RI A+N  G   P+    +  A+ R L P +         + I+   T R  +   G PAP V W R     L   D+ SIE  S         T+L V   NR  D+G Y + +    G++ A   V VLD P  P+ L   E+    + L+W  P  DGG+ I +Y+++  +     +   A     T   V  L+ G  Y F V+A N+ G   P  T E +KA    + P  P +  +VD    SV+L W+KP  DGG  I  YI++ + K    +       A+C A +   EA I GL +G+ Y FR+ A N+ G S P   + P + +   + P+  K   ++ T+         +   G P P  TW+K+ + +  T  V     E     T K    +    D G Y++   N  G+    L++IVLD
Sbjct: 23382 FRVMAVNKYGVGEPLESEPVLAVNPFRPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYIVERRD--KAGQRWVKCNKKTLTDLR-YKVSGLTEGHEYEFRIMAENAAGISAPSSTSPFYKACDAVFK-----PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYIVEIARPEEDEWQ-----------IVTPPAGLKATSYTITNLVENQEYKIRIYAMNSEGMGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESL---DKASIESTS-------SYTLLIVGNVNR-FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS---ERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKW-------ATC-ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAF-KLLFTTFTVLAGEDLKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACRE----DVGHYTVKLTNSAGEATETLNVIVLD 23994          

HSP 16 Score: 232.261 bits (591), Expect = 5.203e-60
Identity = 159/546 (29.12%), Postives = 266/546 (48.72%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            L + N  R  SG Y + + N  G     +NV ++D P  P  + V  + K+S ++   PP  DGG +I +YI+E  +  ++   ++ V     K   + K+ NL     Y FR  A+N  G+  P E + + + + +P   P  PGR +++D + N+  + W  PESDGG+ IT Y +E + K    W       ++  ++KT       +  T  GL  G EY FR+ AVN+ G   P +    V+A+   +KP +  P      +K     + D+ F G P  +V+W+++G  +L ++ R+++   S KTV     T L++ +A+R  D G Y + +    G       V VLD P  P  ++ DE+  +++ +SW  P  DGG  I++Y+++  +  +  W + +     T   +  L  G  YQF V A N+ G S    +  P+ AE P+ PP  P  P +V     ++ + WQ P +DGG  +  Y ++ K++    W  A K         I + + ++ GL EG  Y++R+ A N AG
Sbjct: 26902 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLNVREVKKDSVILSWEPPLIDGGAKITNYIVEKRE--TTRKAYATVTNNCTKN--TFKIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-------STCTQVKT-------LEATISGLTAGEEYTFRVAAVNEKGRGDPRQLGVPVIARDIEIKPSVELP-FNTFNVKARDQLKIDVPFKGRPQATVSWKKDGQ-ILKETTRVNVS--SSKTV-----TSLSIKEASRE-DVGTYELCVSNSAGAITVPITVIVLDKPGPPGPVHIDEVSCDNVTISWNPPEYDGGCQISNYIVEKRETTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENRFGRSSYSESA-PVVAEYPFSPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKI-------LIADTQMKVSGLDEGLMYEYRVYAENIAG 27407          

HSP 17 Score: 230.72 bits (587), Expect = 1.485e-59
Identity = 186/659 (28.22%), Postives = 290/659 (44.01%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS----IDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++  RN  G  E +   N +      D P PP  + +T I++    +   PP+ DGG EI +Y+IE  D +S     +   +A+     S  V +++    Y FR RA NRIG+  P   +   + + DP + P  P   S  D + +S  L W  P  DGG+PI  Y IE  E+    W            I+ +    P +     GL +GN+Y++R+ A N+ G S PSE    + A   +++P +      + +E+      +  +   G P P  TW   G  +L   DR+ ++  S    Y E    L ++ + R  D G YT+KL            VNV+  P  P+ L   EI  + ++L+W  P DDGG+P+T YV++  ++    W   ++   D + TV  L  G  Y F+V A NK G  EP    EP+    P   P  P+     D    S+ L W  P  DGG  I  YI++K  +    + A       C   + + +  + GL EG+WY +R+ A+N+ G S PS  T         +  +    +D    +  T+K          V G+P P  TW K  + +     + I  E     +T  +  SK    D GTY + A N  G+    +++ VLD
Sbjct: 14912 FRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDINRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL---SATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNW------------IRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPHATWS-FGDKVLEAGDRVKMKTIS---AYAE----LVISPSERP-DKGIYTLKLENPVKAISGEIDVNVIARPSAPKELKFGEITRDSVHLTWEPPDDDGGSPLTGYVVQKREVSRKTWTKVIDLVTDLEFTVPDLVQGKEYLFKVCACNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDRWVA-------CGEPVADTKMEVTGLEEGQWYAYRVKALNRQGASKPSKPTDEIQAVDTQVLEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPTITWTKADMLLKQDKRITI--ENVPKKSTVTILDSKRS--DTGTYIIEAVNVCGRATAVVEVNVLD 15534          

HSP 18 Score: 229.565 bits (584), Expect = 3.535e-59
Identity = 172/558 (30.82%), Postives = 265/558 (47.49%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  +G + + I NA G     +NV ++D P P   +  T I+K+S  +    P  DGG+ I +YI+E  + +  S  +S V+    K   + KV  L     Y FR  A N  G+ +P E +       +P    + P  P   +++D + ++  LAW  P+ DGG+ IT Y IE + K    W              T V G   +    K L EG EY F++ AVN  G S P E S  V+ K + + P L   GIY   +  K G   + +I   G P P+VTW++ G  +L  + R++ E           +T+L + +  RS D+G Y +      G       + V D+P  P   +  DE+ ++ +  SW  P +DGG PI++Y+++M   D+  W+  + T   + T K   L  G  YQF V A N+ G   P  T  PI A  P+K P  P  P +      S+T+ W +P  DGG PI  Y I++K++ G  +  +       +A +     +  GL++G  Y+FR+IA N AG+S PS  ++P L 
Sbjct: 22594 RYDTGKFVMTIENAAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS--YSTVSTKCHKC--TYKVTGLSEGCEYFFRVMAENEYGIGEPAETT-------EPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTH-----------ITTVKG---LECVVKNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQRVNFE-------NTATSTILNINECVRS-DSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIRFDEVSSDFVTFSWDPPENDGGVPISNYIVEMRQTDSTTWVE-LATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVG-PGITSTPIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTV------SKALVPGNIFKSSGLTDGIAYEFRVIAENLAGKSKPSKPSEPMLA 23108          

HSP 19 Score: 226.098 bits (575), Expect = 3.902e-58
Identity = 180/646 (27.86%), Postives = 284/646 (43.96%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT-----VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKV--NRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            E ++  N    P  P   E     K   +++ + P+ DGG EIK+Y+++  +    S +W++V +        +KV  L+    Y+FR  A N  G S+P E S   I  ++P   P  P  P V+D +  S  LAW  P  DGG  IT Y +E +EK    W +        +  K  +        T   L  G +Y FR+ AVN  G S  SE++  +    R   P L         + I+ G + R  +   G P P +TW + G           I+L ++  +   +  ++L V K NR  D G YTI+     G + AT  V V D P     +   E+  + + ++W  P  DGG P+ +Y+I+  +      + A +T  TK +     + GL  G +Y F V+  N  G  EPC T + +      + P  P +  +VD    +VTL W+KP  DGG  +T Y+++  +     W   +             LE  +  L+EG+ Y FR+ A N+ G S P         R   + P+ID  +   KTI V   R     I + G PPP  +W+  G ++  ++ V +          AKL + ++ + D G Y+L  +N  G     + +I+LD
Sbjct: 30970 EPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEIKNYLVDKRE--KKSLRWTRVNKDYVIYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNF-IACREPSYTPGPPSAPRVVDTTKYSISLAWTKPLYDGGTDITGYVLEMREKDTDQWYR--------VHTKATIRNNEF---TVPDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWTKKG-----------IDLANRAIIDTTDSYSLLIVDKVNR-YDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAA----MRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVS---EVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACRAGTERWMKVVTLKPTV-------LEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVRDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETH----TKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD 31571          

HSP 20 Score: 224.942 bits (572), Expect = 9.842e-58
Identity = 165/573 (28.80%), Postives = 269/573 (46.95%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDP---WDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVI-KMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            I+       L + N  R  SG Y + + N+ G     + V ++D P PP  ++VT I+K+S  +   PP  DGG++IK+YI+E  + +  S  ++ V     K   S K+  L     Y FR  A N  G+  P   +       DP    + P  PG+ +V D + NS  L+W  PE DGG+ I  Y +E + K    W +   + +              +      L +G EY+FR+ AVN+ G S P   +  V+AK   ++P + +P   N  ++ G+  + ++   G P P++TW ++G L L  + R+++             TVL++ + ++  D GHY I +    G + A+  V  LD P+ P+  +  DE+ AE I LSW  P   GG  IT+Y++ K           +     T   V  LK G  YQF + A N+ G+S    + EPI A+ PYK P  P  P +      ++ ++W +P ++GG P+  Y +++K++    W    KT        I + + +   L EG  Y+FR+ A N  G    S  ++ ++ R
Sbjct: 24744 IDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKN--SWKIEQLQEGCSYYFRVTAENEYGIGLPAHTA-------DPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKS--------------LEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPVVAKDLVIEPDV-RPAFSNYSVQVGQDLKIEVPISGRPKPTITWTKDG-LPLKQTTRVNV-------TDSPDLTVLSIKETHKD-DGGHYGITVANVVGQKTASIEVITLDKPDPPKGPVKFDEVSAESITLSWNPPTYTGGCQITNYIVQKRDTTTTVWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-EPIVAQYPYKEPGPPGTPFVTAISKDAMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTI-------IHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 25273          

HSP 21 Score: 224.942 bits (572), Expect = 1.081e-57
Identity = 189/627 (30.14%), Postives = 288/627 (45.93%), Query Frame = 0
Query:  616 EVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS---IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF-LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            EV++++KN+  V    P DDGG+EI  Y IE  +    S +W +      K P S    KV  L   + Y FR  A N+ G+  P E S   +++KD    P  P    V D +  S  LAW  P  DGG  IT Y +E+++     W    I +T+   ++       +       L    +Y FRI+A+N  G   P+   D  + +      F L       + ++ G + R  +   G PAP VTW ++   L    +R +IE         E  T+L + + NR  DTG + + +    G +     V VLD P     L P +I  + + L W  P  DGG+ IT+Y+++  +     +   + TK  K T  V GL  G  Y F V+A N+ G  EP  T EP+KA    + PS P   NI+D    +V+L W KP  DGG  IT Y+I+ + K    +  + T        +  LE  +  L+EG+ Y F+++AVN AG S+P  E++P + + + + P +D      K +  K       +I V G P P  TW K G QI    +    R  ++  AT+  L +++    D+G Y L A N  G+    + + V D+
Sbjct: 22334 EVSNVTKNTATVSWKRPVDDGGSEITGYHIERRE--KKSLRWVRAT----KMPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSEASNP-VLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYIVEHQKVGDEAW----IKDTTGTALR-------ITQFVVPDLQTKEKYNFRIRAINDAGIGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINL---KNRANIE-------NTESFTLLIIPECNR-YDTGKFVMTIENAAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSY-STVSTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVKAS---EAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--------VKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQ----RVNFENTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDI 22913          

HSP 22 Score: 222.631 bits (566), Expect = 5.641e-57
Identity = 170/520 (32.69%), Postives = 243/520 (46.73%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            P PP T +VT ++K+S  +    P  DGG+ I  Y IE  +   +   W  V++A   G    K + L +   Y FR  A N  G S P + S + ++  DP D    PG+P  L+ + ++  L WA PE  GG  IT Y +E ++   G W +    N  + E             T  GL E   Y FR+ A N  GA S PSE SD++  +     P +     +   I +K G  F+ +    G P P++ W ++G  L G +   I I  FS             + K +   D+G Y +     GG  +    V VLD P  P   L   E+ AE   LSW  P DDGG  I  Y+++  +     W   A E + TK  V  L  G+ Y F V+AVNK G  EP  + EP+ A NP++PP  PK P +      S+ + W  P  DGG  I +YI++++DK G  W    K         + +L  ++ GL+EG  Y+FRI+A N AG S+PS
Sbjct: 23014 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKE--RNGILWQTVSKALVPG-NIFKSSGLTDGIAYEFRVIAENLAGKSKPSKPS-EPMLALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF------------TVSGLTEDAAYEFRVIAKNAAGAVSPPSEPSDAITCRDDIEAPKIMVDVKFKDTIILKAGEAFKLEADVSGRPLPTMEWTKDGKELEGTAKLEIRIADFS----------TYLINKDSTRRDSGAYILTATNPGGFAKHIFNVRVLDRPGPPEGPLAVSEVTAEKCVLSWLPPLDDGGAKIEHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES-EPVLAVNPFRPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKT-------LTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 23496          

HSP 23 Score: 221.09 bits (562), Expect = 1.671e-56
Identity = 172/552 (31.16%), Postives = 261/552 (47.28%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIK--VNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKN-TVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            +++   N  G  E L +  ++ K     P  PK   VT ++K+   V    PD DGG+ I  Y+IE  +   +S  W    +A+    +S++     L+    Y FR  A N+ G S P + + + +  + P D    PG+P V+D S N+  L WA P+ DGG+ I  Y +E  +     W +    NTS  +I       P    T  GL E  +Y FR  A      S PSE SD V  +   + P +         + +K G     D    G+P P+V+W++ G+LL   S+ I + +        ++N   L +   NR  D+G YTI      G++ AT  + VLD P  P  +  +++ A+   LSW  P +DGG+ IT+Y+I   +    +W     T   T  +V+ L  GH YQF + A NK G  +P  T EP  A+NPY PP     P I +     +T+ W+ P+DDGG PIT Y+++K++     W    +         + E   +  GL EG  Y+FR+ A+NKAG   PS  +K
Sbjct: 20819 FRVRAENRFGISEPLTSPKMLAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKE--RNSLLW---VKANDTPVRSLEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT-EYVTARMPVD---PPGKPEVIDISKNTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVR---CNTSPHQI-------PQEEYTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIQAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLL-KPSEGIKMAM--------QRNLCTLELFSVNRK-DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPIFT-EPAVAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNWTKVNRKP-------VIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASK 21333          

HSP 24 Score: 219.55 bits (558), Expect = 4.621e-56
Identity = 183/632 (28.96%), Postives = 270/632 (42.72%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHG--TCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK--TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            PD P T E ++++ NS  +  + P+ DGG EI+ YI+E  +    S +W +V           KV  LI  + Y F   A N  G+  P  IS + I  ++P   P  P    V D S  +  L W+ P  DGG  I  Y IE  +  +G W +              VN +  V    T   L  G EY FR+ A+N  G    SE + ++ A  R   P L     +     ++ G + R  I + G P P+  W +  S L   +D  + + FS           LTV   NR+ D G YT  +  + G++  T  V VLD P  P  +   ++    + L W  P  DGG  I  YV++  +     W    E K T+  +K   L  G  Y F V A N+ G  EP    EPI A    + P+ PK  +++D    S  L W KP  DGG  IT Y+++ + K    W +A  T          +L   +  L E   Y+FR+ A N AG S P       + +   + P+ D    +++  T K   T    + + G P P+ TW    +++  TD V IT  + +      L V  S   D+G Y L  EN  G     + ++V+
Sbjct: 29893 PDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERRE--KKSTRWVKVISKRPISETRFKVTGLIEGNEYEFHVMAENAAGIGPPSGIS-RLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHK--------------VNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGESSEATGAIKAVDRLAAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADIHTTDSFS----------TLTVENCNRN-DAGKYTFTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSVTLMWDAPILDGGARIHHYVVEKREASRRSWQVISE-KCTRQILKVSDLAEGVPYYFRVSAENEYGVGEPYEMPEPIVAT---EQPAPPKRLDVIDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT---------KQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPITGRPAPKVTWKLEEMRLKETDRVSITTTKDR----TTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVI 30479          

HSP 25 Score: 218.394 bits (555), Expect = 1.086e-55
Identity = 174/559 (31.13%), Postives = 263/559 (47.05%), Query Frame = 0
Query:  604 NIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKP-FLHQPGIYN-IEIKKGRTFRYD-IWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            ++ D P PP  +EV H   +S  +  + P   GG+ I  Y IE  +   +S  W +  +   +  K  KV  L     Y FR  A N  G+  P  +  + ++  DP D    PG+P V++ + NS  L W  P+ DGG  +T Y +E ++     W +   +N  D               T   LVEG +Y FRI+A N  GA S PSE++ +V+ K  Y  P  +  P I + + IK G T     I   G+P P  +W R G  +   SD + I            +++LTV  A R  D G YTI      GT++    V VLDVP  P  +    + AE   L+W  P +DGG+PI SYV++  +     W + A + +  +     L  G+ Y F V AVN+ G+ EP ++ EP+K  + + PP  P +P + +    + T+ W++P DDGG  IT Y I++++K    W  A K         + +L  ++ GL EG  Y+FR+ A NKAG   PS  + P L +     P     +  + T K + +  W
Sbjct: 21929 DVPDAPPPPNIVEVRH---DSVSLTWTDPRKTGGSPITGYHIEFKE--RNSLMWKRANKTPIRM-KDFKVTGLTEGLEYEFRVMAINLAGVGKPS-LPSEPVVALDPID---PPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWTKANHVNVPDCAF------------TVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTVICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAISIHGKPLPKSSWSRAGKDIR-PSDIVQIS-------STPTSSMLTVKYATRK-DAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYVFRVSAVNQYGKGEPVQS-EPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHIERREKKSLRWVRATKMP-------VSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSEASNPVLMKDVAYPPGPPSNARVTDTTKKSASLAW 22448          

HSP 26 Score: 218.009 bits (554), Expect = 1.224e-55
Identity = 225/806 (27.92%), Postives = 347/806 (43.05%), Query Frame = 0
Query:  394 TCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQV--KDPSAPVDF--FLNGKIIVPGADTRMEVKQMGDGKHQLIVHY--ITMEDYGQIEARTPTNH-------------GDKTVSCTGS-------FNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVE-GYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSG---SYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKG-SSSSKTIKVNRTAIW 1156
            TCAT K + ++   +    ++   VS+QNE    +    +V V  KD   P  F        ++ G D +++V  +G     +  H   + ++   ++ A +  N+             G  TV  T S        NVI+ +K       GP +G    D     S  +  G  + D   S+     E +             V    I   R K+G    ++I   N  G    L +  ++ +     P PP T  VT  SK+S  V+ + P  DGG+ +  Y +E  +   +S  W ++ +      K  K   L     Y FR  A N +G+  P ++S +  + +DP D    PGRP  +  + NS  L W  P  DGG+ IT Y +E KE   G W +    N  D + +              GLVE   Y FR+ A N  G  S PSE++ ++ A+     P +     Y   I +  G +F+ D    G+P P++ W + G   L ++ R+ I    K T +    T L+V  A R ID+G+Y +K     G +  T  V VLD P  P   +    + AE   L+W  P  DGG+ I +Y+++  +     W L     +     V  L  G+ Y F ++AVNK G  EP  + EP+ A+NP+  P  PK P I      S+ + W++P+ DGG  I  Y+++K+DK G  W          C  R I EL  R+ GL E   Y+FR+ A N AG S PS  +       K   P    G  ++ K I + R++++
Sbjct: 23852 TCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFTTFTVLAGEDLKVDVPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKP------GPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVIAQYPFKVPGPPGTPFVTLFSKDSMEVQWNEPVSDGGSRVIGYHLERKE--RNSILWVKLNKTPIPQTK-FKTTGLDEGIEYEFRVSAENIVGIGKPSKVS-ECYMARDPCD---PPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNVIDTQFEVT------------GLVEDQRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVLHAGESFKIDADIHGKPIPTIQWVK-GDQELSNTARLEI----KSTDFA---TSLSVKDAVR-IDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVVSGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTLVDANVQTLSYKVTKLLEGNEYIFRIMAVNKYGVGEPLES-EPVIAKNPFVVPDAPKAPEITTVTKDSMVVVWERPASDGGSEILGYVLEKRDKEGIRW--------TRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSLPS----AYQKACDPIYKPGPPNNPKVIDITRSSVF 24610          

HSP 27 Score: 218.009 bits (554), Expect = 1.245e-55
Identity = 182/648 (28.09%), Postives = 288/648 (44.44%), Query Frame = 0
Query:  606 MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD---------VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECE 1238
             D P PP  +E + I+K++  +    PDDDGG+ I  Y +E +D    +++W +  +   K   + +V  L NK +YRFR  A N  G   P   S + I+IKDP D P  PG+P+V D    S  L W  PE DGGA I  Y IE  +     W +                G P       GL+EG EY FR++AVNK G S PSE SD VL + +   P   +   + NI  K     ++ +    GG P  +   E+       D  R   +     TV   K TV  +T+ +       Y  ++  +    Q+  Y  + D          P  P  L   ++   H++L W  P +DGG PI  Y+I+  +     W+ A +T   D    V  +  G   QF+V A N+ G   P    E +  E+P  PPS P + ++ D   + + + W+ P  +GG PI  Y ++        W           + +++E      G+   K Y  R+ AVN  G S PS  ++  + +  +  P+ID  +     I+  + +I  +  +  P P  +W+K+G ++ ++D + +  +      +A L V KS   DAG Y++  EN+ G     +++ V+ L   C+
Sbjct: 15632 FDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLD--PDTDKWVRCNKMPVKD-TTYRVKGLTNKKKYRFRVLAENLAGPGKPSR-STEPILIKDPIDPPWPPGKPTVKDVGKTSLMLNWTKPEHDGGAKIESYIIEMLKTGTEDWVRV-------------AEGVPTTQHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINI-TKNTADLKWTVPEKDGGSPITNYIVEKR------DVRRKGWQTVD-TTVKDTKCTVTPLTEGSL------YVFRVAAENAIGQS-DYCEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTELLSIEDPKGPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEE------GVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCQPTIDMETHDIVVIEGEKLSI-PVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHI----SAHLEVPKSVHADAGIYTITLENKLGSATGSINVKVIGLPGPCK 16236          

HSP 28 Score: 217.238 bits (552), Expect = 2.263e-55
Identity = 192/630 (30.48%), Postives = 280/630 (44.44%), Query Frame = 0
Query:  621 SKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQA--DGKGPKSIKVN--NLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLV----EGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ--KKDKFGGWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA---TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +K S +V  +PP D+GG+ I  Y +E  +       WS+V++A     G K ++ N   L    +Y+FRA A N  G+  P E S    +  DP   P  P  P V D + +S  LAW  P  DGG+PI  Y +E +E+    W++              VN    +  TC+ +V    E  +Y FR+KAVN+ G S PS+T+  +LA      P  F+      ++  + G   R      G P P  +WE +G       D +       +    E ++V+ + +  RS  +G Y+I      G + A   V V+DVP  P+ L   +I      L+W  P DDGG  I  YVI+   ID   W         T   V  L     Y F V A N+ G   P  T++   A +P  PP  P +  I      +V L W+ P +DGG P+THYI++    D  G   +A K     C  R ++ELE  +  L EG  Y+FR+ AVN AG S PS    P   + +   PSI+  +     +   VN  A    K+KG P P  TW+K   +     E ++            T  L + +S+  D G Y++ A N  G    ++ L VL
Sbjct: 17365 TKGSMLVSWTPPLDNGGSPITGYWLEKRE--EGGAYWSRVSRAPITKVGLKGVEFNVPRLTEGVKYQFRAMAINAAGVGPPSEPS-DPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGSTDWKK--------------VNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEILATDIQEPPEVFIDIGAQDSLVCQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAVKDGVHDVPEDAQVETAENSSVIIIPECKRS-HSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLTWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTSFVVPDLISEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWK----QCNKRDVEELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIELKEFMEVEEGTDVNIVA----KIKGMPFPTLTWFKAPPRKPDKKEPVVYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL 17968          

HSP 29 Score: 215.312 bits (547), Expect = 8.425e-55
Identity = 154/562 (27.40%), Postives = 258/562 (45.91%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            V I    +   L++ N  R  +G Y + + N+ G     + V ++D P PP+ + V  + K+S ++   PP  DGG ++K+Y+I+  +  S+   ++ V+   GK   S KV NL     Y FR  A N  G+  P E +   +   +P   P  PG+ ++ D S  S  L W  PE DGG+ +  Y +E + K    W              + V    +      GL  G EY FR+KA N+ G S P      V+AK   ++P    P      ++ G   + +I   G P P ++W ++G      + R+++E  +        +T+L + ++N+  D G YTI      GT      + VL+ P  P   +  DE+ A+ + +SW  P   GG  I++Y+++  D     W + +     T   V  LK G  YQF + A N+ G+S P  + +P+  + P+K P  P  P +       + ++W +P +DGG  +  Y +++K+K    +  L       +  I + + +  GL EG  Y+F++ A N  G   PS
Sbjct: 25808 VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLTVKEVKKDSVLLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCGK--TSFKVENLTEGAIYYFRVMAENEFGVGVPVE-TVDAVKAAEP---PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW--------------STVAESKVCSAVITGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKLP-FNTYTVQAGEDLKIEIPVIGRPRPEISWVKDGE-PFKQTTRVNVEETA-------TSTILHIKESNKD-DFGKYTITATNSAGTATENLSIIVLEKPGPPTGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWQMVSATVARTTIKVTKLKTGTEYQFRIFAENRYGKSAPLDS-KPVVVQYPFKEPGPPGTPFVTSISKDQMIVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLN------KIPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPS 26330          

HSP 30 Score: 214.927 bits (546), Expect = 1.291e-54
Identity = 188/633 (29.70%), Postives = 284/633 (44.87%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY-------NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA-TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P PP    VT I++N+  V  + P  DGG+ I  Y +E  +++    + ++   AD K     +V  L   + Y FR  A N  GLS+P   S   I    P   P  P  P + D +  + DL W  P SDGG+PI  Y +E ++     W +   +N  ++ I+      P       GL+EGNEY FRIKA N  G   P E ++SV+AK       LH P +         I ++ G+T R      G P P +TW + G +L+ +  R+ I       +       L + +A R+ D G Y I      G  Q    VNVLD P   + L    +  E+  +SW  P D+GG+ IT+++++    +   W   + +  TK  +K  L   + Y F V A NK G      T  PI A NP   P EP+  +I D     V L+W++P  DGG P   Y ++++ K  G  D  +    S    I E    +    E + Y+FR+   N+ GES    +T+  + +     P +D   S   T+K   T   +  V+G+P PE  W K+     +TD     R +    A ++K  ++K++  D G Y + A N  G       + VLD
Sbjct: 19459 PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLK----FRVTGLYEGNTYEFRVFAENLAGLSNPSP-SSDPIKACRPIKPPGPPINPKLKDKTKETADLVWTKPLSDGGSPILGYVVECQKPGTTQWNR---INKDEL-IRQCAFRVP-------GLIEGNEYRFRIKAANIVGEGEPRELAESVIAKD-----ILHPPEVELDVTCRDVITVRVGQTIRILARVRGRPDPDITWSKEGKVLVREK-RVDI-------IQDLPRVELQIKEAVRA-DHGKYIISAKNSSGHAQGFTIVNVLDRPGPCQNLRVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDATKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLK--GSDDWERVHKGS----IKETHYMVDKCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDK---DATDLTRSPRVKIDTSADSSKFSLTKAKRSDGGKYVITATNTAGSFVAYATVNVLD 20050          

HSP 31 Score: 211.46 bits (537), Expect = 1.418e-53
Identity = 176/602 (29.24%), Postives = 271/602 (45.02%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQ--WSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ---GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL-LGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            V G    DI  S  K+GK +   + V+I     RV+L +    R   G Y I  +N+ G  +    VN++D+P P + + V++++K +C +    P D+GG+EI ++I+E        NQ  WS VA    K  + IK N L N + Y FR  A N++G+  P   +   I+  +P D P +P    + D       L W  P+ DGG+P   Y +E + K    W++   G I  T               H      VE   Y FR++  N+GG S   +T + V+ K    KP L       + +K G T R +    G+P P V W ++     L  S R+ I+  +  + +       ++TKA RS D G Y I      G+  A   VNVLD P   R L   ++ ++   + W  P DDGG  I +Y+++  +     W   +        TV  L  G+ Y F V A NK G   P  + +P+ A+  Y  P  P  P +     + +T+ W  P  DGG+ IT Y ++KK++    W    K       + I E   ++  L  G  YQFR+ A N+ G   PS  ++P + +
Sbjct: 19687 VRGRPDPDITWS--KEGKVLVREKRVDIIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGFTIVNVLDRPGPCQNLRVSNVTKENCTISWENPLDNGGSEITNFIVEY----RKPNQKGWSIVASDATK--RLIKANLLAN-NEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET---------------HYMVDKCVENQIYEFRVQTKNEGGESDWVKT-EEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSKF-------SLTKAKRS-DGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKERHSTRWVPVNK-------SAIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPSLPSRPVVAK 20246          

HSP 32 Score: 209.534 bits (532), Expect = 5.546e-53
Identity = 177/564 (31.38%), Postives = 258/564 (45.74%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQG----FDERLINVNI-MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            R  + V   K      ++I   N  G     D + + V     +P PP T  VT ISK+  +V+   P +DGG+++  Y +E  +   +S  W ++ +   +  K  K   L     Y F+  A N +G+  P ++S +  + +DP D    PGRP  +  + N+  L W  P  DGG+ IT Y +E K+   G W +    N  + E             T  GLVE   Y FR+ A N  G  S PSE++ ++ A+     P       Y   I +  G TF  +    G+P P + W ++G  L   + R+ I+   +KT    K+ + T        D G Y +KL   GGT+     V VLD P  P   L    + AE   L+W  P  DGG  I+ Y+I+  +     W   + E +     V  L PG+ Y F V+AVNK G  EP  + EP+ A NPYKPP  P  P        S+ + W +P DDGG  I  YI++K+DK G  W          C  + + +L  R+ GL+EG  Y+FR+ A N AG   PS
Sbjct: 26200 RTTIKVTKLKTGTEYQFRIFAENRYGKSAPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMIVQWHEPVNDGGSKVIGYHLEQKE--KNSILWVKLNKIPIQDTK-FKTTGLDEGLEYEFKVSAENIVGIGKPSKVS-ECFVARDPCD---PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEF------------TVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT--------DGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES-EPVIARNPYKPPGPPSPPEASAITKDSMVVTWARPVDDGGAEIEGYILEKRDKEGIRW--------TKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPS 26727          

HSP 33 Score: 208.379 bits (529), Expect = 1.115e-52
Identity = 185/665 (27.82%), Postives = 283/665 (42.56%), Query Frame = 0
Query:  586 YKIIIRNAQG-----FDERLINVNIMDKP---DPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP---KSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            ++I   N  G     F E  +  N  D P   DPP    +++I+K+   V   PP DDGG+ I  Y++E  +  + +  W++V     + P   ++IK   L     Y FR  A N+ G   P + S +    +DP   P  P  P V D + +S  L+W  P  DGG+PI  Y +E K      W +  +   L  +  E+               GL+E  EY FR+ AVNK G S PS+  D    K   + P   L       + ++ G T R  +   G P P +TW +    L    +RI +++ S      + +T L     N+  D G Y + L    G ++ T  V VLD P  P  +   EI  +   ++W  P  DGG+PI +YV++  D +   W     E   T   V  L+ G  Y F V A N+ G  +P  T + +KA     P  + K   ++     S  + W+KP  DGG  I  Y++    +   W   +K+      A+          L+EGK Y FR+ A N+ GE +PS  T   + +   + P +D           K N     +I +KG+P P  +W K    +A+   V +            L V   Q  DAG Y++  +N  G  +  L + V+
Sbjct: 21215 FRICAENKYGVGDPIFTEPAVAKNPYDPPGRCDPPV---ISNITKDHMTVSWKPPADDGGSPITGYLVEKRE--THAVNWTKV----NRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDAS-KAAYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTRFEV--------------TGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL---RERIGLDIKS-----TDFDTFLRCENVNK-YDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLK---VISVTKSSCNIGWKKPRSDGGSRIIGYVVDFLTEDNKWQRVMKSLSLQYSAK---------DLTEGKEYTFRVSAENENGEGTPSEITA--VAKDDIVAPDLDLKDIPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE----STAVNTTLVVHDCQKSDAGKYTITLKNVAGTKEGTLSIKVV 21828          

HSP 34 Score: 207.994 bits (528), Expect = 1.465e-52
Identity = 167/589 (28.35%), Postives = 280/589 (47.54%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKT-IEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVL-DVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            E  + Q+  I        + + N +R   G Y ++ +NA G  ++ I V+++D P P     +  +++ +SC +    P+DDGG+ I +Y+IE  +  S    W+ V     +  ++  V  LI    Y FR  A N +G+  P   +   ++I+DP   P++P    V + + +S  L W  P+ DGG+ I +Y +E +           ++ T      T  N     + T KGL EG+ Y +R+ AVN  G   PS  +  +  K     P L       I I+ G  F     + G+P P V+W ++ + +L D DR  I+  +  T+  EK       KA RS D+G Y + +    G+++    VNV+ D P  P  + P   DE+  +++ +SW  P DDGG+ IT+Y+I+  ++    W+     +  T   V  L  G  Y F + A N  G S+P  + + +KA + ++ P  P +P + +    S  + W KP +DGG+PIT+YI++K++     +  +  +      +      R+P L EG  Y+FR+ A N+ G   PS  +KP   +     PS
Sbjct: 18316 ERALPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNAGGERKKTIIVDVLDVPGPVGIPFQAHNLTNDSCKLTWFSPEDDGGSPITNYVIEKRE--SDRRAWTPVTYTVTR--QNATVQGLIQGKAYFFRIAAENSVGIG-PFTETPTALVIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESR-----------LIGTEKFHKVTKDNLLSRKY-TVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDDLAPPTLDLDFRDKITIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED-DRTHIKT-TPTTLALEK------IKAKRS-DSGKYCVVVENTTGSRKGFCQVNVVADRPGPP--VGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEVGKDIWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS-DSMKARDRFRVPDAPDQPIVTEVTKDSALVTWNKP-NDGGKPITNYILEKRETMSKRWARVTREPIHPYTKF-----RVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPS 18869          

HSP 35 Score: 207.223 bits (526), Expect = 2.775e-52
Identity = 168/577 (29.12%), Postives = 252/577 (43.67%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS-GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLK--PGHIYQFEVIAVNKEGESE----PCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            I+    R  L + N  R  SG Y + I+N        + V ++D P PP  I V  I+K S V+    P++DGG  +K+Y IE  + S  S  W  V     +   S KV NL     Y FR    N  G+  P E   G  I      ++P  P +  V   S +S  L W  PE DGG+ I HY +E  EK    W +  ++ ++              H    GL E +EY FR+ A N+ G S P E    VL K +   P +       + + ++ G   + DI   G+P P VT  R+G + L  + R + E+ ++      K +V T        D G Y I      GT +A   + VLD P  P   +   +I  E + L W  P  DGG+ +T+Y++   +     W   + T   + T+K +K   G  YQF + A N+ G S+     C T+     + PY  P  P  P + +   +S+T+ W +P  +GG  +  Y ++ KD+    W  A K         I     ++  +S G  Y+FR+ A N AG   PS  ++P L 
Sbjct: 27972 IDSTDSRTSLTIENANRNDSGKYTLTIQNILNAASLTLVVKVLDSPGPPANITVHDITKESAVLSWDVPENDGGAPVKNYHIEKREASKKS--WVSVTNNCNR--LSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKIT-----EKPSPPEKLGVTGVSKDSVSLTWLKPEHDGGSRIVHYIVEAVEKGQKNWVRCAVVKST--------------HHIVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPDIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDG-VPLKATMRFNTEVTAENLTINLKESVTT--------DAGRYEITAANSSGTTKAFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIVLKRETSTTVW-TEVSTTVARTTIKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTV-----KLPYTTPGPPSTPWVTNVTRESITVAWHEPVSNGGSAVIGYHLEMKDRNSILWQKANK-------LVIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLA 28503          

HSP 36 Score: 203.371 bits (516), Expect = 4.057e-51
Identity = 174/616 (28.25%), Postives = 282/616 (45.78%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS------VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY---NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGD--SDRISIELFSKK-TVYCEKNTVLTVT---------------KANRSI--DTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD--WLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            +S  KDGKEVK    + +        L V       +G Y I + N  G     INV ++  P P K I+ + ++K+SC +   PP+ DGG+ I HY++E       + + + +    G+   S  V +LI    Y FR +A N+IG        G+ I +K+P    D    P       V + ++N+  + W  P  DGG+ I  Y IE   K    W+            + + +  P++  T KGL EG EY FR++A N  G S PS  +      T+ + P +  P +    ++E+K+G     D    G P P++TW ++  +++ +    R++  +  K+  V  E+  VL +T               +   SI  D G + IK   D G  +A   V+VLD P  P     ++IR   +   W  P DDGG+ I +Y ++  D    D  W+    T +  K +V  L  G  Y F V A N+ G   PC + +P+ A++P++PP  P +P + D  + S+ ++W +P D+G  PI  Y ++K++     +  +        + ++ L+  + GL EG  Y FR+ A N AG    S  + P   R
Sbjct: 16170 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGIYTITLENKLGSATGSINVKVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLE----RREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIG-------GGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTANAMTITWKPPLYDGGSKIMGYIIEKIAKGEDKWK------------RCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRAT----PPTKAVDP-IDAPKVIMRTSLEVKRGDEIALDATISGSPYPTITWLKDEKVIIPEEIKKRVAPTVRRKRGEVQEEEPFVLPLTERLSIDNSKKGESQLRVRDSIRPDHGLFMIKAENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIIITATLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLIAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVN------RSLLNSLKTNVEGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAR 16749          

HSP 37 Score: 202.216 bits (513), Expect = 1.017e-50
Identity = 171/609 (28.08%), Postives = 266/609 (43.68%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYK---EKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN---IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            IN    R  + V +  +    S+++   N  G  + L +  I+ +     P  P   EV ++S N+  ++   P  DGG+++  Y +E  +   ++  W +    + K P    + KV  L+    Y+FR  A N  G+S   E S + ++ ++P D    PGRP V D + ++  L W+ P  DGG+ +  Y IE K   E   G W +      SD               T   L EG+ Y FR+ A N  G  S  SE++  V  +  Y  P            + I+ G     D   GG+P P + W + G   L   +++S++       Y  K     +   +RS D+G YT+ +    GT+  +  V VLD P     L    I  E   L+W+ P +DGG  IT Y+++  +    +W+    E       V  L   + Y F V AVNK G   P  + EPI A N +  PS+P  P  V    + + ++W KP  DGG  I +Y++ K++K    +  +  D    + R+     ++ GL EG  YQFR+ AVN AG S PS  +    CR  + TP          T K + +  W
Sbjct: 30532 INSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKE--RNTILWVK----ENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS-RPMMAQNPVD---APGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD------------NFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDKELDLCEKVSLQ-------YTGKRATAVIKFCDRS-DSGKYTLTVKNASGTKSVSVLVKVLDSPGPCGKLTVSRITEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEAECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEIKNYLVDKREKKSLRWTRVNKDYVIYDTRL-----KVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFIACREPSYTPGPPSAPRVVDTTKYSISLAW 31103          

HSP 38 Score: 200.29 bits (508), Expect = 4.072e-50
Identity = 177/648 (27.31%), Postives = 284/648 (43.83%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIG---LSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-------YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            E ++  N    P PP   EVT I+KNS  V  S P  DGG+E+  Y +E  D    S  W +V +   +  +  KV  L     Y++R  A N  G    S+P +         DP D P  P +  V D + +S  L W+ P  DGG+ +T Y +  +        QGE    + +  K +V     V      L  G  Y F++ A+N  G   P E ++ V AK       L +P I        ++  K G   +  I F G P P+VTW R     LG   R +I+         + +++L + +  R+ DTG Y + +    G  + +T  V VLD P   + L    +    + L W  P  DGG+PI +YVI+  D     W   + +   T   +  L     + F V+A N+ G  EPC T EP+KA    + P+  ++ ++ D    SVTL W KP  DGG  IT Y++++K K G    +      +CE  + +L+       E    +FR+ A N  G S P     P   +   +TP +D      +   +++      ++  KG+P P  +W K+G+ +  ++ V  ++ E +      L +   +  + G Y+++ +N   +    + +I L
Sbjct: 28796 EPVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPVADGGSEVSGYYLEKRD--KKSLGWFKVLKETIRDTRE-KVTGLTENSDYQYRVCAVNAAGQGPFSEPSDFYKA----ADPIDPPGPPAKIRVADSTKSSITLGWSKPVYDGGSAVTGYVVAMR--------QGEEEEWTVVSTKGEVRTTEYV---VSNLKPGVNYYFQVSAINCAGQGEPIEMTEPVQAKD-----ILEEPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDEKNLGSDARYNIQ-------NTDSSSLLIIPQVTRN-DTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLFWDPPLIDGGSPIINYVIEKRDATKRTWSSVSHKCTSTSFKITDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA---EVPAPIRDLSMKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGK-GEQMWSHAGISKTCEIEVGQLK-------EQSLLEFRVFAKNDKGLSDP-VTIGPITVKELVITPDVDLSDIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENK----ITLSIKNVKKENGGKYTVILDNAVCRTSIPITIITL 29395          

HSP 39 Score: 197.593 bits (501), Expect = 2.514e-49
Identity = 160/586 (27.30%), Postives = 256/586 (43.69%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI-KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI 1158
            R  +G Y I   N  G     + V + D P P  +++V  +S++S  +    P  DGG  + +YIIE  + +  + +         K  K++ +++ L+    Y FR    N  G+ +P E S   ++ + P      P +  V+D + ++  LAW  P  DGG+ +T Y +E        W +   L  + +E             T   L EG +Y+FR++A N+ G S P E   +V  +   + P +    +    I +  GR     I   G P P+ +W   GS L  +S+R+++E  +K      + T +         DTG YT++L    GT   T  V +LD P  P   +  DEI A  I +SW  P  DGG P++ YV++  D     WL   E+  T+ T K   L  G+ Y F V A N+ G     ++ E I+  +    P  P+   I D     +TL W  P +DGG  +T YII++K+ +   W    K         +     R  GL EG  Y+ R+ A+N  G   PS  +KP +       P   +    + T + + +  W +
Sbjct: 31250 RYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFK-----TVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPL----VPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACRAGTERWMKVVTLKPTVLE------------HTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVRDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR-ESERVTVETHTKVAKLTIRETTIR--------DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESV-TRQTFKFTRLTEGNEYVFRVAATNRFGIGSYLQS-EVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPENDGGSQVTGYIIERKEVRADRWVRVNKVP-------VTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSV 31796          

HSP 40 Score: 197.208 bits (500), Expect = 2.955e-49
Identity = 164/541 (30.31%), Postives = 247/541 (45.66%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI---KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-----LAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEP-IKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            P PP+T+++  +S++   +   PP++DGG+++  YIIE  +V +  ++W +V     K P ++   +   LI    Y  R  A N  G   P   S + I+  DP   P KP  P V D +  S  LAW++PE +GG+ +T Y IE ++     W +    NT+  +I+           T   L +G EY FR+ A N GG   P+E   +V     L    Y     +Q GI+   +++G   R  I   G+P P   W + G  +   S R  I          E +T L + +A+R  D+G Y + L    G +     V V+  P  P   L  D+I+A  + +SW  P DDGG  I  Y+++  ++    W       + T   VKGLK    Y F V A N+ G S+  ++ EP I       P      P ++D    SV+L W +P DDGG  +T Y I++K+     W    KT       +I      + GL     YQFRIIA N  G S  S  ++P +C+     PS
Sbjct: 31673 PGPPETLQIFDVSRDGMTLTWYPPENDGGSQVTGYIIERKEVRA--DRWVRV----NKVPVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPS-KPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK---CNTTPTKIR---------EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF---VRQGGVIRLTIPIKGKPFPICKWTKEGQDV---SKRAMI-------ATSETHTELVIKEADRD-DSGTYDLVLENKCGKKTVYIKVRVIGNPNPPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVSKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKSLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKT-------QITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPS 32173          

HSP 41 Score: 196.823 bits (499), Expect = 3.979e-49
Identity = 166/577 (28.77%), Postives = 268/577 (46.45%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS---GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRY---LKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN--GDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            V I   G + +L + N  R+  G Y I   N+ G       V + D P P   ++    ++  C++  S P DDGG+EI  +IIE  D  +  + W Q  + +        +  L+    Y FR  A N+ G   P EI      D ++K P   P  P R +  + + ++  L W  P S+GG+PI  Y IE +             +  D E + +    P      + L E   Y FR+KAVN+ G S PS   + V+        +K  L   G   I++K G          G P P + W +N +++   +D  ++++  ++    E  T L + KA R  D G YT+      G+     +V V D P  PR L   +I+AE   L+W  P D+GG+ IT Y+I   D      +W     T  + +  V  L P   Y+F V AVNK G S+ C++ + +  ++P++PP  P +P +++    S+ + W  P D+GG PIT Y ++K+++ G ++  +     + +  +  +E  +P L+EG  YQFR +A+N AG   PS  + P + 
Sbjct: 16902 VVIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKD--AKMHTWRQPIETERS---KCDITGLLEGQEYMFRVIAKNKFGCGPPVEIGPILAVDPLVKGP---PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRH-----------DKPDFE-RVNKRLCPTTSFLVEDLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG-DTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTD--ALKITKEEVSRSEAKTELIIPKAVRE-DKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVEKRYGVWKLIPNGQYEFRVRAVNKYGISDECKS-DKVVIQDPFRPPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPIT-KVGLKGVEFNVPRLTEGVKYQFRAMAINAAGVGPPSEPSDPAVA 17452          

HSP 42 Score: 194.897 bits (494), Expect = 1.525e-48
Identity = 193/647 (29.83%), Postives = 282/647 (43.59%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS-----VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF-LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWE-RNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPY--KPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIAS-TDEVLITREEY-QGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            LI  +  + PD P    V  ++ NS +VK + P D+G + I  Y +E  +V+S+   WS+V ++     K+  V  L+    Y FR  A N  G   P + S       DP    D    P      V D SS + DL W  P  +GG  I  Y ++ +      W +        I+++           T K + EG +Y  R+ AVN  G   P ET    +A+ +      L       I+I  G+T R      G P P+  W    G L   D DR+ IE    K+    KN +          D G Y I      G++ A   V V DVP     L P     +   L+W+ P DDGG+ IT ++I+  D     W   +ET+ +K  + GL  G  Y F VIA NK G   P   + PI A +P    PP+ P+     +    ++TL W++P  +GG PI  YII+K+      F+ +        + + E       L E + Y+FR+ AVN+ GES PS      + +   + P+I  + S    TIKV       I   V G P P+  W KN   I   TD + IT+EE  +  A  +L + K+   D GTY++ A NR G    ++ + V D
Sbjct: 16646 LIAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNST--HWSRVNRSLLNSLKT-NVEGLLEGLTYVFRVCAENAAG---PGKFSPPS----DPKTARDPISPPGPPVPRVTDTSSTTIDLEWEPPAFNGGGEIVGYYVDKQLVGTNEWSR---CTEKMIKVR---------QYTVKEIREGADYKLRVSAVNAAGEGPPGETGPVTVAEPQEPPTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGEL---DKDRVVIENVGTKSELIIKNALRK--------DHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYMFRVIAKNKFGCGPPVE-IGPILAVDPLVKGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE------DLDEHQMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKITKEEVSRSEAKTELIIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYD 17250          

HSP 43 Score: 192.586 bits (488), Expect = 8.705e-48
Identity = 169/595 (28.40%), Postives = 256/595 (43.03%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRN--AQGF---DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNT---VLTVTKANRSIDTGHYTIK---LLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI 1148
            R  L V   K      ++I   N   Q F    E ++      +P PP T  VT ISK++ VV+   P ++GG+ +  Y +E  +   +S  W++V +      +  K  NL     Y FR  A N +G+    + S +  + +DP D    PG P  +    N   L W  PE DGG+ IT Y IE ++   G W +    N  + +             T  GL E   Y FR+ A N  G  S PS+++  + A+     P +     +   I +  G TFR +    G+P P++ W R G   + +S R  I           KNT    L + K    ID G Y ++   +    G  Q TG                  + +E  +L+W+ P  DGG+ I+ YV++  +     W + A E       +  L  G+ Y F ++AVNK G  EP  +  P+  +NP+ PP  PK   + +    S+T+ W +P  DGG  I  YI++K+D+ G  W    K        RI +L  R+ GL+E   Y+FR+ A N AG   PS    P    +K   P    G  ++  I
Sbjct: 25134 RTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPIVAQYPYKEPGPPGTPFVTAISKDAMVVQWHEPINNGGSPVIGYHLERKE--RNSILWTKVNKTIIHDTQ-FKALNLEEGIEYEFRVYAENIVGVGKASKNS-ECYVARDPCD---PPGTPEAIMVKRNEITLQWTKPEYDGGSMITGYIIEKRDLPEGRWMKASFTNVIETQF------------TVSGLTEDQRYEFRVIAKNAAGVISKPSDSTGPITARDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR-GDKEIEESARCEI-----------KNTDFKALLIVKDAIRIDGGQYILRASNVAAPEGPVQVTG------------------VTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKITKLLEGNEYIFRIMAVNKYGVGEPLESA-PVLMKNPFVPPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCSK-------RRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS----PATVYYKACDPIFKPGPPTNAHI 25667          

HSP 44 Score: 190.274 bits (482), Expect = 4.263e-47
Identity = 164/583 (28.13%), Postives = 268/583 (45.97%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPK--REKSGSYKIIIRNAQGFDER-LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPG---RPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDV--PEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            E  +G D   N         +I P+  R  +G Y + I N  G  +   ++V ++D P   + ++V H+S+ +  +   PP  DGG+ I +Y+IE  D  ++   WS V+        S K+ +L  K  + FR  A N IG+ +P E +       +P    + P      S+ D +  S  L+W  P+ DGG+ IT Y +E K K   +W    I  T +IE+                L E +   FR+ A N  G S P  T   +  K   + P +    I    + ++ G     ++ + G+P PS++W ++G L L +S+ +    FSK      +N +    K  +  + G YT+ L  D    + +  + ++ +  P KP+  +  DEI+A+ + +SW  P DDGG  IT Y I+  +    +W +       T   V  L     YQF V A N+ G S+P  +   I A++ ++ P  P +P + +  +  ++L W  P  DGG  +T + ++KK++    +  + T      + I   E R  GL EG  YQFR+ A N AG SSPS  +K
Sbjct: 29050 EKNLGSDARYNIQNTDSSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLFWDPPLIDGGSPIINYVIEKRD--ATKRTWSSVSHKCTS--TSFKITDLSEKTPFFFRVLAENEIGIGEPCETT-------EPVKAAEVPAPIRDLSMKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGKGEQMWSHAGISKTCEIEVGQ--------------LKEQSLLEFRVFAKNDKGLSDPV-TIGPITVKELVITPDVDLSDIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDG-LPLKESEYVR---FSKT-----ENKITLSIKNVKKENGGKYTVIL--DNAVCRTSIPITIITLGPPSKPKGPIRFDEIKADSVIMSWDVPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVS-NTIVAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNT------SPISGREYRATGLMEGLDYQFRVYAENSAGLSSPSDPSK 29588          

HSP 45 Score: 190.274 bits (482), Expect = 4.884e-47
Identity = 167/605 (27.60%), Postives = 265/605 (43.80%), Query Frame = 0
Query:  586 YKIIIRNAQG------FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS------LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK----KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKN 1173
            +++   NA G       ++ ++  +    P PP  + V  ++K    +K  PP +DGG  I+ YIIE  +      +W +  +  G    + +V ++I     +F+ RA N  G+  P E + + + I+DP   P  P    V D       +AW  PE +GG+PI  Y +E        W +       D++ K +           +G+V   EYV R++AVN  G S PSE S++V+AK    +P +     ++I + +G      + F   P P+V+W ++G        L   +D IS  L   K+V+                D G YTI L    G+   +  V V+ +P   + +   ++      L+W  P  DGG+PI  YV++  +     ++  M  ++  + TVK L P   Y F V AVNK G  E      P+ A++P +PP  P +  + +    ++T+ W+ P  DGG  I  YII+K    +DK+    + L          +  L     GL EGK YQFR+ A N AG S PS  T P         P +     +S  +K          + G P P  TW K+
Sbjct: 15907 FRVAAENAIGQSDYCEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKE--KLGTRWVKAGKTAGPD-CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT-ELLSIEDPKGPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVE-----------EGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCQPTIDM-ETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHA---------------DAGIYTITLENKLGSATGSINVKVIGLPGPCKDIKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTANAMTITWKPPLYDGGSKIMGYIIEKIAKGEDKWKRCNEHL----------VPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVIM--RTSLEVKRGDEIALDATISGSPYPTITWLKD 16468          

HSP 46 Score: 189.119 bits (479), Expect = 1.031e-46
Identity = 160/529 (30.25%), Postives = 238/529 (44.99%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQ---ADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKG-GASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            P PP T +V H +K++ +V    P +DGG+++  Y +E  +   SS  WS+  +   AD +    +KV+ L     Y +R  A N  G+    + S + +  +DP D    PG+P V + +  S  L W+ P  DGGA IT Y IE +E   G W +    N  +             +     L E   Y FR+ A N     S PSE++  +  K     P +     +   I +K G   + +    G P P ++W ++G  +    +R   E+ S      + NTVLTV    R  DTG Y + L    GT+       VLD P  P   L    + AE  +LSW  P ++GG  I  Y+++  +     W +   E + T   V  L  G+ Y F V  VNK G  E   +   +KA NP+  PS P    I     + +TL W +P  DGG  I+ YII++++K    W    K         + +L  +  GL EG  Y++R+ A N AG S PS ET P +
Sbjct: 27326 PGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKE--RSSILWSKANKILIADTQ----MKVSGLDEGLMYEYRVYAENIAGIGKCSK-SCEPVPARDPCD---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTNVQE------------TYFEVTELTEDQRYEFRVFAKNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEI---EERARTEIVS-----TDYNTVLTVKDCVRR-DTGQYILTLKNVAGTRSMAVNCKVLDKPGPPAGPLEISGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGESLESTA-VKALNPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKP-------VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLI 27814          

HSP 47 Score: 182.185 bits (461), Expect = 1.381e-44
Identity = 149/522 (28.54%), Postives = 232/522 (44.44%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTV----LTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVL--DVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD--TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE 1117
            P PP T  VT++++ S  V    P  +GG+ +  Y +E  D   +S  W +  +   +     KV  +     Y FR  A N  G+  P   S   + I    D  + P    + D S NS  L+W  P  DGG+ IT Y +E ++   G W +    N  + +                GL + ++Y FR+ A N  G  S PSE    +     Y  P +  P  Y   ++ + G + +      G+P P++ W ++   L  ++            + C +NT     + +  ANR +++G Y +KL    G+  AT  V +L  D P  P   +    + AE I L W  P DDGG  IT Y+++  +     W    E  +     T K +K G+ Y F V AVNK G  +P  + EP+ A+N +  P  P  P +      S+T+ W +P  DGG  ++ Y ++K+DK   GWF  LK         I +   ++ GL+E   YQ+R+ AVN AG+
Sbjct: 28409 PGPPSTPWVTNVTRESITVAWHEPVSNGGSAVIGYHLEMKD--RNSILWQKANKLVIRT-THFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAI----DACEPPRNVRITDISKNSVSLSWLQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQF------------IVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNA------------LVCIENTTDLASVLIKDANR-LNSGSYELKLRNAMGSASATIRVQILVTDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSENLEECIIKTTKIIK-GNEYVFRVRAVNKYGIGDPLES-EPVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPVADGGSEVSGYYLEKRDKKSLGWFKVLK-------ETIRDTREKVTGLTENSDYQYRVCAVNAAGQ 28889          

HSP 48 Score: 181.8 bits (460), Expect = 1.555e-44
Identity = 159/566 (28.09%), Postives = 259/566 (45.76%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD-VPEK---PRXLN----PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV--KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            ++  +G YK+ + N  G  + +++V I DKPD P   + +  + KNS V+   PP DDGG+ I +Y++E  +    + +W  V+ A      + ++ NL     Y FR  A N  G+S+P E++   +IIK P+++P  PG+P++   + +SC +AW  P SDGGA I +Y +E +EK    W     +  +  EI+  V        + + L+EG EY FR+K  N GG S  SE S+    K+       H +  + N+ ++            G P P V W R G  ++ D  +  I+ F  K  Y  +  + +VT  + ++    Y ++    GG+   T  + V D VP K   P+ L        +R E +++    P      P+ ++      IDN      + T+   + V   G++      + V A N+ G  +    L+     +P      P+   + D    SV L W +P+ DGG  IT+YII+K       W           +AR  E    +  L     YQFR+IA NK G S PS  ++P + + 
Sbjct: 32434 RKTHAGKYKVQLSNIFGTVDSILDVEIQDKPDKPTGPLVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGA-EWQLVSSAISV--TTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASV-VIIKSPFEKPGAPGKPTITALTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKW-----IAVTTEEIRETV-------FSVQNLIEGLEYEFRVKCENLGGESEWSEISEPATPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF--KGGY-HQLIIASVTDDDATV----YQVRATNQGGSVSGTASLEVEDTVPAKIHLPKTLEGMGAVHALRGEVVSIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP------PRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIIEKCATTAERWLRV-------GQAR--ETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 32959          

HSP 49 Score: 179.489 bits (454), Expect = 8.481e-44
Identity = 165/594 (27.78%), Postives = 259/594 (43.60%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLH-QPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS---IDKGSSSSKT 1147
            R    V N  ++    +++   N  G  + L++  I+ K     P PP    V +++ +   +    P  DGG+E+  + +E  +   +S  W +V  +   G +  +   L+    Y+FR  A N  GLS P + S   + +       D PG P  +D +  +  L W  P  DGG+ I  Y IE ++ S   W +    + S+ +             T  GL  G+ Y FRI A N  G  S PS++S  ++ +   + P +   P  ++ I IK G + R      G P P VTW R+G  +     ++++E+          +T L V  A R    G Y ++     G+ +A   V V D P K   + P     I  E + L W  P +DG  PIT Y+I+  +     W L     +    T   L  G+ YQF V AVNK G   P  + +P+ A+  Y  P  P  P   +    S+TL W +P  DGG  I  YI+++++K    W   +       +  I E   ++ GL EG  Y+F ++A N AG   PS  ++   CR     PS   + K + +SKT
Sbjct: 29454 RTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSNTIVAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE--RNSILWQRVNTSPISG-REYRATGLMEGLDYQFRVYAENSAGLSSPSDPSKFTLAV----SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGS-DRWVRCNFTDVSECQY------------TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPTVEFGPEYFDGIIIKSGESLRIKALVQGRPVPRVTWFRDGVEI---EKKMNMEITD-----VLGSTSLFVRDATRE-HRGVYRVEAKNASGSSKAEITVKVQDTPGK--VVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDNCQAHSYTATKLITGNEYQFRVSAVNKFGVGRPLDS-DPVVAQIQYTIPDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERREKKSTRWVKVI------SKRPISETRFKVTGLIEGNEYEFHVMAENAAGIGPPSGISRLIKCREPVSPPSAPTVVKVTDTSKT 30009          

HSP 50 Score: 164.466 bits (415), Expect = 3.627e-39
Identity = 178/695 (25.61%), Postives = 283/695 (40.72%), Query Frame = 0
Query:  563 NINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFD---ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGR--PSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIK---TDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKL-------LCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET----KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQ-IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             +     +    V N +  KS  +++   N  G     E    V   + P P   ++V  ++K+SC +    P  DGG+ I  Y++   D  +  N+W +V ++           +L     Y FR  A N  G   P EI+    + KD    PD   +  P +   +  + +    +P     AP               W++GE    +D  +    T VN   +VH   K   +  +Y   +K V        + T +  L+        + +PGI    IK        I     P          + +L   D ++      K V C      T  +  R  +   YT ++       + +G         +  DVP+ P   N  E+R + ++L+W  P   GG+PIT Y I+  + ++  W  A +T    KD K T  GL  G  Y+F V+A+N  G  +P    EP+ A +P  PP +P+   +++    SVTL W +P  DGG  +T YI++K+D     W  A   +   C   + +L        EG  Y+FRI A N AG  S+PS  T   +C+ +   P+I  D       TIK   T +   I + G+P P+ +W + G  I  +D V I+        T K    K    DAG Y++ A N  G  +  + + VLD+
Sbjct: 21590 TVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVISVTKSSCNIGWKKPRSDGGSRIIGYVV---DFLTEDNKWQRVMKSLSL---QYSAKDLTEGKEYTFRVSAENENGEGTPSEITA---VAKDDIVAPDLDLKDIPDLCYLAKENSNFRLKIPIKGKPAPSVS------------WKKGEDPLATDTRVSVESTAVNTTLVVHDCQKS--DAGKYTITLKNV--------AGTKEGTLSIK-----VVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVN-----NKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSDPVVAKHPFDVPDAPPPPNIVEVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLMWKRANKTPIRMKDFKVT--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPE---VINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWTKANHVNVPDCAFTVTDL-------VEGGKYEFRIRAKNTAGAISAPSESTGTVICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAISIHGKPLPKSSWSRAGKDIRPSDIVQISSTPTSSMLTVKYATRK----DAGEYTITATNPFGTKEEHVKVTVLDV 22227          

HSP 51 Score: 159.844 bits (403), Expect = 8.505e-38
Identity = 179/670 (26.72%), Postives = 281/670 (41.94%), Query Frame = 0
Query:  586 YKIIIRNAQGFDER------LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK----GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNG-DW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--------KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLM 1234
            ++II +N  G  E       ++  +  DKP  P  +E+  ISK+S  ++   P+ DGG EI  Y +E     S  + W + +  D    +   +  L+    Y FR  A N  GLS P   +   + I+      + PG    +   +     A  L     G P+   +I++      L Q  +   +SD    T          T     + +E V+   A N+ G     ETS  +L +     P  H PG Y ++ K     G T R  + + G P PS+TW   G  LL +S+ I+IE         E  T L +    R    G Y ++L    GT  +   V + D P+KP   L  + +    + +SW  P DDGG+ IT+YV++  +   G +W L +     T   +  L     Y F V A N  G SEP      +  ++P++ P  P +P I      S  + W+ P+ DGG  I +Y ++K++K    + A+ T++      I E    +  L EG  Y+FR+   N  GES  S  ++P        TP  D        K    +  ++    A    KV G P P   WY+ G +I + D +    +E++GG   +L ++     DA  Y + A N+ G       L V D +
Sbjct: 32143 FRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEY--RQSGDSAWKK-SNKDRIKDRQFTIGGLLESTEYEFRVFAENETGLSRPRRTA---MSIRTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLP--DIKWYRFGKELVQSRKYKMSSDGRTHT---------LTVMTEEQEDEGVYTCIATNEVGEV---ETSSKLLLQA---TPQFH-PG-YPLKEKYYGAVGSTLRLHVMYIGRPVPSITW-FYGQKLLQNSENITIE-------NTEHYTHLVMKNVQRKTHAGKYKVQLSNIFGTVDSILDVEIQDKPDKPTGPLVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASVVIIKSPFEKPGAPGKPTITALTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTEE------IRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPA-------TPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGY-HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEDTV 32764          

HSP 52 Score: 150.984 bits (380), Expect = 4.655e-35
Identity = 150/588 (25.51%), Postives = 256/588 (43.54%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGT------QQATGYVNVLDVPEKPRXLNPDEIR-------AEHINLSWATPHDDGG--TPITSYVIKMMDIDNGDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEP---CRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            KDG+ +K    VN++       L++    RE  G+Y++ + N+ G     I V ++DKP PP  + +  +S ++  +  +PP+ DGG +I +YI+E  + +S++  W  V+QA  +   SIK+  L     Y+FR  A NR G S   E     ++ + P+  P  PG P V+  + ++  ++W +P +DGG+ +  Y +EYKE+S  LW +   +  +D ++K              GL EG  Y +R+ A N  G    S++ + V A+     P   QP + NI  +K  + ++    + GG        ER     L D   +     + +  Y E   V  +T+  R      Y  ++             ++TG + V D  E PR +   + R        E + ++     D  G   P+ S+    ++I+       + T  +T  TVK        Q+ +   N  G       C+ L     + P  PP+ P E  I     +  +L W  P ++GG  I +YI++K++     W          CE  +     ++  L +G  Y FR+  VNK G
Sbjct: 27169 KDGQILKETTRVNVSSSKTVTSLSIKEASREDVGTYELCVSNSAGAITVPITVIVLDKPGPPGPVHIDEVSCDNVTISWNPPEYDGGCQISNYIVEKRETTSTT--WHVVSQAVAR--TSIKIVRLTTGSEYQFRVCAENRFGRSSYSE--SAPVVAEYPFSPPGPPGTPKVVHATKSTMIVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIADTQMKVS------------GLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPP--GQPEVTNI-TRKSVSLKWSKPHYDGGAKITGYIIERRE---LPDGRWLKCNFTNVQETYFE---VTELTEDQR------YEFRVFAKNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKIN----ADIAGRPLPVISWAKDGVEIEERARTEIVSTDYNTVLTVKDCVRRDTGQYILTLKNVAGTRSMAVNCKVL-----DKP-GPPAGPLE--ISGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLAW--------TICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYG 27703          

HSP 53 Score: 150.214 bits (378), Expect = 7.042e-35
Identity = 161/625 (25.76%), Postives = 272/625 (43.52%), Query Frame = 0
Query:  515 LGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVI--NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPD-PPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD------GGTQQATGYVNVLDVPEKPR-XLNPD-----EIRA-EHINLSWATPHDDGGTPI--TSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            L D   +  +A ++ N+ +   ++G     +    +K G++  +  D  ++     V+  ++  + ++  +G Y I ++N  G  E  +++ ++ KP  P   I+   ++  +  +K  PP DDGG+EI +YI+E  D  S +N+W   A A  K   + +V  L     Y FR  A N+ G+ +   +    ++ K P+D PD P  P++++   +S  L W  P   GG+PIT Y IE+KE++  +W++    N + I +K              GL EG EY FR+ A+N  G   PS  S+ V+A    L P +  PG   + I   R     IW   EP      +  G ++  +   +  + ++K       +   TVT     ++ G Y  ++             ++TG V   D  E P   L+P       I+A + I LS  + H   G P+  +S+     DI   D +    T  +   TVK        ++ + A N  G  E     E +K       P  P    I +   +  TL W  P +DGG PI  Y+++K++     +  +  D  SC     +       L +G  Y FR+ AVN+ G+  P
Sbjct: 21739 LKDIPDLCYLAKENSNFRLKIPIKGKPAPSVS---WKKGED-PLATDTRVSVESTAVNTTLVVHDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRD--SVNNKWVTCASAVQK--TTFRVTRLHEGMEYTFRVSAENKYGVGE--GLKSDPVVAKHPFDVPDAPPPPNIVEVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLMWKRA---NKTPIRMK---------DFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVA----LDP-IDPPGKPEV-INVTRNSVTLIW--TEPKYDGGHKLTGYIV--EKRDLPSKSWTKANHVNVPDCAFTVTDL---VEGGKYEFRIRAKNTAGAISAPSESTGTVICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLSAISIH---GKPLPKSSWSRAGKDIRPSDIVQISSTPTSSMLTVKYATRKDAGEYTITATNPFGTKE-----EHVKV-TVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATK-------LIQGNEYVFRVSAVNQYGKGEP 22312          

HSP 54 Score: 142.895 bits (359), Expect = 1.155e-32
Identity = 89/285 (31.23%), Postives = 142/285 (49.82%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG 833
            K+G  +K  + + +    +   L + +  R+ SG Y I   N+ G     I + ++DKP PP ++++  +  +  ++   PP +DGG+EI +YII+  +  +S   W+QV+        S  V  LI  H Y+FR  A N+ G+ DP  I  +  + K+P+D P +   P + + + +   ++W  P  DGG+PIT Y +E +E     W              T VN KP++  T K  GL EG EY FR+ A+NK G   PS+ S     K  Y +  L+ PG
Sbjct: 21086 KEGTLLKPSEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRE--TSRPNWAQVSATVPI--TSCSVEKLIEGHEYQFRICAENKYGVGDP--IFTEPAVAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNW--------------TKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDAS-----KAAYAQDPLYPPG 21345          

HSP 55 Score: 140.198 bits (352), Expect = 9.292e-32
Identity = 118/423 (27.90%), Postives = 189/423 (44.68%), Query Frame = 0
Query:  715 DKPGRPSVLDWS---SNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTW----ERNGSLLLGD-SDRISIELFSKKTVYCEKNTVLTVTKANRSI-DTGHYTIKLLCD-----GGTQQATGYVNV---LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGES 1118
            DKPG P+  D +   + SC L W  P  DGG+ IT+Y +E +     +W +   L+++      D N K         L    EY+FR+ A N  G   P + S  + AK ++  P              G   R +     + A ++TW    +  GS + G   +R+  +  + K V C K  V   T   + + +   Y  ++L +     G   ++T  + +   +D P  P      ++    + L+W  P  DGG  I SY+I+M+     DW+   E    T+  + GL  G  Y F V AVNK GESEP    +P+       PPS P+   +++    +  L+W  P  DGG PIT+YI++K+D +  GW         + +  + + +  +  L+EG  Y FR+ A N  G+S
Sbjct: 15534 DKPGPPAAFDVTEVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK---LSST----VKDTNYK------ATKLTPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP--------------GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPD--TDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDVGKTSLMLNWTKPEHDGGAKIESYIIEMLKTGTEDWVRVAEGVPTTQHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW--------QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQS 15918          

HSP 56 Score: 139.043 bits (349), Expect = 1.969e-31
Identity = 88/278 (31.65%), Postives = 137/278 (49.28%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KDGKE++    + I        L   +  R  SG+Y +   N  GF + + NV ++D+P PP+  + V+ ++   CV+   PP DDGG +I+HYI++  + S  +  W+ VA         +KV  L+  + Y FR  A N+ G+ +P E   + ++  +P+  PD P  P V   + +S  + W  P+SDGG+ I +Y +E ++K+   W +      +D+  K              GL EG+EY FRI A N  G S PS TS    A     KP
Sbjct: 23252 KDGKELEGTAKLEIRIADFSTYLINKDSTRRDSGAYILTATNPGGFAKHIFNVRVLDRPGPPEGPLAVSEVTAEKCVLSWLPPLDDGGAKIEHYIVQKRETSRLA--WTNVASEVQV--TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE--SEPVLAVNPFRPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKTLTDLRYKVS------------GLTEGHEYEFRIMAENAAGISAPSSTSPFYKACDAVFKP 23511          

HSP 57 Score: 137.117 bits (344), Expect = 7.469e-31
Identity = 101/321 (31.46%), Postives = 146/321 (45.48%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRA--EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME---TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            N   +P +P    P+E+ A  EHI + W  P  DGG  I +Y++   +  +  W    +     DT+  V GL  G  YQF V AVN  G SEP      I    P   P  P  P +VD    S++L W KP  DGG  IT Y+++ ++K    W+          +A I   E  +P L  G+ Y FR+ AVN  G S  S  T       +   P ++      KT+ +   A  +  + V G PPP  TW K GI +A+   ++ T + Y     + L V K    DAG Y++ AEN++G+    + + V D    C
Sbjct: 30976 NSFTIPSQPGI--PEEVGAGKEHIIIQWTKPESDGGNEIKNYLVDKREKKSLRWTRVNKDYVIYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFIACREPSYTPGPPSAPRVVDTTKYSISLAWTKPLYDGGTDITGYVLEMREKDTDQWY------RVHTKATIRNNEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWTKKGIDLAN-RAIIDTTDSY-----SLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPC 31282          

HSP 58 Score: 136.346 bits (342), Expect = 1.139e-30
Identity = 96/306 (31.37%), Postives = 138/306 (45.10%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ-KKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKN--------GIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  +H+ +SW  P DDGG+PIT Y+++  +    +W         + T+K  GL+ G  Y+F V A+NK G  +P    +   A++P  PP  P  P + D    SV+L W KP+ DGG PI  Y+++ K+     W         +   ++ +    + GL E   YQFR+ AVNK G S PS     H C    L P    +D     +  ++   T    + VKG PPP+ TW K         G+ I STD     R E                 DAG Y L  EN  G+ +  + + VLD
Sbjct: 21254 ITKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWV------RCNLPQKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKH-CPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCE------------NVNKYDAGKYILTLENSCGKKEYTIVVKVLD 21540          

HSP 59 Score: 136.346 bits (342), Expect = 1.168e-30
Identity = 162/656 (24.70%), Postives = 271/656 (41.31%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ----GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG-IYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDG--GTQQATGYVNVL-----DVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF------GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNL-TPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++ +N +D+P  P+ + +    K    +K   PD DGG+    Y +E       S+ W +V +   K    + V+  +    Y FR +  N  G SD   +  +++++K+   +P       VLD       L+  L    G        +  K     LW +     ++  +  ++I T  +         K   +G +YV  I A N  G+ +   T +            L +PG + N++I    + R  I +           +N  L   +S R+    +S        N +   T   R I+   Y  ++  +   GT   T    V+     D P +P      ++  E + + W  P  DGG  IT Y ++  +  +  W+   ++   + +  V+ L PGH YQF V A N+ G  EP     P+ A++P +PP  P    +VD    S+TL W KP  DGG PI  Y+++ + K        GW         +  A++  +E  +  L E + Y+FR+ A N+AG   P+ E K  +   + L  P ID  +S  K + V      ++   V+G P P+ TW + GI     D V+   +       A L +  S   D+G YSL   N  G+    +++ VLD
Sbjct: 19847 ILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVER--RLKGSDDWERVHKGSIKETHYM-VDKCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKEDLQKP-------VLD-----LKLSGVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSKFSLTKAK-RSDGGKYV--ITATNTAGSFVAYATVN-----------VLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSA-------NVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKERHSTRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKREDTSPDEGW------KRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQAGIGRPA-ELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRRVGI-----DNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD 20452          

HSP 60 Score: 135.191 bits (339), Expect = 2.603e-30
Identity = 85/277 (30.69%), Postives = 136/277 (49.10%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            DG E+K  +   +        L + N  R  +G Y+I + NA G     +++ ++D P PP   I +  ++     +   PP DDGG+ + +YI+E  D  +  + W  V+    K    +K+ +L     Y FR RA N++G+  P  +     + K  +  P  PG+P V D + N+  ++W LP+SDGG+PIT Y +E +E + G W +      +D++ +              GL EGN Y FR+ A N  G S PS +SD + A  R +KP
Sbjct: 19302 DGTEIKTDEHYTVETDSFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQD--TRKDTWGVVSSGSSK--TKLKIPHLQKGCEYIFRVRAENKMGVGPP--LDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREIT-GKWVRVNKTPIADLKFR------------VTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKA-CRPIKP 19558          

HSP 61 Score: 132.494 bits (332), Expect = 1.766e-29
Identity = 91/275 (33.09%), Postives = 139/275 (50.55%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +S  KDG  +K  + V  +   +++ L++ N K+E  G Y +I+ NA       I +  +  P  PK  I    I  +S ++    P+DDGG EI  Y IE  + S ++  W  V  +  +   + KV NL+    Y+FR RA NR G+S P  +    I+ K  +  P  PG+P V + +S+   L W  P  DGG+ +T + +E KE++  LWQ+   +NTS I      +G+        GL+EG +Y FR+ A N  G S PS+ S   LA
Sbjct: 29336 ISWLKDGLPLKESEYVRFSKTENKITLSIKNVKKENGGKYTVILDNAVCRTSIPITIITLGPPSKPKGPIRFDEIKADSVIMSWDVPEDDGGGEITCYSIEKREASQTN--WKMVCSSVAR--TTFKVPNLVKDAEYQFRVRAENRYGVSQP--LVSNTIVAKHQFRIPGPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQR---VNTSPI------SGR---EYRATGLMEGLDYQFRVYAENSAGLSSPSDPSKFTLA 29592          

HSP 62 Score: 131.724 bits (330), Expect = 3.710e-29
Identity = 90/263 (34.22%), Postives = 128/263 (48.67%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            V+I    DR  L+V +  R  SG Y + + N  G     I V ++ +P P    IEV+ IS  SCV+  + P DDGGT+I +YI+E  +  S +  W  +  +  +    IKV +L     Y FR  + NR G+S P E     II + P+  P  P RP V   S+N+  + W  P  DGG+ +  Y +E KE++  LW +               N  P +    K  GLVEG EY FR  A+N  G S  SE S  ++A+
Sbjct: 30435 VSITTTKDRTTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISAESCVLSWAEPKDDGGTDITNYIVEKRE--SGTTAWQLINSSVKR--TQIKVTHLTKYMEYSFRVSSENRFGVSKPLE--SAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKE--------------NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQ 30677          

HSP 63 Score: 129.028 bits (323), Expect = 1.954e-28
Identity = 90/301 (29.90%), Postives = 144/301 (47.84%), Query Frame = 0
Query:  940 EIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA--TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDA----SCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLT----PSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++    ++LSW+ P DDGG+ +T Y I+  +     W+   +T+ T    TV GL P   YQF +IA N  G SE     EP+  ++P+  PS+P E  I+     SVTL+W+KP  DGG+ I           G W +  ++ D+    S + RI + +  I GL E   Y+FR+ A N+ G S P    +  +     LT    P + K      T K+   A    ++ G P P+  WY+ G ++  + +  ++ +    G T  L V   +  D G Y+ +A N  G+ +T   L++
Sbjct: 32081 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI----------LGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGGLLESTEYEFRVFAENETGLSRPR---RTAMSIRTKLTSGEAPGVRK-EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELVQSRKYKMSSD----GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 32363          

HSP 64 Score: 128.642 bits (322), Expect = 2.737e-28
Identity = 163/725 (22.48%), Postives = 277/725 (38.21%), Query Frame = 0
Query:   98 QWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEF--YFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKH-RYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV 818
            +WF+  + +    +Y      +  T  L I  AR +++ +Y V L N  GE+       +  E   D R                    IE   D E  E K   V    +++  NV  KW  RN   +       Y ++ +K            ++LI+ +    + G++ + A  +         + +I    EF  + E + +T+          F+C L+   AN++W RNG  +    +Y+    G    L++    LDD         EY    ED  +  +L VE    EI            +R   D   + E    +        VF  ++      V +  N  ++V G   +M    M +GK H+L +  I   D G+             +    +  +  G++   +    P++ V   D           Y +++ E   FK+ + +       ++   ++    ++  K+   G YKI+++N  G  E  IN+ ++D P P + +EVT        +    P  DGG++I  Y++E  D+   +  W  V   D        V  L      Y FR  A NR+G  +P E +   +  +  +D P  P   ++ D +     L W  PE DGGA IT+Y IE ++K+   W     +   D+              T   +VEG EY FR++A N+ G   PS  +  V
Sbjct: 14421 KWFRNEEAIFDSSKYIILQKDLVYT--LRIRDARLDDQANYSVSLTNHRGENVKSAANLIVEE--EDLRI-------------------IEPLKDIETMEKKT--VTFWCKVNRLNVTLKW-TRNGEEVAFDNRVTYRIDKYK------------HSLIIKDCGFPDEGEYVVTAGQDKSV----AELLIIEAPTEFIEHLEDQTVTEFDDAV-----FSCQLSREKANVKWYRNGREIKEGKKYKFEKEGSTHRLIIKDCRLDDE-------CEYACGVEDRKSRARLFVEEIPVEI------------IRPPQD---ILEAPGTD-------VVFLAELNKDKVEVQWLRNNMVVVQGDKHQM----MSEGKIHRLQICNIQPRDQGEYRFIAKDKEARAKLELAAAPKIKTGDQDLVVDVGQPLTMVVPYD----------AYPKAEAEW--FKENEPL---SSKTVDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEAFINLRVIDVPGPVRNLEVTETFDGEVSLGWEEPLTDGGSKIIGYVVERRDIKRKT--W--VLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVE-TDNPVEARSKYDVPGPPLNVAITDINRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL------------SATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 15033          

HSP 65 Score: 128.642 bits (322), Expect = 3.267e-28
Identity = 83/294 (28.23%), Postives = 143/294 (48.64%), Query Frame = 0
Query:  530 NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGE--ILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            N  V   + G     + LS  +DG  +K     N     + + +N+       +G Y+I   N+ G  +  IN+ ++D+P PP   + ++ I++ S  +K  PP  DGG+++ +YI+  +   +S+  W++V+    +   +IKV  L     Y+FR +A NR G+SD   I    + +K P+  P  P  P V + +  S  +AW  P S+GG+ +  Y +E K+++  LWQ+    ++ T+  ++ T             GL+    Y FR+ A N  G   PS  S+ VLA
Sbjct: 28232 NLKVDIPISGKPLPKVTLS--RDGVPLKATMRFNTEVTAENLTINLKESVTTDAGRYEITAANSSGTTKAFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIV--LKRETSTTVWTEVSTTVAR--TTIKVMKLTTGEEYQFRIKAENRFGISD--HIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVAWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVIRTTHFKVTT----------ISAGLI----YEFRVYAENAAGIGKPSHPSEPVLA 28503          

HSP 66 Score: 125.946 bits (315), Expect = 1.871e-27
Identity = 84/275 (30.55%), Postives = 132/275 (48.00%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            K  KE+ + + V++ + G R    +    R  SG Y + ++NA G     + V ++D P P   + V+ I++  C +  S P +DGG EI HYI+E  +  +S   W  V   + + P  S  V  LI  + Y FR RA N+ G   P  +  + I+ ++ +  P +PG P  +        + W  PESDGG  I +Y ++ +EK    W              T VN   +++ T     GL+EG +Y FR+ AVN  G S PSE S+ +  +
Sbjct: 30824 KGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKSVSVLVKVLDSPGPCGKLTVSRITEEKCTLAWSLPQEDGGAEITHYIVERRE--TSRLNWVIV---EAECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVP--VESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEIKNYLVDKREKKSLRW--------------TRVNKDYVIYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFIACR 31077          

HSP 67 Score: 125.561 bits (314), Expect = 2.578e-27
Identity = 88/311 (28.30%), Postives = 143/311 (45.98%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMI---DAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VP +P+     ++  + I ++W  P  DGG+PIT Y+I+  + ++  W+ A +T  +  +    GL  G  Y F + A+NK G S P +  E + A  P  PP +P+   ++D    +V+L W +P  DGG  I  Y ++     G  +    T       +I + E  + GL E   YQFR IA      S PS  + P   + +N+ P ID   +  S  T+K          V G+P P  +W K G  +  ++ + +  +         LC  +   +   D+G Y++ AEN +G     + L VLD
Sbjct: 20846 VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSLEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE---VIDISKNTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTSPH----QIPQEEYTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIQAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLLKPSEGIKMAMQR-------NLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLD 21142          

HSP 68 Score: 124.405 bits (311), Expect = 5.645e-27
Identity = 146/590 (24.75%), Postives = 234/590 (39.66%), Query Frame = 0
Query:  548 SVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLG---DSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLL-CDGG----TQQATGYVNVLDVPEKPRXLNPDEIRAEHI------NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGES 1118
            S F  G +++  + V +  H     L +       +G Y + ++N  G     I V I+DKP PP   I++  I   S  +   PP+ DGG  +  Y++E  D       W  V+++  +  ++ K   L   + Y FR  A NR G+     +  + I  +     P  P    + D S +   L W  PE+DGG+ +T Y IE KE     W +              VN  P  M      GL+EG EY  R+ A+N  G   PS  S  ++A      P   Q P + +      RT     W       SV  +  GS + G   +  ++    ++K      K    T+T   +      Y  ++L C+ G      +  G V V ++ E P     DE   E I       +    P      PI  +  +  D+     +   ET  T+  +K         ++++  NK G+      +  I   N   PP  P E +  D   +SV + W+ P+DDGG  I  YI+++++     W+        + ++R+      + GL E   Y FR+ A N+ G S
Sbjct: 31512 SWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPG--WLPVSESVTR--QTFKFTRLTEGNEYVFRVAATNRFGIGS--YLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPENDGGSQVTGYIIERKEVRADRWVR--------------VNKVPVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDT----TRTSVSLAW-------SVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQG---AEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYP-DYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDVSKRAMIATSET-HTELVIKEADRDDSGTYDLVLENKCGKKTVYIKVRVIGNPN---PPEGPLEYD--DIQARSVRVSWRPPADDGGADILGYILERREVSKAAWY--------TIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS 32052          

HSP 69 Score: 123.635 bits (309), Expect = 9.764e-27
Identity = 155/623 (24.88%), Postives = 239/623 (38.36%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL------LGDSDRISIELFSKKTVYCEKNTVLTVT--KANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWA------------TPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS----IDKGSSSS 1145
            F+DG E++   ++ I        L V +  RE  G Y++  +NA G  +  I V + D P      I  T+I+     +    P +DG   I HYIIE  + S  +  W+ +   D     S     LI  + Y+FR  A N+ G+  P  +    ++ +  +  PD PG P   + + NS  L WA PESDGG  I  Y +E +EK    W +              ++ +P+     K  GL+EGNEY F + A N  G   PS  S  +  +     P    P +  +      T   + W   +P      E  G ++      LGD  +++ E   K        T  TVT  +A          I     G + +ATG +  +D    P        +  H+  + A            TP      P ++  I+  DI   D    +  ++      G      Y F V   N  G      T++ +    P      P      D    SVTL W  P  DGG  I HY+++K++     +  +      C  +I     ++  L+EG  Y FR+ A N+ G   P    +P +   +   P     ID   SS+
Sbjct: 29734 FRDGVEIEKKMNMEITDVLGSTSLFVRDATREHRGVYRVEAKNASGSSKAEITVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLA--WALIE--DNCQAHSYTATKLITGNEYQFRVSAVNKFGVGRP--LDSDPVVAQIQYTIPDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERREKKSTRWVKV-------------ISKRPISETRFKVTGLIEGNEYEFHVMAENAAGIGPPSGISRLIKCREPVSPP--SAPTVVKVTDTSKTTVSLE-W--SKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVK--------TRYTVTDLQAGEEYKFRVSAINGAGKGESSEATGAIKAVDRLAAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIR-ADIHTTDSFSTLTVENCNRNDAGK-----YTFTV--ENNSGSKSITFTVKVLDTPGP------PGPITFKDVTRGSVTLMWDAPILDGGARIHHYVVEKREASRRSWQVI---SEKCTRQI----LKVSDLAEGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPKRLDVIDTSKSSA 30303          

HSP 70 Score: 123.635 bits (309), Expect = 1.062e-26
Identity = 87/271 (32.10%), Postives = 137/271 (50.55%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIM--DKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSD 816
            +KD KE++    V I    D   + + +  R  SGSY++ +RNA G     I V I+  DKP PP   IE   ++     +   PP DDGG +I HYI+E  +  +S   WS V++   +    IK   +I  + Y FR RA N+ G+ DP E   + ++ K+ +  P  PG P V   + NS  + W+ P +DGG+ ++ Y +E ++ KS+G ++   +L  +  + +  V           GL E ++Y +R+ AVN  G    SE SD
Sbjct: 28646 YKDDKELQTNALVCIENTTDLASVLIKDANRLNSGSYELKLRNAMGSASATIRVQILVTDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRE--TSRVVWSMVSENLEEC--IIKTTKIIKGNEYVFRVRAVNKYGIGDPLE--SEPVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPVADGGSEVSGYYLEKRDKKSLGWFK---VLKETIRDTREKVT----------GLTENSDYQYRVCAVNAAGQGPFSEPSD 28897          

HSP 71 Score: 122.479 bits (306), Expect = 2.287e-26
Identity = 85/250 (34.00%), Postives = 122/250 (48.80%), Query Frame = 0
Query:  878 ELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDT-KATVKGLKPGHI-YQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            E  S KTV    + T   + +A +  D G Y I L    G  +A   + V+DVP   R L   E     ++L W  P  DGG+ I  YV++  DI    W+ A +  D+ + TV GL+ G + Y F V A N+ G  EP  T  P++A + Y  P  P    I D +   V+L W+ P  DGG  IT+Y+I+ +DK    +D   T       R ++L A +  + EG+ Y FR+ A N+ G   PS  T
Sbjct: 14788 EPLSSKTVDTTAEQTSFRILEAKKG-DKGRYKIVLQNKHGKAEAFINLRVIDVPGPVRNLEVTETFDGEVSLGWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVAITDINRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT------VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 15030          

HSP 72 Score: 122.094 bits (305), Expect = 2.662e-26
Identity = 89/299 (29.77%), Postives = 141/299 (47.16%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-------LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS--IDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNG-IQIASTDEVLITREEYQ---GGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            +SW  P D+GG+PIT Y ++  +     W        TK  +KG       L  G  YQF  +A+N  G   P    +P  A +P  PP  P  P + D    S++L W+ P+ DGG PI  YI++ +++  G  D  K ++   +  +   E  +P L E + Y+FR+ AVN+AGES PS  T   L       P   ID G+  S   +          +KG P P+ +W  +G  + A  D V    E+ Q      ++ + + + +   +G YS+ A+N+ GQ   +  + V+D+
Sbjct: 17371 VSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLTEGVKYQFRAMAINAAGVGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEE--GSTDWKKVNEP--DKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEILATDIQEPPEVFIDIGAQDSLVCQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAVKDGVHDVPEDAQVETAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDV 17665          

HSP 73 Score: 121.709 bits (304), Expect = 4.126e-26
Identity = 100/317 (31.55%), Postives = 142/317 (44.79%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-------KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL-CRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
              VP  P       +  + + +SW  P  DGG+PI  Y I+  + +   W        +KA V        GL  G  Y+F VIA N  G+S+P +  EP+ A +P  PP +P   NI      +VTL+W KP   GG  IT YI++K+D   G W  A  ++       I E E  + GL+E   Y+FR+IA N AG  SP  E    + CR     P I  D     +  +K       +  V G P P   W K+G ++  T ++ I   ++    +  L    S   D+G Y L A N  G  K   ++ VLD
Sbjct: 23011 FKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTV-----SKALVPGNIFKSSGLTDGIAYEFRVIAENLAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN-------ILENEFTVSGLTEDAAYEFRVIAKNAAGAVSPPSEPSDAITCRDDIEAPKIMVDVKFKDTIILKAGEAFKLEADVSGRPLPTMEWTKDGKELEGTAKLEIRIADF----STYLINKDSTRRDSGAYILTATNPGGFAKHIFNVRVLD 23308          

HSP 74 Score: 121.324 bits (303), Expect = 4.565e-26
Identity = 81/277 (29.24%), Postives = 133/277 (48.01%), Query Frame = 0
Query:  546 ELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            E+S  KDG+  K    VN+        L++    ++  G Y I   N+ G     +++ +++KP PP   +    +S +  V+   PP   GG +I +YI+E  D ++++  W  V+    +   +IKV  L     Y+FR  A NR G S P  +  + ++++ P+ EP  PG P V   S +   + W  P +DGG+ +  Y +E KEK+  LW +   +   D + KT             GL EG EY F++ A N  G   PS+ S+  +A+
Sbjct: 26081 EISWVKDGEPFKQTTRVNVEETATSTILHIKESNKDDFGKYTITATNSAGTATENLSIIVLEKPGPPTGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTT--WQMVSATVAR--TTIKVTKLKTGTEYQFRIFAENRYGKSAP--LDSKPVVVQYPFKEPGPPGTPFVTSISKDQMIVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKIPIQDTKFKTT------------GLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 26339          

HSP 75 Score: 121.324 bits (303), Expect = 4.721e-26
Identity = 86/271 (31.73%), Postives = 134/271 (49.45%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            + GK+++    V I+       L V    R+ +G Y I   N  G  E  + V ++D P PP  IE++++S     +  +PP +DGG+ IK Y++E  +  +S   W+ VA+ D +  + +    LI  + Y FR  A N+ G  +P  +  + + + D +  P  PG+P V + + N+  ++W  P  DGG+ IT Y IE +EK    W +   +  SD+  K              GL EGN Y FR+ A NK G   PSE S+ VL K
Sbjct: 22170 RAGKDIRPSDIVQISSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRE--TSRLLWTVVAE-DIQSCRHV-ATKLIQGNEYVFRVSAVNQYGKGEP--VQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHIERREKKSLRWVRATKMPVSDLRCK------------VTGLQEGNTYEFRVSAENKAGIGPPSEASNPVLMK 22422          

HSP 76 Score: 118.627 bits (296), Expect = 3.392e-25
Identity = 90/284 (31.69%), Postives = 133/284 (46.83%), Query Frame = 0
Query:  546 ELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIM-DKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            ++S FKD  +V      +I      + L  I  KR  SG Y +++ N  G  +    VN++ D+P PP   +    ++K+  V+   PP DDGG+EI +YIIE  +V    + W  V  A  K   + KV+ L+    Y FR  A N  G+SDP  +    +  +D +  PD P +P V + + +S  + W  P +DGG PIT+Y +E +E     W +            T     P        L+EG +Y FR+ A N+ G   PS  S  V AK    KP
Sbjct: 18603 KVSWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRSDSGKYCVVVENTTGSRKGFCQVNVVADRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEV--GKDIWMPVTSASAK--TTCKVSKLLEGKDYIFRIHAENLYGISDP--LVSDSMKARDRFRVPDAPDQPIVTEVTKDSALVTWNKP-NDGGKPITNYILEKRETMSKRWAR-----------VTREPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 18868          

HSP 77 Score: 118.627 bits (296), Expect = 3.628e-25
Identity = 95/329 (28.88%), Postives = 150/329 (45.59%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETS------DSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS 866
            +S  KDG E++      I        L V +  R  +G Y + ++N  G     +N  ++DKP PP   +E++ ++   C +   PP ++GG +I +YI+E  + S  +  W+ + + + +   S KV  L+  + Y FR    N+ G+ +  E +    +  +P+  P  P    +   +     L W+ PESDGG+ I+ Y IE +EK+   W +              VN KP+     K  GL EG EY +R+ A N  G SLPSETS      D V   +   KP +   G  NI I    ++   ++ GG P    T E   S
Sbjct: 27560 ISWAKDGVEIEERARTEIVSTDYNTVLTVKDCVRRDTGQYILTLKNVAGTRSMAVNCKVLDKPGPPAGPLEISGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLA--WT-ICEGELRT-TSCKVTKLLKGNEYIFRVTGVNKYGVGESLESTAVKAL--NPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIIERREKNSLRWVR--------------VNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTNITI----SWVKPLFDGGAPVTGYTVEYKKS 27864          

HSP 78 Score: 116.316 bits (290), Expect = 1.445e-24
Identity = 87/291 (29.90%), Postives = 134/291 (46.05%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +SW  P +DGG+ +  Y ++  +  +  W  A  +   DT+  V GL  G +Y++ V A N  G  +  ++ EP+ A +P  PP +P+  NI     +SV+L+W KP  DGG  IT YII++++   G W     T+       + E    +  L+E + Y+FR+ A N A   S PS  T P   +     P I         I V    + +I   + G P P  +W K+G++I       I   +Y    T K CV +    D G Y L  +N  G     ++  VLD
Sbjct: 27344 VSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNIT---RKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTN-------VQETYFEVTELTEDQRYEFRVFAKNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEIEERARTEIVSTDYNTVLTVKDCVRR----DTGQYILTLKNVAGTRSMAVNCKVLD 27620          

HSP 79 Score: 115.546 bits (288), Expect = 2.456e-24
Identity = 84/310 (27.10%), Postives = 132/310 (42.58%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK---DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKT--IKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +P+ P    P  +    I L+WA P  DGG  I  Y+++  +  +  W+  +  +   +T+  V GL  G+ Y+F V+A N  G   P      IK   P  PPS P    + D    +V+L W KP  DGG  I  YII+  K   G W    K +  +C     +    +  L  G+ Y+FR+ A+N AG+   S  T       +   P +D  ++  +T  ++   +    I  +G P P   W K    ++   ++  T       + + L V      DAG Y+   EN +G       + VLD
Sbjct: 29892 IPDAPGTPEPSNVTGNSITLTWARPESDGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLIEGNEYEFHVMAENAAGIGPPSGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWH---KVNAEACV----KTRYTVTDLQAGEEYKFRVSAINGAGKGESSEATGAIKAVDRLAAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADIHTT------DSFSTLTVENCNRNDAGKYTFTVENNSGSKSITFTVKVLD 30188          

HSP 80 Score: 115.546 bits (288), Expect = 2.583e-24
Identity = 86/313 (27.48%), Postives = 147/313 (46.96%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYII--QKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLT--PSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            + +P  P  L   ++  + + L+W  P +DGG+ +T Y+I+  ++    W+    +    T+    GL  G  Y+  V A+N  G  +P R  +PI A +P  PP +P+ P + D    SV+L W  P D+GG  +T Y+I  QK D+     +  K +    + R    E  +  L +G  Y+FR++A N  G   P+    P   +   +   P  +      + I V +  + +  I +KG+P P   W K G Q  S   ++ T E +      +L + ++   D+GTY LV EN+ G+    + + V+
Sbjct: 31670 ISIPGPPETLQIFDVSRDGMTLTWYPPENDGGSQVTGYIIERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ----HEWTKCNTTPTKIR----EYTLTHLPQGAEYRFRVLACNAGGPGEPA--EVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEG-QDVSKRAMIATSETH-----TELVIKEADRDDSGTYDLVLENKCGKKTVYIKVRVI 31966          

HSP 81 Score: 115.161 bits (287), Expect = 3.162e-24
Identity = 86/276 (31.16%), Postives = 125/276 (45.29%), Query Frame = 0
Query:  550 FKDGKEV-KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +K G ++ K  Q VN         LN+    R  SG Y +  RN  G    +I + + D P PP   I    +S +       PP++DGG  I +YI+E     S++  W ++A    +   + K   L     Y+FR +A NR G+     I+   I+   P+  P  PG P V   + +S  ++W  P SDGG+PI  Y IE KE++  LWQ                  K +V G      GL +G  Y FR+ A N  G S PS+ S+ +LA
Sbjct: 22854 WKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIRFDEVSSDFVTFSWDPPENDGGVPISNYIVEMRQTDSTT--WVELATTVIR--TTYKATRLTTGVEYQFRVKAQNRYGVGP--GITSTPIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQ---------------TVSKALVPGNIFKSSGLTDGIAYEFRVIAENLAGKSKPSKPSEPMLA 23108          

HSP 82 Score: 115.161 bits (287), Expect = 3.189e-24
Identity = 91/298 (30.54%), Postives = 139/298 (46.64%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW--LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  + + + W  P +DGG+ +  Y ++  + ++  W  L  +  +DTK    GL  G  Y+F+V A N  G  +P +  E   A +P  PP  P E  ++  +N  VTL+W+KP+ DGG  IT YI++KKD   G W  A  T+       + E E  + GL E + Y+FR+IA N AG  S PS  T     R +   P  S+D        +    T + +  ++G+P P+  W K+G ++  T   +  +   Q      L V      D G Y L   N  G     + + VLD
Sbjct: 26255 ISKDQMIVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRP-EAIVITRNN--VTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTN-------VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWSKDGKELEETAARMEIKSTIQ---KTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLD 26539          

HSP 83 Score: 114.775 bits (286), Expect = 4.900e-24
Identity = 91/310 (29.35%), Postives = 148/310 (47.74%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW----LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P KP   N   + ++ ++L+W  P  DGG+ +T + ++  + ++  W       +  ++ +AT  GL  G  YQF V A N  G S P    +   A +P  PP  P   + +D   +++TL+W  P  DGG  I  Y I+K+     W     TD + C+  +        GLS G  Y+FRIIA N  G  S PS  +   + R +N+ P+++ G      I +      +IK  V+G P P  TW+++G++I     + IT      G+T+ L V  +     G Y + A+N +G  K ++ + V D
Sbjct: 29501 PGKPVVYN---VTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRAT--GLMEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTP---DYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVT-------GLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPTVEFGPEYFDGIIIKSGESLRIKALVQGRPVPRVTWFRDGVEIEKKMNMEITD---VLGSTS-LFVRDATREHRGVYRVEAKNASGSSKAEITVKVQD 29791          

HSP 84 Score: 110.538 bits (275), Expect = 1.034e-22
Identity = 77/263 (29.28%), Postives = 128/263 (48.67%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK--SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            VN     D   L +   +R  +G Y I   N  G   + + +N++ +P PP   I+  +IS +   +   PP DDGG++I +Y+IE  + +  +  W  V+      PK  +  +  L+  H Y FR  A N+ G+ +P  +  +    ++ +  P  P +P+V   + NS  + W  PE DGG+P+T Y +E K+ +   W++   +N   I+  T       V     GL+EG++Y FR+ A+N  G    S  SD V A+
Sbjct: 17924 VNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFENISADQMTLSWLPPLDDGGSKITNYVIEKREANRKT--WVHVSSE----PKECTYTIPKLLEGHEYVFRIMAQNKFGVGEP--LDSEPETARNLFSVPGPPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKR---VNRDPIKAMTL-----GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTAR 18170          

HSP 85 Score: 108.997 bits (271), Expect = 2.962e-22
Identity = 87/295 (29.49%), Postives = 140/295 (47.46%), Query Frame = 0
Query:  944 EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            + + + W  P  DGG+ +  Y ++  + ++  W+   +T    TK    GL  G  Y+F V A N  G  +P +  E   A +P  PP  P+    +     SVTL+W+KP+ DGG  IT YI++KK+   G W  A  T+       + + +  + GL E + Y+FR+IA N AG  S PS  T     R +   P I        TI ++    ++I   + G+P P   W K   ++++T  + I   ++       L V  +  ID+G Y L A+N  G+    +++ VLD
Sbjct: 24110 DSMEVQWNEPVSDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLDEGIEYEFRVSAENIVGIGKPSKVSECYMARDPCDPPGRPEA---IIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTN-------VIDTQFEVTGLVEDQRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVLHAGESFKIDADIHGKPIPTIQWVKGDQELSNTARLEIKSTDF----ATSLSVKDAVRIDSGNYILKAKNVAGERSVTVNVKVLD 24390          

HSP 86 Score: 108.612 bits (270), Expect = 3.977e-22
Identity = 96/318 (30.19%), Postives = 142/318 (44.65%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-------LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            N+  VP  P       +    + ++W  P  DGG+P+T Y ++M D  +  W       + AM T      V GL  G  YQF V A+N  G        +P+ A +P  PP  P    + D+   SV L W  P  DGG  +T YI++ K++    ++  K      E R  +L   + GL EG +Y+FR+ AVN AG   P   T     + + ++P +   +S    I V+   + +I   V G+PPP  TW  N  + A   E  I           K C    Q    G YSL+A+N  G+ K  + + VLD+
Sbjct: 18066 NLFSVPGPPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM-TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPIAPPGPPIP-KVTDWTKSSVDLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEQGKDK----EVRGTKL--VVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--ERALPQEATIETTAISSSMVIKNCQRSHQ----GVYSLLAKNAGGERKKTIIVDVLDV 18369          

HSP 87 Score: 108.227 bits (269), Expect = 5.077e-22
Identity = 85/319 (26.65%), Postives = 135/319 (42.32%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTD-LDLIVLDLMQECE 1238
            N    P  P      +I    + + W+ P  DGG+ ++ Y ++  D  +  W   ++   +DT+  V GL     YQ+ V AVN  G+       +  KA +P  PP  P +  + D    S+TL W KP  DGG  +T Y++  +      +  + T     +  +   E  +  L  G  Y F++ A+N AG+  P   T+P   +     P ID   +  +S   K        I  KG PPP  TW K+   + S     I   +    +++ L + +    D G Y L  EN  GQ K+  + + VLD    C+
Sbjct: 28802 NAFVTPGPPGIPEVTKITKNSMTVVWSRPVADGGSEVSGYYLEKRDKKSLGWFKVLKETIRDTREKVTGLTENSDYQYRVCAVNAAGQGPFSEPSDFYKAADPIDPPGPPAKIRVADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQGEEEEWTVVST-----KGEVRTTEYVVSNLKPGVNYYFQVSAINCAGQGEPIEMTEPVQAKDILEEPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYNIQNTD----SSSLLIIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQ 29111          

HSP 88 Score: 107.842 bits (268), Expect = 5.569e-22
Identity = 83/275 (30.18%), Postives = 128/275 (46.55%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KDG  +K    VN+    D   L++    ++  G Y I + N  G     I V  +DKPDPPK  ++   +S  S  +  +PP   GG +I +YI++  D +++         A      ++KV  L     Y+FR  A NR G S    +  + I+ + P+ EP  PG P V   S ++  + W  P ++GG+P+  Y +E KE++  LW              T VN K ++H T      L EG EY FR+ A N  G    S+ S+  +A+
Sbjct: 25020 KDGLPLKQTTRVNVTDSPDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEVITLDKPDPPKGPVKFDEVSAESITLSWNPPTYTGGCQITNYIVQKRDTTTTVWDTVSATVAR----TTLKVTKLKTGTEYQFRIFAENRYGQS--FALESEPIVAQYPYKEPGPPGTPFVTAISKDAMVVQWHEPINNGGSPVIGYHLERKERNSILW--------------TKVN-KTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 25273          

HSP 89 Score: 106.686 bits (265), Expect = 1.260e-21
Identity = 79/297 (26.60%), Postives = 136/297 (45.79%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +  E I ++W  P  +GG+ +  Y ++M D ++  W  A  +  + T   V  +  G IY+F V A N  G  +P    EP+ A +  +PP   +   I D    SV+L W +P+ DGG  IT YI++++D   G W  A  T+       + E +  + GL++   Y+FR+ A N  G  S+PS    P  C      P ID     ++ +K       +++  + G+P P   WYK+  ++ +   V I          A + +  +  +++G+Y L   N  G     + + +L
Sbjct: 28420 VTRESITVAWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPP---RNVRITDISKNSVSLSWLQPAFDGGSKITGYIVERRDLPDGRWTKASFTN-------VIETQFIVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCIE----NTTDLASVLIKDANRLNSGSYELKLRNAMGSASATIRVQIL 28702          

HSP 90 Score: 105.916 bits (263), Expect = 2.535e-21
Identity = 73/253 (28.85%), Postives = 117/253 (46.25%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLL 869
            V  ++K+S  +  S P DDGG+ +  Y IE  +  +S+++W +  +          V  L+    Y+FR  A N +GLS+    S + ++ KDP+D+P +PG   +L  S +S  L W  PE DGG  I  Y +EY++     W++       D +             T  GL+E  EY FR+ A N+ G S P  T+ S+  K    +    +  + ++  K G   +      G P P + W R G  L+
Sbjct: 32079 VLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE--TSTDKWVRHNKTQITT-TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPAS-EPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQF------------TIGGLLESTEYEFRVFAENETGLSRPRRTAMSIRTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELV 32315          

HSP 91 Score: 102.449 bits (254), Expect = 2.793e-20
Identity = 93/294 (31.63%), Postives = 132/294 (44.90%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVN----INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI 837
            F   K  K GQDV+    I       +L +    R+ SG+Y +++ N  G     I V ++  P+PP+  +E   I   S  V   PP DDGG +I  YI+E  +VS ++  W  + ++  G    S+ V  L     Y FR  A N+ G+S   +     I              P VLD + +S  L+W+ P+ DGG+ +T Y IE KE S   W     +  +  +I T +        T  GLV   EY FRI A N  G S  S  S+ V+ K  + KP   QPG   I
Sbjct: 31906 FPICKWTKEGQDVSKRAMIATSETHTELVIKEADRDDSGTYDLVLENKCGKKTVYIKVRVIGNPNPPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVSKAA--WYTIDSRVRG---TSLVVKGLKENVEYHFRVSAENQFGISKSLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKW-----VRHNKTQITTTMY-------TVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKP--SQPGELEI 32180          

HSP 92 Score: 102.064 bits (253), Expect = 3.565e-20
Identity = 80/307 (26.06%), Postives = 130/307 (42.35%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX--AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF----GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFE-TKPHLCRHKNLTPSID---KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            + A  +++ W  P+ DGG+ +  Y ++  + +   W+    +   +    V GL  G  YQF   A+N  G S+      P+ A+NP   P  P+   + D    +V+L W  P  DGG  +  YII++K       G W     T        + +    +  LSEG  Y+FR++A N AG  S   E T P  CR +   P  +   +      TI+     +    V G+P P+  W K   ++   ++V +     +  A  K C       D+G Y+L  +N +G     + + VLD    C
Sbjct: 30593 VSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGRPE---VTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTI-------VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFC----DRSDSGKYTLTVKNASGTKSVSVLVKVLDSPGPC 30885          

HSP 93 Score: 82.4185 bits (202), Expect = 3.360e-14
Identity = 83/309 (26.86%), Postives = 137/309 (44.34%), Query Frame = 0
Query:  732 LAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-----GGTQQATGYVNVLDV---PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPS 1030
            L W  P +DGG+ I  Y +E ++     W    +L T   +     + +  V G  KG   G EY+FR+ A N+ G   P ET + V A+++Y  P    P + N+ I      R+ +    EP          + ++   D+ SI   +  TV  E +   TVT     ++   Y+ ++        G    AT +V V D    P  P  L+  +     + L+W  P  DGG+PI  Y+I+  +    +W+   +    + T  V GL+ G+ Y + V A N+ G S+P   L P+ A++ +  P+
Sbjct: 14858 LGWEEPLTDGGSKIIGYVVERRDIKRKTW----VLATDRAD-----SCEFTVTGLQKG---GVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP---GPPL-NVAITD--INRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAE-DLSATVTDV---VEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDAFVEPT 15144          

HSP 94 Score: 63.1586 bits (152), Expect = 2.040e-8
Identity = 76/332 (22.89%), Postives = 129/332 (38.86%), Query Frame = 0
Query:  192 DQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQ-LIVHYITMEDYGQIEARTPTNHGD----------KTVSCTGSFNVIMGEKA 512
            DQ V+E      VL   +S  N K KW+               G E+ KS+++E +       LI+H  T E+   +T  AK     F T  ++ V+PP  EF    + +T          +F C ++   A ++W ++GA +    +Y+   +G    LV+N+  LD                             D  E +C      +S  L V  +    ++     E  E ++     +V  P A V ++   + I+     R E+  + DG+ + LI+    +ED G    R P++  D          + +S   +  V+ GEKA
Sbjct: 14043 DQTVEEEAT--AVLECEVSRENAKVKWF-------------KNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFL---RPLTDLQVKEKEMARFECEISRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLD-----------------------------DEAEYSCEVKTARTSGMLTVLAEEAVFTKNLGNIEVSETDTIKLVCEVSKPGAEVTWYKGDEEIIETG--RYEI--LTDGRKRILIIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEVLEGEKA 14319          

HSP 95 Score: 52.7582 bits (125), Expect = 2.902e-5
Identity = 110/493 (22.31%), Postives = 188/493 (38.13%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            ++WFK  +++    +Y   T+G+    IL I  A  +++G+Y             + K  VTVE      A L+K +K    VE+ V +     ++                LS P+V G+W L+             G  L  S   E I     + L+++N  ++ +G+ +  A   N        V+ +P      F   L   K        KF C ++      RW +    +    + E    G K  LV+     +D G       +Y+ + ED  TS KLI+EG                 +R+    KF++ +       ERES VF V++   +  V +F N + +     T   V    +GK H +    ++++D  QI+           +S      V+ G+     KL D    +GV   +       +     ++D  +  FKDG+E+K  ++V I   G +  L +    +   G Y
Sbjct: 13442 VKWFKDGEEIVPSAKYSIKTDGLRR--ILKIKKAELKDKGEYMCDCGTD------QTKANVTVE------ARLIKVEKPLYGVELFVGETARFEIE----------------LSEPDVHGQWKLK-------------GEPLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAA--NAKSAANLKVKELP----LIFITPLSDVKV-FEKDEAKFECEVSREPKTFRWLKGTQEITGDDKVELIKDGTKHSLVIKSAAFEDEG-------KYIFEAEDKHTSGKLIIEG-----------------IRL----KFLTPLKDVT-AKERESAVFTVELSHDNIRVKWFKNDQRL----HTSRSVWMDDEGKTHSITFRDLSIDDTSQIKVEA------MGLSSEAKLTVLEGDPYFTGKLQD---YTGVEKDEVILQCEIS-----KADAPVKWFKDGEEIKPSKNVVIKADGKKRILILKKALKSDIGQY 13837          

HSP 96 Score: 52.7582 bits (125), Expect = 3.291e-5
Identity = 75/299 (25.08%), Postives = 129/299 (43.14%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM--ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI--KAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDEL-----EARIPGLSEGKWYQFRIIAVNKAGESS--PSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTD--EVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++W  P  DGG  I +Y ++  +     W+     E ++T  +V+ L  G  Y+F V   N  GESE     EP   K++ P + P   +E   ++   QS      K +    +PI  +  Q K+      D LK        RI E      +  I  +++     +++ A N+ G  S   S E +  +    +L P   +G  +   ++    +I +I   G+P P  TW K    I +    +V++TR       T+ +  +  +  DAG Y + A+NR G D+  ++L V D+
Sbjct: 32584 VAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPATPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP-KPIVKWYRQGKEIIA---DGLK-------YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEDTVPAKIHL-PKTLEGMGAVHALRGEVVSI-KIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTR-----SFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV 32864          

HSP 97 Score: 50.447 bits (119), Expect = 1.624e-4
Identity = 111/495 (22.42%), Postives = 192/495 (38.79%), Query Frame = 0
Query:   95 PEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            P I+WFKG+ ++ +EP  KT      N + L + +A  E+  +Y V ++                  G  + A L   ++     EV++   IE     E +    D     A +S  ++ G+W L+    LR   + +   E  K  RF          L +H   ++++G+    A      FTT   + V   + +F    K +T       R  +F C+L    AN+ W++    +    +++    G+K  LV+N    DD GV       Y  + E   +S +L V G                 +R+    KF+S +  Q    E ++  F  ++      V +F N   +     T   V    +GK H+L +  +T++D  QI A+       K +S T +  V+  +     KL D    +GV   +       +       D+ +  FKDG+E+      +I   G R  L +   + +  G Y
Sbjct: 13084 PNIKWFKGYDEIPLEPNDKTEIVREGNHLFLKVKNATPEDIDEYAVEIE------------------GKRYPAKLTLGER-----EVELLKPIEDVTIYEKESASFD-----AEISEADIPGQWKLKGEL-LRPSPTCEIKAEGGK--RF----------LTLHKVKLDQAGEVLYQAL---NAFTTA-ILTVKEIELDFAVPLKDVTVPE---RRQARFECVLTRE-ANVIWSKGPDIIKASDKFDIIADGKKHILVINDSHFDDEGV-------YTAEVEGKKSSARLFVTG-----------------IRL----KFISPLEDQTVK-EGQTATFVCELSHEKMHVVWFKNDAKL----HTSRTVLISSEGKTHKLEIREVTLDDISQIRAQV------KDLSSTANLKVLEADPYFTVKLHD---KTGVEKDEIILKCEVS------KDVPVKWFKDGEEIVPSAKYSIKTDGLRRILKIKKAELKDKGEY 13481          

HSP 98 Score: 50.447 bits (119), Expect = 1.766e-4
Identity = 113/558 (20.25%), Postives = 198/558 (35.48%), Query Frame = 0
Query:   66 PKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYK-TWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLS-IPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNC-ILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERE---SYVFNVQVKDPSAP--VDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGE-KAPKLGD--CGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP 612
            P  V   +      G N      I+G P   + WFKG  +L+   R   +  + V    + G+ +    + GDY  ++ N  G+       +V         A  +KR                   D  +++ K   ++L    +  P +   W                G+ +  S+R      E S  L + + T+E++G++    +  +   +    + ++ P    YF K+L   K  + + S    C I       + W +    L     Y+   R     LV NQ++ +D+G       EY+   E+ V           GE+        SSST     + K     S Q   V+       VF   +   S P  V ++ +GK +  G + +       D    L +        GQ         G    S + S  +I+ E K P   D    PV  V  +  ++     V G +   I+++  KD +E++ G +  I++  +   L ++   +  SG Y     N  G D     +NI ++  PP
Sbjct: 8698 PSFVQKPEAMDVLTGANVTFTSIIKGTPPFTVSWFKGSSELAPGDRCNVSLEDCVAELELFGVDTT---QSGDYTCIVSNEAGKASCTTHLYVKAP------AKFVKRLN-----------------DYSIEKGK--PLILEGTYTGTPPISVTW-------------KKNGINITPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP---YFVKQLEPVKVTVGD-SASLQCQIAGTPEIGVSWYKGDTKLRPTATYKMHFRNNVATLVFNQVDSNDSG-------EYICRAENSV-----------GEV--------SSSTFLSVQEQKLPPSFSRQLRDVQETVGLPVVFECTING-SEPISVSWYKDGKPLKDGPNVQT---SFLDNVATLNIFKTDRSLAGQYSCTATNPIG----SASSSARLILTEGKNPPFFDIPVAPVDAVVGESADFECH--VTGTQP--IKVTWAKDNREIRSGGNYQISYLENSAHLTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPP 9172          

HSP 99 Score: 49.2914 bits (116), Expect = 3.858e-4
Identity = 83/412 (20.15%), Postives = 160/412 (38.83%), Query Frame = 0
Query:  235 GLELHKSERFEWIHREDSYTLIVHNPTIEE-SGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKD----SSSSTLRV--AHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVF--KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHI------SKNSCVVKLSP 631
            G  +H  E+F+ +  +++YTL++H    EE  G +T  A       +T   + V+        ++++   +  L + + KF C + +   N+R+    A   ++   + S+R  K    ++ LE+    V+                        D GE TC  + +    S ++TL V  A+   F S   S    V + +      +  P     +  +G  + P  + ++      + KH L +  +T++D G    +     G     C     +I  +K   + +  PV    +K         +E     D +++V   KDG+++  G+D  I F      L +   K + SG+Y     N  G       V I + P   K ++ +++      ++  C +K SP
Sbjct: 4307 GKLVHSDEKFKCLQDQNTYTLVIHGVNTEEHQGAYTCEALNAKGNASTSAKLTVVKRAAPV-IKRRIEPLEVALGHLA-KFTCEV-QIAPNVRFQWFKAGREIYESDKCSIRSSKY---VSTLEILRTQVV------------------------DCGEYTCKASNEYGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKTAKFLCTVLGTPVIETIWQKDGAALSPSPNRKI---SEAENKHSLELSNLTIQDRGVYSCKASNKFGADI--CQAELIII--DKPHFIKELEPVQSAINKKIR------LECQVDEDRKVTVTWNKDGQKLPPGKDHKIYFEDKIASLEIPLAKLKDSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKLKGSP 4675          

HSP 100 Score: 48.521 bits (114), Expect = 5.309e-4
Identity = 77/392 (19.64%), Postives = 159/392 (40.56%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHRE-DSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVA-HDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIE 486
             +W KG ++++ + + +   +G +++++  I SA  E+EG Y    ++++              G +    + LK                 TP+ ++V   + +  V T  LS  N++ KW+  +               LH S R  W+  E  ++++   + +I+++ +     K E    ++   + V+  DP  YF  KL    TG+    V   C +++A A ++W ++G    + P     ++                            DG+  +   K  ++ D G+ TC    D +S  L +   + K V  + S  E +E E+  F  ++ +     ++ L G+ ++   D   E+K+ G   H LI+H   ++  G ++
Sbjct: 13620 FRWLKGTQEITGDDKVELIKDGTKHSLV--IKSAAFEDEGKYIFEAEDKH------------TSGKLIIEGIRLK---------------FLTPL-KDVTAKERESAVFTVELSHDNIRVKWFKNDQ-------------RLHTS-RSVWMDDEGKTHSITFRDLSIDDTSQI----KVEAMGLSSEAKLTVLEGDP--YFTGKLQ-DYTGVEKDEVILQCEISKADAPVKWFKDGE--EIKPSKNVVIKA---------------------------DGKKRILILKKALKSDIGQYTCDCGTDKTSGKLNIEDREIKLVRPLHSV-EVMETETARFETEISEEDIHANWKLKGEALLQTPD--CEIKEEGK-MHFLILHNCRLDQTGGVD 13927          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:Ttn "titin" species:10090 "Mus musculus" [GO:0000794 "condensed nuclear chromosome" evidence=ISO] [GO:0001701 "in utero embryonic development" evidence=IMP] [GO:0002020 "protease binding" evidence=ISO] [GO:0003007 "heart morphogenesis" evidence=IMP] [GO:0003300 "cardiac muscle hypertrophy" evidence=ISO] [GO:0004674 "protein serine/threonine kinase activity" evidence=ISO] [GO:0005200 "structural constituent of cytoskeleton" evidence=TAS] [GO:0005509 "calcium ion binding" evidence=ISO] [GO:0005515 "protein binding" evidence=IPI] [GO:0005516 "calmodulin binding" evidence=ISO] [GO:0005634 "nucleus" evidence=ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005794 "Golgi apparatus" evidence=ISO] [GO:0005859 "muscle myosin complex" evidence=TAS] [GO:0005865 "striated muscle thin filament" evidence=ISO] [GO:0006468 "protein phosphorylation" evidence=ISO] [GO:0006936 "muscle contraction" evidence=IMP] [GO:0007512 "adult heart development" evidence=IMP] [GO:0008307 "structural constituent of muscle" evidence=ISO] [GO:0019899 "enzyme binding" evidence=ISO] [GO:0019901 "protein kinase binding" evidence=ISO] [GO:0030017 "sarcomere" evidence=IDA] [GO:0030018 "Z disc" evidence=ISO;IDA] [GO:0030240 "skeletal muscle thin filament assembly" evidence=ISO] [GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=ISO] [GO:0031430 "M band" evidence=ISO;IDA] [GO:0031433 "telethonin binding" evidence=ISO] [GO:0031672 "A band" evidence=IDA] [GO:0031674 "I band" evidence=ISO;IDA] [GO:0042802 "identical protein binding" evidence=ISO] [GO:0042805 "actinin binding" evidence=ISO] [GO:0043056 "forward locomotion" evidence=IMP] [GO:0043621 "protein self-association" evidence=ISO] [GO:0045214 "sarcomere organization" evidence=ISO;IMP;TAS] [GO:0045859 "regulation of protein kinase activity" evidence=ISO] [GO:0048739 "cardiac muscle fiber development" evidence=ISO] [GO:0048769 "sarcomerogenesis" evidence=ISO] [GO:0050790 "regulation of catalytic activity" evidence=ISO] [GO:0051015 "actin filament binding" evidence=ISO] [GO:0051371 "muscle alpha-actinin binding" evidence=ISO] [GO:0051592 "response to calcium ion" evidence=ISO] [GO:0055002 "striated muscle cell development" evidence=IMP] [GO:0055003 "cardiac myofibril assembly" evidence=ISO;IMP] [GO:0055008 "cardiac muscle tissue morphogenesis" evidence=ISO] [GO:0060048 "cardiac muscle contraction" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR015129 InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009 Pfam:PF00041 Pfam:PF00069 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 MGI:MGI:98864 GO:GO:0005524 GO:GO:0005634 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0031430 GO:GO:0030018 GO:GO:0046872 GO:GO:0005200 eggNOG:COG0515 GO:GO:0003007 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0018108 GO:GO:0004674 GO:GO:0001701 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0001756 GO:GO:0004713 GO:GO:0006936 GO:GO:0055003 GO:GO:0045214 GO:GO:0007512 GO:GO:1901897 InterPro:IPR013098 Pfam:PF07679 MEROPS:I43.001 GO:GO:0043056 GO:GO:0005859 GeneTree:ENSGT00720000108588 OMA:TWFHNNR OrthoDB:EOG7N8ZTK TreeFam:TF316477 InterPro:IPR004168 Pfam:PF02818 Pfam:PF09042 EMBL:AL928681 EMBL:AL928721 EMBL:AL928789 UniGene:Mm.373672 UniGene:Mm.446279 UniGene:Mm.473358 ProteinModelPortal:A2ASS6 PhosphoSite:A2ASS6 PaxDb:A2ASS6 PRIDE:A2ASS6 Ensembl:ENSMUST00000011934 Ensembl:ENSMUST00000099980 Ensembl:ENSMUST00000099981 HOGENOM:HOG000136636 HOVERGEN:HBG080472 InParanoid:A2ASS6 PRO:PR:A2ASS6 ArrayExpress:A2ASS6 Bgee:A2ASS6 CleanEx:MM_TTN Genevestigator:A2ASS6 Uniprot:A2ASS6)

HSP 1 Score: 265.388 bits (677), Expect = 2.001e-70
Identity = 188/577 (32.58%), Postives = 282/577 (48.87%), Query Frame = 0
Query:  557 KVGQDVNINFHG--DRVD----LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            KVG D N+   G  D VD    L + N  R+ SG Y + + N  G     +NV ++D P P   ++V+ ++K SC V  +PP++DGG+++ HYI+E  +    +  WS V     K   S  V NL+  + Y FR  A N  G   P +I  + ++  DP  EPD P +  V + + NS  LAW  P  DGGA I  Y I Y+E+     +  E     D+ +               GL EG +Y FR+ A N  G S+P E      AK + L P +  P    I IK G+  R +    G+P P   W++      GD + ++    +      + ++VL +    R  D+G+Y++      G+      V V+D P  P+   +  EI A+  +LSW  P +DGG+ IT+Y+++  D+  GDW+ A+ +   T   V  L PG  Y F V A N+ G SEP  T   + A+ P+  PSEPK   +   +   + + W +P  DGG PIT Y+I++K++    +  +K +D      +   E    GL EG  Y FRI A+NKAG S PS  T+
Sbjct: 20431 KVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLDTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKT--WSTVTPEVKK--TSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIP-KPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLSL------------IVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLLPPKILMP--EQITIKAGKKLRVEAHVYGKPNPICKWKK------GDDEVVTSSHLAIHK--ADGSSVLIIKDVTRK-DSGYYSLTAENSSGSDTQKIKVTVMDAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPL-TSPKMLAKFPFDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLW--VKANDTI----VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 20971          

HSP 2 Score: 261.922 bits (668), Expect = 2.933e-69
Identity = 201/659 (30.50%), Postives = 302/659 (45.83%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++I   N  G  + L++ ++  K     PD P+   VT ++K+S +V  + P+D GG  I +YI+E  +  + S +W +V +         +V +L+   +Y FR  A N IG+ DP   S + +  +DP  +P  P  P  +D + NS +L W  P  DGG+ I  Y +EY++     W++      S  E K  V G          L +G  Y FR+ AVN+ G S P+   + VL K R   P   L         I+ G T R      G P P VTW++         DR   E  +K  +      + L +  A    D G Y++ +    GT+  +  V VLD P  PR L   EIR +   L+W  P DDGG+ +T+YV++  D+    W     T   K+   K L  G+ Y F V A N+ G      T +PIKA +P  PP  PK+ + VD D   V+L W KP  DGG PIT Y+++ +++    +   KT        +  L+  + GL +GK Y+FR+ A N  G   P   T P  C+ K + PS+  D        +K   T  +   ++G P P   W  +G +I + D   +  + +    T K C+ K    D G Y L   N  G     + L VLD+
Sbjct: 18773 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPEQPVVTEVTKDSALVTWNKPND-GGKPITNYILEKRE--TMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPS-KPVFARDPIAKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTG----------LRDGQSYKFRVLAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKE--------DR---EAPTKAQIDVTPVGSKLEIRNAAHE-DGGIYSLTVENPAGTKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKFKT--------VKNLDCVVTGLQQGKTYRFRVKAENIIGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRK----DTGEYQLTVSNAAGTKTVAVHLTVLDV 19392          

HSP 3 Score: 259.996 bits (663), Expect = 1.065e-68
Identity = 180/585 (30.77%), Postives = 284/585 (48.55%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP-HLCR 1130
            K+ +E      +++   G ++++   N   E  G Y + + N  G     + V ++DKP PP+ +EV+ I K+SC +    P DDGG+ + +Y++E  DV+++  QWS ++    K  KS    +L   ++Y FR  A N+ G   P   + + I   DP   P  P     +D       L W  P+ DGG+PIT Y +EY+E+    W          I+ KT  N    +     GL +G  Y FR+KA N  G  LP +T+  +  + + + P   L    I  + +K G T R+     G P P+  W  +G+ +  D D  ++E  S  +V   KN +          DTG Y + +    GT+    ++ VLDVP  P   +N  ++  E++ +SW  P DDGG+P+ +Y+++  D   G W + +  +   K  V  L+ G  Y F V A NK G   P  ++ P  A++ + PPS P +P + D    + T+ W  P  DGG PIT Y +++++  G W    KT        I +L+ R+ GL EG  Y+FR+ A N AG S+PS  + P   CR
Sbjct: 19043 KEDREAPTKAQIDVTPVGSKLEIR--NAAHEDGGIYSLTVENPAGTKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATA--QWSPLSTTSKK--KSHMAKHLTEGNQYLFRVAAENQYG-RGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDW----------IKFKTVKN----LDCVVTGLQQGKTYRFRVKAENIIGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTD-DHYTVETDSFSSVLTIKNCLRK--------DTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSI-PTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTP-------IADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACR 19588          

HSP 4 Score: 251.906 bits (642), Expect = 3.993e-66
Identity = 195/658 (29.64%), Postives = 293/658 (44.53%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L     I  N   +P PP T E + I+K+S V+  + P DDGG EI+ YI+E  D      +W++  +      +  +V  L   H Y FR  A N  G+ +P E S   +  +  D    P  P  P V D S +S  LAW  P  DGGAP+  Y IE K+ +   W        +     + + GK     T   L E  EY FRI A N  G   P+    SV+A+ R   P +         + ++   T R  +   G P P V WE+   +L   ++R  IE+ S         T+L +    R  D+G Y + L  + G++ A   V VLD P  P  L   E++ + + LSW  P  DGG  IT+Y+++  +     +   +    TK T K   L+ G  Y F V+A N+ G   P  T EP+K     +PP  P    +VD    + T++W+KP  DGG  IT Y+++ + K    + A          ++  LE  I GL+ G+ Y FR+ AVN+ G S P     P + +   + PS++    ++  +K N      I  KG P     W K+G  +  T  V +   +        L + ++   D GTY L   N  G     + +IVLD
Sbjct: 26663 FRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRD--KEGIRWTKCNKKTLTDLR-FRVTGLTEGHSYEFRVAAENAAGVGEPSEPS---VFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELKKAAADEW--------TTCTPPSGLQGK---QFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAEGIL---TERAQIEVTS-------SYTMLVIDNVTR-FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAY-ATITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVS---EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSAC--------TQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVEL-PFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVASSK----TVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLD 27275          

HSP 5 Score: 248.825 bits (634), Expect = 3.692e-65
Identity = 200/663 (30.17%), Postives = 304/663 (45.85%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL--INVNIMD---KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDE--VLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++   N  G  E L  + V  +D    P PP ++E+T ++K+S  +  S P+ DGG++I  YIIE  +   +S +W +V     K P     +K   L     Y +R  A N  GLS P E S   +  +DP   P  P +P ++D    +  + W  P  DGGAPIT Y +EYK+     W             K  +        T  GL  G+EYVFR++++NK GAS PS++SD  +AK R  +P           + +K G +F   + F G P P+V+W +  + L     R  I+         +  T+LT+  ANR+ D+G YT+ +         T  V VLD P  P  +   E+  E   LSW  P +DGG P+ +Y I+  +     W+      +  +  V  L+ G IY F V   N+ G   P  T E +K     + PS P++  +      SV+L W KP  DGG  I HY+++  +K    W            A +      + GL E   Y FR+ A N+AG S P     P L + +   P ID  +  S T+ V   +  +  I + G+P P+ T  ++G+ + +T      IT E         + + +S   DAG Y + A N +G  KT +++IVLD
Sbjct: 27744 FRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERRE--KNSLRWMRV----NKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPL-VRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITGYTVEYKKSEETDW-------------KVAIQSFRGTEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGRPIPNVSWSKPDTDL---RTRAYID-------STDSRTLLTIENANRN-DSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKIT---EKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKC---------AVVKTTHHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLT------INLKESVTTDAGRYEITAANSSGTTKTFINIIVLD 28357          

HSP 6 Score: 246.128 bits (627), Expect = 2.398e-64
Identity = 178/563 (31.62%), Postives = 265/563 (47.07%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            L V N  R  +G Y + + N  G       V ++D P PP  I    +++ S  +    P  DGG  I HY+IE  + S  S  W  V++   +  + +KV+ L     Y FR  A N  G+ +P+E+    +      ++P  P R  V+D S +S  LAW  P+ DGG+ IT Y +E ++K    W               +      +  T + LVE  EY FR+KA N  G S P E   SV+ K   ++P     GI N  I  K G TF  D+   G PAP VTW+    + L ++DR+SI          +  T LTV  + R  D+G Y + L    G +  T  V V+  P      +    + AE   LSW  P DDGGT IT+Y+++  +     W L     K T+  V  L     Y F V + N+ G S+P  ++ PI AE+P+ PPS P  P +      ++++RW++P  DGG  I  Y ++KK++    +  +K +   C     E   ++ GL EG  YQFR  A+N AG S  S  ++P + ++
Sbjct: 30202 LTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRS--WQVVSEKCTR--QILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPIVAT----EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFW--------------VEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLE-EMRLKETDRMSI-------ATTKDRTTLTVKDSMRG-DSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESV-PIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILW--VKENKVPCL----ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 30726          

HSP 7 Score: 245.743 bits (626), Expect = 3.672e-64
Identity = 179/558 (32.08%), Postives = 273/558 (48.92%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-----KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            R  SG Y I  +N  G       V +MD P PPK ++V+ I++ SC +    PDDDGG  IK Y+IE   +   +  W++V      G  +  V +LI++ +Y FR RA NR G+  P E + Q    +DP   PD P +  +   + N+  L+W  P++DGG+P+THY +E        K    W+Q    N  D+E          +  T + L+EG EY FR+KAVN+ G S PS T   V+ K +   P +       +E+++G          G P P++TW +         + +  +    K V  +    L + ++ RS DTG Y+I  + + GT      +NVL  P  P   +  + I A+ + LSW  P DDGG+ IT+YVI+  + +   W+  + E K+   T+  L  GH Y F ++A NK G  EP  + EP  A N +  P  P +P +      S+T+ W++P  DGG P+T Y ++ KD     +  +  D    +A    +  ++ GL EG  YQFR+ A+N AG    S  + P   R
Sbjct: 17672 RAHSGKYSITAKNKAGQKTANCRVKVMDAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKA--WTKVNP--NCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAE-TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQ---CNRRDVE---------ELEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTCPPAIELKEF--MEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQV-VDDTCTLVIPQSRRS-DTGLYSITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD--PIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTAR 18205          

HSP 8 Score: 245.358 bits (625), Expect = 4.683e-64
Identity = 197/643 (30.64%), Postives = 293/643 (45.57%), Query Frame = 0
Query:  522 SGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINF--------------------HGDRVDLN--------VINP-KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ-GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            +GV+      G   A + + +  ++LS FKDG EV V   + I                       GDRV +         VI+P +R   G Y + + N        INVN++  P  PK ++ + I+K+S  +   PPDDDGG+ +  Y++E  D+S  +  W++V   D        V +L+    Y F+  A N+ G  +P   + + + +  P   PD P      D ++NS  L W  P++DGG+ I  Y +E   +    W   GE +  + +E+               GL EG  Y +R+KA+N+ GAS PS+ ++ + A      P  FL    +  I +K G          G+P P +TW +  +LL  D  RI+IE   KK+        +T+T + RS DTG Y I+ +   G   A   VNVLD P  P   +  ++  E   L+W  P DDGG+ IT+YV++    D+  W     T KDT      L P   Y F V A N  G  EP +   PI A+  + PP  P      D    +VTL W +P DDGG PIT Y +++ D     W    K         + +   R+ GL+  K Y+FR++A N AG   PS  T+P L +
Sbjct: 15161 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEINVNVIAPPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKT--WTKVM--DFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA-YTDEPVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPDTKMEVT--------------GLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPD-QRITIENVPKKST-------VTITDSKRS-DTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAA-PIIAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMP-------VKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIK 15767          

HSP 9 Score: 244.973 bits (624), Expect = 5.289e-64
Identity = 188/561 (33.51%), Postives = 266/561 (47.42%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSV----LDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            L   N  +  +G Y + + N+ G  E  I V ++D P PP  + V  +SK+S  V   PP  DGG+ I +Y++E  D    S  WS V     K   S +V+NL     Y FR  A N  G+ DP E        +D     + PG P V    L  + +SC + W  P SDGG+ IT Y +++  +    WQ+  ++ +  ++  T            K L EG EY FR+ A N+ G   PSE               L          K+   FR  I   G+PAPSV+W++    L  D+ R+S+E  +        NT L V    +S D G YTI L    GT++ T  + V+  P  P   +  DE+ AE + L W  P DDGG+ IT+YV++  D  N  W+  A   + T   V  L  G  Y F V A NK G  E  ++ EPI A++P+  P  P  PNIVD  + SV+L W  P   GG PIT Y I+ K++    W  A KT        I   + ++ GL+EG  Y+FR++A+N AG   PS  ++P
Sbjct: 21540 LRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKS--WSTVTTECSK--TSFRVSNLEEGKSYFFRVFAENEYGIGDPGE-------TRDAVKASETPG-PVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEE-NKWQR--VMKSLSLQYST------------KDLKEGKEYTFRVSAENENGEGTPSEIVVVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESTA-------VNTTLVVYDCQKS-DAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAENKYGVGEGLKS-EPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTP-------IRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEP 22056          

HSP 10 Score: 244.202 bits (622), Expect = 1.145e-63
Identity = 177/562 (31.49%), Postives = 271/562 (48.22%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            L V N  R  SG Y + + N+ G     +NV ++D P PP+ +++  ++K S  +   PP  DGG++IK+YI+E  +  S+   +S VA    K   S KV+ L     Y FR  A N  G+  P E +     +K   + P  PG+ ++ D + NS  L+W  PE DGG+ I  Y +E + K    W     +  ++               T  GL++G EY FR+ A N+ G S P + S  V+AK   + P      ++N   +  G   + D+ F G P P+VTW ++  + L  + R++ E         E N++LT+ +A R  D GHYT+KL    G    T  V VLD P  P   +  DE+ A+ + LSW  P  DGG+ I +Y+++  D     W     T   + T+K   LK G  YQF + A N+ G+S    + EP+ A+ P+K P  P  P +      S+ ++W +P  DGG  +  Y +++K++    W    KT        I + + +  GL EG  Y+FR+ A N  G   PS   KP  C
Sbjct: 23705 LVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRE--STRKAYSTVATNCHK--TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES---VKAS-ERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTE--------------ATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL--LFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKD-DIPLKQTTRVNAE-------STENNSLLTIKEACRE-DVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATV-ARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTP-------IPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPS---KPSEC 24221          

HSP 11 Score: 243.432 bits (620), Expect = 1.538e-63
Identity = 193/664 (29.07%), Postives = 300/664 (45.18%), Query Frame = 0
Query:  586 YKIIIRNAQGF-----DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-------YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGD-SDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G       E LI  N    PD PK  EVT ++K+S +V    P  DGG+EI  Y++E  D      +W++       G   ++V  L+  H Y FR  A N  GLS+P   S       DP  +P  P  P V+D + +S  L+W  P  DGG  I  Y +E  + S+G W        +N +++E++               L+E +EY FRI A+NK G    ++    V+ + +     L  P I         I I+ G + R  +   G P P V W +    + GD  D   I++ S         T L +   NR  D+G YT+ L    GT+ A   V VLD P  P  L   EI  + ++++W  P  DGG+ I +Y+++  +     +   +      +  +  L+ G  Y F V A N+ G   P RT +PIK     +PP    +  + D    SV+L W KP  DGG  I  YI++          A  TD  S  AR+  L+A I  L++G+ Y FR+IAVN+ G S P     P + +   + P + + + SS +++V +    ++ + G P P  +W K+G+ +  T  + +T           L + ++   D G Y +   N  GQ    +++I LD
Sbjct: 24498 FRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRD--KEGIRWTR-CHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKAC-DPIYKPGPPNNPKVMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEK--------------LLEKHEYNFRICAINKAGVGEHADVPGPVMVEEK-----LEAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEVKWGK----VDGDIRDAAIIDVTS-------SFTSLVLDNVNR-YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVE--------MQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDV-RPAFSSYSVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRINVT----DSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLD 25110          

HSP 12 Score: 242.276 bits (617), Expect = 4.626e-63
Identity = 180/630 (28.57%), Postives = 285/630 (45.24%), Query Frame = 0
Query:  607 DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            D P PP  + +T +++    +   PP+ DGG EI +Y+IE  D +S     +   +A+     S  V +++    Y FR RA NRIG+  P   +   + + DP + P  P   +  + + +S  L W  P  DGG+PI  Y IE +E+    W            I+ ++   P +     GL +GN+Y++R+ A N  G S PSE    + A   +++P +      + +E+      +  +   G P P  TW   G  +L + DR+ ++  S    Y E    L ++ + R+ D G YT+ L     +      VNV+  P  P+ L   +I  + ++L+W  P DDGG+P+T YV++  D+    W   M+   D + TV  L  G  Y F+V A NK G  EP  T EP+    P   P  P+     D    S+ L W  P +DGG  I  YI++K  +    + A       C   + + +  + GL EGKWY +R+ A+N+ G S PS  T+          P I  D    +  T+K          V G+P P+ TW K    +     + I     +   T    ++ S+  D GTY + A N  G+    +++ VLD
Sbjct: 14978 DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL---SATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNW------------IRCNMKPVPELTYKVTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATW-TFGDQVLEEGDRVKMKTIS---AYAE----LVISPSERT-DKGIYTLTLENPVKSISGEINVNVIAPPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEPVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVA-------CGEPVPDTKMEVTGLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITIENVPKKSTVT----ITDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD 15571          

HSP 13 Score: 237.654 bits (605), Expect = 1.135e-61
Identity = 203/662 (30.66%), Postives = 290/662 (43.81%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV---AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS----GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L     + V+    PDPPK  EVT I+K+S VV    PD DGG+EI +YI+E  D   +  +W +    A  D +     KV+ L   H Y FR  A N  G+S P   S      D + K     P  PG P VLD S +S  +AW  P  DGG+ IT Y +E        WQ           + T   G      T   L+E  EY  RI A+N  G   P+    +  A+ R L P +         + I+   T R  +   G PAP V W R     L   D+ SIE  S         T+L V   NR  D+G Y + +    G++ A   V VLD P  P+ L   E+    + L+W  P  DGG+ I +Y+++  +     +   A     T   V  L+ G  Y F V+A N+ G   P  T E +KA    + P  P +  + D    SV+L W+KP  DGG  I  YI++ + K    +       A+C A +   EA I GL +G+ Y FR+ A N+ G S P   + P + +   + P+  K   ++ T+         +   G PPP  TW+K+ I +  T  V     E     T K    +    D G Y++   N  G+    L++IVLD
Sbjct: 23416 FRVMAVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRD--KAGQRWVKCNKKALTDLR----FKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFK-----PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQ-----------VVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESL---DKASIESTS-------SYTLLVVGNVNR-FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS---ERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRW-------ATC-ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAF-KLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACRE----DVGHYTVKLTNSAGEATETLNVIVLD 24028          

HSP 14 Score: 234.958 bits (598), Expect = 7.832e-61
Identity = 196/662 (29.61%), Postives = 302/662 (45.62%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIEL---FSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G  E L +  ++ K     P PPK++EVT+I+K+S  V  + PD DGG+EI  YI+E  D   S  +W +  +      + ++V  L   H Y FR  A N  G+ +P   S   +  K  DP  +P  P    V+D + NS  LAW+ P  DGG+ I  Y +E  +     WQ           I T   G  +       L+E  EY  R+ A+NK G    +    +V  + +   P L         I ++ G + R  I F G P P +TW +        +D++ IE    F++ ++  C++N            D G Y +KL    G++ A   V VLD P  P+ L   E+R + + L W  P  DGG  + +YVI   +     +   + +   T   V+ L  G IY F V+A N+ G   P  T + +KA    +PPS P +  + D    S +L W+KP  DGG  I  Y+++ + K         T+  S  A      A + GLS G+ YQFR+ A N+ G+S P     P + +   + PS  K   ++ +++       +I V G P P+ +W K+G  +  T     TR   +  AT+  L + +S   D G YS+ A N  G    +L +IVL+
Sbjct: 25580 FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRD--RSGIRWIKCNKRRITDLR-LRVTGLTEDHEYEFRVSAENAAGVGEP---SPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKADEEEWQ-----------IVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSKEEGEF---TDKVQIEKGINFTQLSIDNCDRN------------DAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKAS---EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPK--------GTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSF-KLPFNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQT-----TRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLE 26192          

HSP 15 Score: 233.802 bits (595), Expect = 1.918e-60
Identity = 160/546 (29.30%), Postives = 267/546 (48.90%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            L + N  R  SG Y + + N  G     +NV ++D P  P  + +  + K+S  +   PP  DGG +I +YI+E  +  ++   ++ +     K   + K+ NL     Y FR  A+N  G+  P E + + + + +P   P  PGR +++D + N+  + W  PESDGG+ IT Y +E + K    W       ++  ++KT       +  T  GL  G EYVFR+ AVN+ G S P +    V+AK   +KP +  P      +K     + DI F G P  +V W+++G +L  ++ R+++   S KTV     T L++ +A+R  D G Y + +    G+      V VLD P  P  +  DE+  +++++SW  P  DGG  I++Y+++  +  +  W + +     T   +  L  G  YQF V A N+ G+S    +   + AE P+ PP  P  P +V     ++ + WQ P +DGG  +  Y ++ K++    W  A K         I + + ++ GL EG  Y++R+ A N AG
Sbjct: 26952 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRE--TTRKAYATITNNCTKN--TFKIENLQEGCSYYFRVLASNEYGIGLPAE-TAEPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-------SACTQVKT-------LETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELP-FNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLR-ETTRVNVA--SSKTV-----TTLSIKEASRE-DVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSES-SAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANK-------VLIADTQMKVSGLDEGLMYEYRVYAENIAG 27457          

HSP 16 Score: 231.491 bits (589), Expect = 9.497e-60
Identity = 182/639 (28.48%), Postives = 282/639 (44.13%), Query Frame = 0
Query:  608 KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMV---HGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNG---SLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS-----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +PDPP   EVT +SK    V  + P+ DGG  I  Y +E  +    + +W  V ++     + +KV NL+  H Y+FR +A N +G+ +P  +  + ++ KDP + P  P    V+D + +S  LAW  P  DGGAPI  Y +E + K         I + S  E     N    +     T   L E  EY FR+ A N+ G   P+E  +++  K     P +         + ++ G   R      G PAP VTW + G    +  G  D +    F            L +  + R  D+G Y++ L+   G +     V VLD P     L   ++     ++SWA P +DGG+ +T Y+++  + +   W     E K T   V  L PG+ Y F V AVN+ G   P    +P+ A +P   P  P++  + +    S TL W  P  DGG  I  YII  ++      +    D  +  + + +L   + GL EGK Y+FR+ A N  G S P      +E K  L   K L P          TIK  +    +  V G+P P   W K   ++ ++  + I    ++   ++ L +      D+G YSL AEN +G D   + + V+D
Sbjct: 20187 RPDPP---EVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKE--KHAVRWVPVNKS-AIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPS-LPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPK---------IADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF------------LVIPNSTRD-DSGKYSLTLVNPAGEKAVFVNVKVLDTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYRE------EDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLLPPKILMP-------EQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAI----HKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMD 20779          

HSP 17 Score: 227.639 bits (579), Expect = 1.494e-58
Identity = 166/577 (28.77%), Postives = 275/577 (47.66%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDP---WDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRI----SIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            I+       L + N  R  SG Y + + N+ G     + V ++D P PP  ++VT I+K+S  +   PP  DGG++IK+YI+E  + +  S  ++ V     K   S K++ L     Y FR  A N  G+  P   +       DP    + P  PG+ +V D + NS  L+W  PE DGG+ I  Y +E + K+   W +   + + D  I                L +G EY+FR+ AVN+ G S P   +  ++AK   ++P + +P   +  ++ G+  + ++   G P PS++W ++G + L  + RI    S++L           T L++ + ++  D G Y I +    G + A   +  LD P+ P+  +  DEI AE I LSW  P   GG  IT+Y+++  D     W + +     T   V  LK G  YQF + A N+ G+S    + EP+ A+ PYK P  P  P +     +S+ ++W +P ++GG P+  Y +++K++    W    KT        I + + +   L EG  Y+FR+ A N  G    S  ++ ++ R
Sbjct: 24778 IDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKN--SWKIDQLQEGCSYYFRVTAENEYGIGLPARTA-------DPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVI--------------TNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDV-RPAFSSYSVQVGQDLKIEVPISGRPKPSISWTKDG-MPLKQTTRINVTDSLDL-----------TTLSIKETHKD-DGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-EPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTI-------IHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 25307          

HSP 18 Score: 225.713 bits (574), Expect = 6.145e-58
Identity = 176/548 (32.12%), Postives = 253/548 (46.17%), Query Frame = 0
Query:  586 YKIIIRNAQG----FDERLINVNI-MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKG-GASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            ++I   N  G     D + + V     +P PP T  VT ISK+  +V+   P +DGG+++  Y +E  +   +S  W ++ +   +  K  K   L     Y FR  A N +G+  P ++S +  + +DP D    PGRP  +  + NS  L W  P  DGG+ IT Y +E K+   G W +    N  + E             T  GLVE   Y FR+ A N     S PSE+S ++ A+     P       Y   I +  G TF  +    G+P P + W ++G+ L   + R+ I+   +KT    K+ + T        D G YT+KL   GGT+     V VLD P  P   L    + AE   L+W  P  DGG  I+ Y+I+  +     W   + E +     V  L PG+ Y F V+AVNK G  E   + EP+ A NPYK P  P  P        S+ L W +P DDGG  I  YI++K+DK G  W          C  + + +L  R+ GL+EG  Y+FR+ A N AG   PS
Sbjct: 26266 FRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKE--KNSILWVKLNKIPIQDTK-FKTTGLDEGLEYEFRVSAENIVGIGKPSKVS-ECYVARDPCD---PPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFTNVVETEF------------TVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRT--------DGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALES-EPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRW--------TKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPS 26777          

HSP 19 Score: 225.328 bits (573), Expect = 7.678e-58
Identity = 195/661 (29.50%), Postives = 296/661 (44.78%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY-------NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA-TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++   N  G    L ++  + K     P PP    VT I++N+  V  + P  DGG+ I  Y +E  +++    + ++   AD K     +V  L   + Y FR  A N  GLS+P   S   I    P   P  P  P + D S  S DL W  P SDGG+PI  Y +EY++     W +   +N  ++ I+      P       GL+EGNEY FRI+A N  G   P E ++SV+AK       LH P +         I ++ G+T R      G P P +TW + G +L+ D  R+ +       ++      L + +A R+ D G Y I      G  Q +  VNVLD P   + L    +  E+  +SW  P D+GG+ IT+++++    +   W   + +  TK  VK  L   + Y F V A NK G      T  PI A NP   P EP+  +I D     V L+W++P  DGG P   Y ++++ K  G  D  +    S    I E    +    E + Y+FR+   N+ GES     T+  + +     P +D   S   T+K   T   +  V+G+P PE  W K+     +TD     R +    A ++K  ++K++  D G Y + A N  G       + VLD
Sbjct: 19465 FRVKAENKMGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLK----FRVTGLYEGNTYEFRVFAENLAGLSNPSP-SSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDR---INKDEL-IRQCAFRVP-------GLIEGNEYRFRIRAANIVGEGEPRELAESVIAKD-----ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDK-RVDL-------IHDLPRVELQIKEAVRA-DHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLK--GSADWERVHKGS----IKETHYMVDKCVENQIYEFRVQTKNEGGESD-WVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDK---DATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNVLD 20084          

HSP 20 Score: 224.172 bits (570), Expect = 1.777e-57
Identity = 206/790 (26.08%), Postives = 334/790 (42.28%), Query Frame = 0
Query:  464 QMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCG--PVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVN-INFHGDRVDLNVINPKREKSGSYKIIIRNAQGF-------DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT-----VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKV--NRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            Q    +   ++ Y    D G+         G K+VS       +M +     G CG   VS V  + C    S       Q D    +     E +    +N +   G+ +  + +  +  K+  Y   +R    +        E ++  N    P  P   E     K   +++ + P+ DGG EI +Y+++  +    S +W++V +        +KV +L+    Y+FR  A N  G S+P E S   I  ++P   P  P  P V+D +  S  LAW  P  DGG  I  Y +E +EK    W +      ++  I+ +         T   L  G +Y FR+ AVN  G S  SET+  +    R   P L         + ++ G + R  +   G P+P +TW + G           I+L ++  +   E  ++L V K NR  D G YTI+     G + AT  V V D P     ++  E+  + + ++W  P  DGG P+ +Y+I+  +      + A +T  TK +     + GL  G +Y F V+  N  G  EPC T + +      + P  P +  +VD    +VTL W+KP  DGG  +T Y+++  K     W   +             LE  +  L+EG+ Y FR+ A N+ G S P     P   +   + P+ID  +   KTI V   R     I + G PPP  +W+  G ++  ++ V +   E     T KL + ++ + D G Y+L  +N  G     + +I+LD
Sbjct: 30886 QYTGKRATAVIKYCDRSDSGKYTLTVKNASGTKSVS-------VMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLP-----QEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKRE--KKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNF-ISCREPSYTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVH----TNATIRNN-------EFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLEIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKG-----------IDLANRAIIDNTESYSLLIVDKVNR-YDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAA----MRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVS---EVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTV-------LEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRVLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGSKLRESERVTV---ETHTKVT-KLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD 31619          

HSP 21 Score: 223.402 bits (568), Expect = 3.099e-57
Identity = 166/558 (29.75%), Postives = 261/558 (46.77%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  +G + + I N  G     +NV ++D P P   +  T I+K+S  +    P  DGG+ I +YI+E  + +  S  +S V     K   + KV  L     Y FR  A N  G+ +P E +       +P    + P  P   +++D + N+  LAW  P  DGG+ IT Y IE + K    W              T ++    +    + L EG EY F++ AVN  G S P E S  V+ K + + P L   GIY   +  + G   + +I   G P P+VTW++ G  +L  + R+++E           +T+L + +  RS D+G Y +      G       + V D+P  P   +  DE+ ++ +  SW  P +DGG PI++YV++M   D+  W+  + T   + T K   L  G  YQF V A N+ G   P  T   + A  P+K P  P  P +      S+T+ W +P  DGG PI  Y I++K++ G  +  +       +A +     +  GL++G  Y+FR+IA N AG+S PS  ++P   
Sbjct: 22628 RYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS--YSTVTTKCHKC--TYKVTGLTEGCEYFFRVMAENEYGVGEPTETT-------EPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQW--------------THISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQRVNVE-------NTATSTILNINECVRS-DSGPYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVE-LATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVG-PGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTV------SKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFA 23142          

HSP 22 Score: 222.246 bits (565), Expect = 6.751e-57
Identity = 191/660 (28.94%), Postives = 297/660 (45.00%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLN--PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+ +N  G  E L        N+   P  P    V+ +++NS  V    P+ DGG+ +  Y +E  D  ++S +W +V +   K      S KV  LI    Y+FR  A N  G+  P  +    +  +DP   P  P    V DW+ +S DL W+ P  DGG+ IT Y +EYKE+              +     +V G  +V     GL EG  Y FR++AVN  G   P E +D +  K R + P L         I +  G   R   +  G+P P+VTW  N   L  ++   +IE  +  +    KN         RS   G Y++    +GG ++ T  V+VLDVP  P  +    D +  +   L+W +P DDGG+PIT+YVI+  + D   W     T   + ATV+GL  G  Y F + A N  G      T   +   +P   P  P++  + +    +V+L W  P  DGG  I +Y+++ +      F  +  D+      +   +  + GL EG  Y++R+ AVN  G+  PSF TKP  C+ +   P++D       T++V  +     +  G+P P+  W+K+   +   D   I         T  L  +K++  D+G Y +V EN  G  K    + V+D
Sbjct: 18078 FRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD--TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVG-PASLPSDPVTARDPVAPPGPPFP-KVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGK---------EEWEKGKDKEVRGTKLV---VTGLKEGAFYKFRVRAVNVAGVGEPGEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEA---AIETTAISSSMVIKN-------CQRS-HQGVYSLLAKNEGGERKKTIIVDVLDVP-GPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPFVETPNALVIRDPITVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDN------LLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIK----TTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD 18699          

HSP 23 Score: 221.09 bits (562), Expect = 1.574e-56
Identity = 188/673 (27.93%), Postives = 297/673 (44.13%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD---------VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECE 1238
            +++   N  G  E +    I+     D P PP  +E + I+K++  +    PDDDGG+ I  Y +E +D    +++W +  +   K   + +V  L NK +YRFR  A N  G   P   S + I+IKDP D P  PG+P+V D    S  L W  PE DGGA I  Y I             E+L T   E      G P       GL+EG EY FR++AVNK G S PSE SD VL + +   P   +   + NI  K     ++ +    GG P  +   E+       D  R   +     TV   K TV  +T+ +       Y  ++  +    Q+  Y  + D          P  P  L   ++   H++L W  P +DGG PI  Y+I+  +     W+ A +T   D    V  +  G   QF+V A N+ G   P    E +  E+P  PPS P + ++ D   + + + W+ P  +GG PI  Y ++        W           + +++E      G+   K Y  R+ AVN  G S PS  ++  + +  +  P+ID  +     I+  +  I  +  +  P P  +W+K+G ++ ++D + +  +      +A L V KS   DAG Y++  EN+ G     +++ V+ L   C+
Sbjct: 15644 FRVAAENMYGVGEPVQAAPIIAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLD--PDTDKWVRCNKMPVKD-TTYRVKGLTNKKKYRFRVLAENLAGPGKPSR-STEPILIKDPIDPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVI-------------EMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINI-TKNTADLKWTVPEKDGGSPITNYIVEKR------DVRRKGWQTVD-TTVKDTKCTVTPLTEGS------LYVFRVAAENAIGQS-DYTEIGDSVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEE------GIVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLNI-PVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHI----SAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCK 16273          

HSP 24 Score: 219.55 bits (558), Expect = 4.242e-56
Identity = 158/576 (27.43%), Postives = 269/576 (46.70%), Query Frame = 0
Query:  557 KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KV  +  INF      L++ N  R  +G Y + + N+ G     + V ++D P PP+ + V  + K+S ++   PP  DGG ++K+Y+I+  +  S+   ++ V+    K   S +V NL     Y FR  A N  G+  P E S   +   +P   P  PG+ ++ D S  S  L W  PE DGG+ I  Y +E + K    W              + V    + +    GL  G EY FR+KA N+ G S P      V+AK   ++P    P      ++ G   + +I   G P P ++W ++G   L  + R+++E  +        +T+L + ++++  D G Y++      GT      V VL+ P  P   +  DE+ A+ + +SW  P   GG  I++Y+++  D    +W + +     T   +  LK G  YQF + A N+ G+S P  + +P+  + P+K P  P  P +       + ++W +P +DGG  +T Y +++K+K    +  L       +  I + + +  GL EG  Y+FR+ A N  G   PS  ++ ++ R
Sbjct: 25857 KVQIEKGINF----TQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCNK--TSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDA-VKASEP---PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKW--------------SVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLP-FNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGE-PLKQTTRVNVEETA-------TSTILHIKESSKD-DFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDS-KPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLN------KIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVAR 26389          

HSP 25 Score: 219.55 bits (558), Expect = 5.164e-56
Identity = 167/519 (32.18%), Postives = 243/519 (46.82%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            P PP T +VT ++K+S  +    P  DGG+ I  Y IE  +   +   W  V++A   G    K   L +   Y FR  A N  G S P + S + +   DP D    PG+P  L+ + ++  L WA PE  GG  IT Y +E ++   G W +    N  + E             T  GL E   Y FR+ A N  GA S PSE SD++  +     P +     +   I +K G  F+ +    G P P++ W ++G  L G + ++ I++    T    K++  T        D+G Y +     GG  +    V VLD P  P   L   ++ +E   LSW  P DDGG  I  Y+++  +     W   A E + TK  V  L  G+ Y F V+AVNK G  EP  + EP+ A +PY PP  PK P +      S+ + W  P  DGG  I +YI++++DK G  W    K         + +L  ++ GL+EG  Y+FRI+A N AG S+PS
Sbjct: 23048 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKE--RNGILWQTVSKALVPG-NIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPS-EPMFALDPID---PPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEF------------TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEG-TGKLEIKIADFSTHLINKDSSRT--------DSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES-EPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNK-------KALTDLRFKVSGLTEGHEYEFRIMAENAAGISAPS 23530          

HSP 26 Score: 218.779 bits (556), Expect = 7.023e-56
Identity = 193/642 (30.06%), Postives = 283/642 (44.08%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQA--DGKGPKSIKVN--NLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLV----EGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDA--SCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA---TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P PP   +V   +K S +V  +PP D+GG+ I  Y +E  +       WS+V++A     G K ++ N   LI   +Y+FRA A N  G+  P E S    +  DP   P  P  P V D + +S  LAW  P  DGG+PI  Y +E +E+    W+               VN    +   C+ +V    E  +Y FR+KAVN+ G S PS+T+  + A      P  F+       +  K G   +      G P P  +WE +G       D +       +    E ++V+ + +  R+  +G Y+I      G + A   V V+D P  P+ L   +I      LSW  P DDGG  I  YVI+   ID   W         T   V  L     Y F V A N+ G   P  T++   A +P  PP  P +  I      +V L W+ P +DGG P+THYI++       W    K  +A   C  R ++ELE  +  L EG  Y+FR+ AVN+AG S PS    P + + +   P+I+  +     +   VN  A    K+KG P P  TW+K   +   + E ++            T  L + +S+  D G YS+ A N  G    ++ L VL
Sbjct: 17388 PGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKRE--EGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPS-DPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKP--------------VNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLVCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECTRA-HSGKYSITAKNKAGQKTANCRVKVMDAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVE----CLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTCPPAIELKEFMEVEEGTDVNIVA----KIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVL 18003          

HSP 27 Score: 216.083 bits (549), Expect = 5.690e-55
Identity = 182/632 (28.80%), Postives = 269/632 (42.56%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHG--TCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK--TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            PD P   E ++++ NS  +  + P+ DGG+EI+HYI+E  +    S +W +V           KV  L+  + Y F   A N  G+     IS + I  ++P + P  P    V D S  +  L WA P  DGG  I  Y IE  +  +G W +              VN +P V    T   L  G EY FR+ AVN  G     E + ++ A  R   P L     +     ++ G + R  I + G P P+  W +  S L   +D  + + FS           LTV   NR+ D G YT+ +  + G +  T  V VLD P  P  +   ++      L W  P  DGG  I  YVI+  +     W    E K T+  +K   L  G  Y F V A N+ G  EP    EPI A    + P+ P+  ++VD    S  L W KP  DGG  IT Y+++ + K    W +A  T          +L   +  L E   Y+FR+ A N AG S P       + +   + P+ D    +++  T K   T    + + G P P+ TW    +++  TD + I   + +      L V  S   D+G Y L  EN  G     + ++V+
Sbjct: 29941 PDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERRE--KKSTRWVKVISKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGIS-RLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHK--------------VNTEPCVKTRYTVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFS----------TLTVENCNRN-DAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRSWQVVSE-KCTRQILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPIVAT---EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEAGHT---------KQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIATTKDR----TTLTVKDSMRGDSGRYFLTLENTAGVKTFTITVVVI 30527          

HSP 28 Score: 215.312 bits (547), Expect = 9.414e-55
Identity = 181/628 (28.82%), Postives = 281/628 (44.75%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQ--WSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ---GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL-LGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            V+G  + DI  S  K+GK +   + V++     RV+L +    R   G Y I  +N+ G  +    VN++D+P P + ++V++++K +C +    P D+GG+EI ++I+E        NQ  WS VA    K  + +K N L N + Y FR  A N++G+  P   +   I+  +P D P +P    + D       L W  P+ DGG+P   Y +E + K    W++   G I  T               H      VE   Y FR++  N+GG S    T + V+ K    KP L       + +K G T R +    G+P P V W ++     L  S R+ I+  ++ + +       ++TKA RS D G Y I      G+  A   VNVLD P   R L   ++ ++   + W  P DDGG  I +Y+++  +     W   +       ATV  L  G+ Y F V A NK G   P  + +P+ A+  Y  P  P  P +     + +T+ W  P  DGG+ IT Y ++KK+K    W    K       + I E   ++  L  G  YQFR+ A N+ G   PS  ++P + +     P          T K + T  W
Sbjct: 19721 VKGRPEPDITWS--KEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEY----RKPNQKGWSIVASDVTK--RLVKANLLAN-NEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKET---------------HYMVDKCVENQIYEFRVQTKNEGGESDWVRT-EEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAESSKF-------SLTKAKRS-DGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNK-------SAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAW 20306          

HSP 29 Score: 214.927 bits (546), Expect = 1.079e-54
Identity = 180/615 (29.27%), Postives = 279/615 (45.37%), Query Frame = 0
Query:  616 EVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS---IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF-LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQ 1221
            E+++++KN+  V    P DDGG+EI  Y +E  +      +W +      K P S    KV  L   + Y FR  A NR G+  P + S   +++KD    P  P    V D +  S  LAW  P  DGG  IT Y +E+++     W    I +T+   ++       +       L    +Y FRI A+N  G   P+   +  + +      F L       + ++ G + R  +   G PAP VTW ++   L     R +IE         E  T+L + + NR  DTG + + +    G +     V VLD P     L P +I  + + L W  P  DGG+ IT+Y+++  +     +   + TK  K T  V GL  G  Y F V+A N+ G  EP  T EP++A    + P  P   NI+D    +V+L W KP  DGG  IT Y+I+ + K    +  + T        +  LE  +  L+EG+ Y F+++AVN AG S+P  E++P + + + + P +D      K +  +       +I V G P P  TW K G QI    +    R   +  AT+  L +++    D+G Y L A+N  G+
Sbjct: 22368 EISNVTKNTATVSWKRPTDDGGSEITGYHVERRE--KKGLRWVRAT----KTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNP-VLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAW----IKDTTGTALR-------ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL---KHRANIE-------NTESFTLLIIPECNR-YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSY-STVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTEPVRAS---EAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHIST--------VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQ----RVNVENTATSTILNINECVRSDSGPYPLTAKNTVGE 22935          

HSP 30 Score: 214.927 bits (546), Expect = 1.117e-54
Identity = 171/559 (30.59%), Postives = 263/559 (47.05%), Query Frame = 0
Query:  604 NIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKP-FLHQPGIYN-IEIKKGRTFRYD-IWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            ++ D P PP  ++V H   +S  +  + P   GG+ I  Y IE  +   +S  W +  +   +  K  KV  L     Y FR  A N  G+  P  +  + ++  DP D    PG+P V+  + NS  L W  P+ DGG  +T Y +E ++     W +   +N  D               T   LVEG +Y FRI+A N  GA S PSE++ +++ K  Y  P  +  P I + + +K G +     I   G+P P  +W R G  +   SD   I            +++LTV  A R  D G YTI      GT++    V+VLDVP  P  +    + AE   L+W  P +DGG+PI +YV++  +     W    E  +  +  V  L  G+ Y F V AVN  G+ EP ++ EP+K  + + PP  P +P I +    + T+ W++P+DDGG  IT Y +++++K G  W  A KT        + +L  ++ GL EG  Y+FR+ A N+AG   PS  + P L +     P     +  + T K + +  W
Sbjct: 21963 DVPDAPPPPNIVDVRH---DSVSLTWTDPKKTGGSPITGYHIEFKE--RNSLLWKRANKTPIRM-KDFKVTGLTEGLEYEFRVMAINLAGVGKPS-LPSEPVVALDPID---PPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAF------------TVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAGKDIR-PSDIAQI-------TSTPTSSMLTVKYATRK-DAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGEPVQS-EPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTP-------VSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAW 22482          

HSP 31 Score: 214.157 bits (544), Expect = 1.978e-54
Identity = 170/592 (28.72%), Postives = 285/592 (48.14%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKN----SCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            E  + Q+  I        + + N +R   G Y ++ +N  G  ++ I V+++D P P   + +  +S N    SC +    P+DDGG+ I +Y+I+  +  +    W+ V     +  ++  V  LI    Y FR  A N IG+  P   +   ++I+DP   P++P    V + + N+  L W  P+ DGG+ I +Y +E   + +G  +  ++ N + +  K           T KGL EG+ Y +R+ AVN  G   PS  +  +  K     P L       + ++ G +F     + G+P P + W ++ + +L D DR  I+  +  T+  EK      TKA RS D+G Y + +    G+++    VNV+D P  P  + P   DE+  E++ +SW  P DDGG+ IT+Y+I+  ++    W+     +  T   V  L  G  Y F + A N  G S+P  + + +KA++ ++ P  P++P + +    S  + W KP +DGG+PIT+YI++K++     W    K      E      + R+P L EG  Y+FR+ A N+ G   PS  +KP   R     PS
Sbjct: 18351 ERALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLDVPGP---VGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKRE--ADRRAWTPVTYTVTR--QNATVQGLIQGKSYFFRIAAENSIGMG-PFVETPNALVIRDPITVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLE--SRLIGTEKFHKVTNDNLLSRKY----------TVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLED-DRTHIKT-TPTTLALEK------TKAKRS-DSGKYCVVVENSTGSRKGFCQVNVVDRPGPP--VGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVS-DSMKAKDRFRVPDAPEQPVVTEVTKDSALVTWNKP-NDGGKPITNYILEKRETMSKRWVRVTK------EPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFARDPIAKPS 18903          

HSP 32 Score: 213.386 bits (542), Expect = 3.243e-54
Identity = 167/577 (28.94%), Postives = 265/577 (45.93%), Query Frame = 0
Query:  560 QDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGK--PMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN--GDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            + V I   G + +L + N  R+  G Y I   N+ G     + V + D P P   ++    ++  C++  S P DDGG++I  +IIE  D  +  + W Q  + +        +  LI    Y+FR  A N+ G   P EI    I+  DP   P  P R +  + + ++  L W  P SDGG+PI  Y IE +             +  D E    VN +  P      + L E   Y FR+KAVN  G S PS   + V+           +  +    I++K G          G P P + W +N  ++   +D ++I    ++    E  T L++ KA R  D G YTI      G+     +V V D P  PR L   +I+AE   L+W  P D+GG+ IT Y+I   D      +W     T  + +  +  L P   Y+F V AVNK G S+ C++ + +  ++PY+ P  P +P +++    S+ + W  P D+GG PIT Y ++K+++ G ++  +     + +  +  +E  +P L EG  YQFR +A+N AG   PS  + P + 
Sbjct: 16937 ERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKD--AKMHTWRQPIETERS---KCDITGLIEGQEYKFRVIAKNKFGCGPPVEIG--PILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRRH-----------DKPDFE---RVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIDKPTDTLNIT--KEEVSRSEAKTELSIPKAARE-DKGTYTITASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGISDECKS-DKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPIT-KVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVA 17487          

HSP 33 Score: 212.231 bits (539), Expect = 8.648e-54
Identity = 168/557 (30.16%), Postives = 251/557 (45.06%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERN--------GSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            +++   N  G  E L +  ++     D P  PK   VT ++K+   V    PD DGG+ I  Y+IE  +   +S  W +      +         L+    Y FR  A N+ G S P + + + +  + P D    PG+P V+D + NS  L WA P+ DGG+ I  Y +E  +     W +    NT+  +I       P    T  GL E  +Y FR  A      S PSE SD V      + P +         + +K G     D    G+P P+V+W+++        G  +    +  ++ELFS                 NR  D+G YTI      G++ AT  + VLD P  P  +  +++ A+   LSW  P +DGG+ IT+Y+I   +    +W     T   T  TV+ L  GH YQF + A NK G  +P  T EP  A+NPY PP     P I +     +T+ W+ P+DDGG PIT Y+++K++     W    +         + E   +  GL EG  Y+FR+ A+NKAG   PS  +K
Sbjct: 20853 FRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKE--RNSLLWVKANDTIVRS-TEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT-EYVTARMPVD---PPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVR---CNTTPHQI-------PQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKRNLCTLELFS----------------VNRK-DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPILT-EPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKP-------VIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASK 21367          

HSP 34 Score: 207.608 bits (527), Expect = 1.941e-52
Identity = 164/571 (28.72%), Postives = 251/571 (43.96%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            I+    R  L + N  R  SG Y + I+N          V ++D P PP  I V  ++K + ++    P++DGG  +K+Y IE  + S  +  W  V     +   S KV NL     Y FR    N  G+  P E + + + I +    P+K G  SV   S +S  L+W  PE DGG+ I HY +E  EK    W +  ++ T+              H    GL E +EY FR+ A N+ G S P E    VL K +   P +       + + ++ G   + DI   G+P P VT  R+G + L  + R + E+ ++      K +V T        D G Y I      GT +    + VLD P  P   +   +I  E + L W  P  DGG+ +T+Y++   +     W     T   T   V  L  G  YQF + A N+ G S+   ++  +  + PY  P  P  P + +   +S+T+ W +P  +GG  +T Y ++ KD+    W  A K         I     ++  +S G  Y+FR+ A N AG   PS  ++P L 
Sbjct: 28022 IDSTDSRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKA--WVSVTNNCNR--LSYKVTNLQEGAIYYFRVSGENEFGVGVPAE-TKEGVKITEKPSPPEKLGVTSV---SKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTT--------------HHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDG-VPLKATMRFNTEITAENLTINLKESVTT--------DAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSV-CVVVKLPYTTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANK-------MIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLA 28553          

HSP 35 Score: 207.223 bits (526), Expect = 2.799e-52
Identity = 175/618 (28.32%), Postives = 285/618 (46.12%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS------VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY---NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLL----------------GDSDR---ISIELFSKKTVYCEKN--TVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDID--NGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            +S  KDGKEVK    + +        L V       +G Y I + N  G     INV ++  P P K I+ + I+K+SC +   PP+ DGG+ I HY++E       + + + +    G+   S  V +LI    Y FR +A N+IG        G+ I +K+P    D    P       V + ++ +  + W  P  DGG+ I  Y IE   K    W+            + + +  P++  T KGL EG EY FR++A N  G   PS  +      T+ + P +  P +    ++E+K+G     D    G P P++TW ++ ++++                G+++     S+ L  + ++   K   + L +  + R  D G Y IK+  D G  +A   V+VLD P  P     ++IR + +   W  P DDGG+ I +Y ++  D    + DW+    T ++ K +V  L  G  Y F V A N+ G   PC + +P+ A++P++PP  P +P + D  + S+ ++W +P D+G  PI  Y ++K++     W    KT  +S + ++D       GL EG  Y FR+ A N AG    S  + P   R
Sbjct: 16207 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLE----RREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIG-------GGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWK------------RCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRAT----PPTKAVDP-IDAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTERLSINNSKQGESQLRIRDSLRP-DHGQYMIKVENDHGVAKAPCSVSVLDTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLLAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVNKTLLSSLKTKVD-------GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAR 16786          

HSP 36 Score: 207.223 bits (526), Expect = 3.127e-52
Identity = 225/807 (27.88%), Postives = 346/807 (42.87%), Query Frame = 0
Query:  394 TCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQV--KDPSAPVDF--FLNGKIIVPGADTRMEVKQMGDGKHQLIVHY--ITMEDYGQIEARTPTNH-------------GDKTVSCTGS-------FNVIMGEKAPKLGDCGPVSGVAHKD--CNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSG---SYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKG-SSSSKTIKVNRTAIW 1156
            TCAT K + ++   +    ++   VS+QNE    +    +V V  KD   P  F    N   ++ G D +++V  +G     +  H   I ++   ++ A +  N+             G  TV  T S        NVI+ +K       GP +G    D      V+ + E  K  D   S+     E +             V    I   R K+G    ++I   N  G    L +  ++ +     P PP T  VT  SK+S  V+   P  DGG+++  Y +E  +   +S  W ++ +      K  K   L     Y FR  A N +G+  P + S +     DP D    PGRP  +  + NS  L W  P  DGG+ IT Y +E KE   G W +    N  D + +              GL+E + Y FR+ A N  G  S PSE++ ++ A+     P +     Y   + ++ G +F+ D    G+P P+  W + G   L  + R+ I    K T +    T L+V  A R +D+G+Y +K     G +  T  V VLD P  P   +    + AE   L+W  P  DGG+ IT+Y+++  +     W L     +     V  L  G+ Y F ++AVNK G  EP  + E + A+NP+  P  PK P +      S+ + W++P+ DGG  I  Y+++K+DK G  W          C  R I EL  R+ GL E   Y+FR+ A N AG S PS    P     K   P    G  ++ K + V R++++
Sbjct: 23886 TCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKP------GPPTGPVKMDEVTADSVTLSWEPPKY-DGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKE--RNSILWVKLNKTPIPQTK-FKTTGLEEGIEYEFRVSAENIVGIGKPSKPS-ECYAAHDPCD---PPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFE------------VTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVK-GDQELSSTARLEI----KSTDFA---TSLSVKDAVR-VDSGNYILKAKNVAGEKSVTINVKVLDRPGPPEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLES-ESLIAKNPFVVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRW--------TRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPS----PPSAYQKACDPIYKPGPPNNPKVMDVTRSSVF 24644          

HSP 37 Score: 204.142 bits (518), Expect = 2.673e-51
Identity = 185/667 (27.74%), Postives = 278/667 (41.68%), Query Frame = 0
Query:  586 YKIIIRNAQG-----FDERLINVNIMDKP---DPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP---KSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG---EILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK------GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            ++I   N  G       E  I  N  D P   DPP    +++I+K+   V    P DDGG+ I  Y++E  +  + +  W++V     + P   +++K   L     Y FR  A N+ G   P + S + +  +DP   P  P  P V D + +S  L+W  P  DGG+PI  Y +E K      W +    E L  +  E+               GL+E  EY FR+ AVNK G S PS+  D    K   + P     G  + E++K      G T R  +   G P P +TW +    L    +RI +++ S      + +T L     N+  D G Y + L    G ++ T  V VLD P  P  +   E+  +   ++W  P  DGG+PI +YV++  D +   W     E   T   V  L+ G  Y F V A N+ G  +P  T + +KA     P  + K   I      S T+ W+KP  DGG  IT Y++    +   W   +K+           L+     L EGK Y FR+ A N+ GE +PS                +          K N     +I +KG+P P  +W K    +A+   V +            L V   Q  DAG Y++  +N  G  +  L + V+
Sbjct: 21249 FRICAENKYGVGDPILTEPAIAKNPYDPPGRCDPPV---ISNITKDHMTVSWKAPADDGGSPITGYLVEKRE--TQAVNWTKV----NRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDAS-KAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEV--------------TGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPP----EGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL---RERIGLDIKS-----TDFDTFLRCENVNK-YDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKALAIT---KSSCTIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLS---------LQYSTKDLKEGKEYTFRVSAENENGEGTPSEIVVVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE----STAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVV 21862          

HSP 38 Score: 203.371 bits (516), Expect = 4.023e-51
Identity = 173/609 (28.41%), Postives = 267/609 (43.84%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYK---EKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN---IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            IN    R  + V +  + K   +++   N  G  + L +V I+ +     P  P   EV ++S N+  ++   P  DGG++I  Y +E  +   ++  W +    + K P    + KV  L+    Y+FR  A N  G+S   E S + I+ ++P D    PGRP V D + ++  L W+ P  DGG+ +  Y IE K   E   G W +      SD               T   L EG+ Y FR+ A N  G  S  SE++  V  +  Y  P            + I+ G     D   GG+P P + W + G   L   ++IS++       Y  K     +   +RS D+G YT+ +    GT+  +  V VLD P     L    +  E   L+W+ P +DGG  IT Y+++  +    +W+    E       V  L   + Y F V AVNK G   P  + EPI A N +  PS+P  P  V    + + ++W KP  DGG  I++Y++ K++K    +  +  D    + R+     ++  L EG  YQFR+ AVN AG S PS  +    CR  + TP          T K + +  W
Sbjct: 30580 INSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESVPIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKE--RNTILWVK----ENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS-RPIMAQNPVD---PPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD------------NFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDKELDLCEKISLQ-------YTGKRATAVIKYCDRS-DSGKYTLTVKNASGTKSVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVES-EPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRL-----KVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKRSISLAW 31151          

HSP 39 Score: 202.986 bits (515), Expect = 4.935e-51
Identity = 180/649 (27.73%), Postives = 290/649 (44.68%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGL---SDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-------YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF-GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            E ++  N    P PP   EVT I+KNS  V    P  DGG+EI  Y +E  D  S +  W +V +   +  +  KV  L     Y++R  A N  G+   S+P +         DP D P  P +  + D + +S  L W+ P  DGG+ +T Y +E K+     W    I++T   E++T              L  G  Y F++ AVN  G   P   ++   AK       L +P I        ++  K G   +  I F G P P+VTW R     LG   R SI+         + +++L + +  R+ DTG Y + +    G  + +T  V VLD P   + L    +    + L W  P  DGG+PI +YVI+  D     W + + +   T   V  L     + F V+A N+ G  EPC T EP+KA    + P+  ++ ++ D    SV L W KP  DGG  IT Y++++K K    W  A  +   +CE  I +L+       E    +FR+ A N+ G+S P     P   +   +TP +D      +  ++++      ++  KG+P P  +W K+G+ +  ++ V  ++ E +      L +  S+    G Y+++ +N   ++   + +I L
Sbjct: 28844 EPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLA--WLKVLKETIRDTRQ-KVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKA----ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQGDEEEWT---IVSTRG-EVRT-------TEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKD-----VLEEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTW-RKDEKNLGSDTRYSIQ-------NTDSSSLLVIPQVTRN-DTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA---EVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISK--TCEIEIGQLK-------EQSVLEFRVSARNEKGQSDP-VTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENK----ITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIITL 29443          

HSP 40 Score: 201.06 bits (510), Expect = 2.062e-50
Identity = 163/541 (30.13%), Postives = 248/541 (45.84%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI---KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-----LAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEP-IKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            P PP+T+++  +S++   +   PP+DDGG+++  YI+E  +V +  ++W +V     K P ++   +   LI    Y  R  A N  G   P   S   + + DP   P KP  P V D +  S  LAW++PE +GG+ +T Y IE ++     W +    NT+  +I+           T   L +G EY FR+ A N GG   P+E   +V     L    Y     +Q G++   +++G   R  I   G+P P   W + G  +   S R  I          E +T L + +A+R+ D+G Y + L    G +     V V+  P  P   L  D+I+A  + +SW  P DDGG  I  Y+++  ++    W       + T   VKGLK    Y F V A N+ G S+P ++ EP I       P      P ++D    SV+L W +P DDGG  +T Y I++K+     W    KT       +I      + GL     YQFRIIA N  G S  S  ++P +C+     PS
Sbjct: 31721 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRA--DRWVRV----NKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAM-DPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTK---CNTTPTKIR---------EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGVF---VRQGGVIRLTIPIKGKPFPVCKWTKEGQDI---SKRAMI-------ATSETHTELVIKEADRN-DSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKT-------QITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPS 32221          

HSP 41 Score: 199.519 bits (506), Expect = 7.262e-50
Identity = 160/586 (27.30%), Postives = 256/586 (43.69%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI-KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI 1158
            R  +G Y I   N  G     + V + D P P  ++ V  +S++S  +    P  DGG  + +YIIE  + +  + +         K  K++ +++ L+    Y FR    N  G+ +P E S   ++ + P      P +  V+D + ++  LAW  P  DGG+ +T Y +E  +     W +   L  + +E             T   L EG +Y+FR++A N+ G S P E    V  +   + P +    +    I +  GR     I   G P P+ +W   GS L  +S+R+++E  +K T    + T +         DTG YT++L    GT   T  V +LD P  P   +  DEI A  + +SW  P  DGG P++ YV++  D     WL   E+  T+ T K   L  G+ Y F V A N+ G     ++ E I+  +    P  P+   I D     +TL W  P DDGG  +T YI+++K+ +   W    K         +     R  GL EG  Y+ R+ A+N  G   PS  +KP +       P   +    + T + + +  W +
Sbjct: 31298 RYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFK-----TVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPL----VPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLE------------HTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRVLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGSKLR-ESERVTVETHTKVTKLTIRETTIR--------DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESV-TRPTFKFTRLTEGNEYVFRVAATNRFGIGSYLQS-EVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP-------VTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSV 31844          

HSP 42 Score: 198.749 bits (504), Expect = 1.038e-49
Identity = 173/586 (29.52%), Postives = 255/586 (43.52%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRN--AQGF---DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNT---VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKG 1141
            R  L V   K      ++I   N   Q F    E ++      +P PP T  VT ISK S VV+   P ++GG+ +  Y +E  +   +S  W++V +      +  K  NL     Y FR  A N +G+    + S +  + +DP D    PG P  +    N   L W  P  DGG+ IT Y +E ++   G W +    N  + +             T  GL E   Y FR+ A N  GA S PS+++  + AK     P +     +   I +  G TFR +    G+P P++ W R G   + +S R  I           KNT    L + K    ID G Y ++     G++     V VLD P  P   +    + AE   L+W+ P  DGG+ I+ YV++  +     W + A E       V  L  G+ Y F ++AVNK G  EP  +  P+  +NP+  P  PK   + +    S+T+ W +P  DGG  I  YI++K+D+ G  W    K        RI +L  R+ GL+E   Y+FR+ A N AG   PS    P    +K   P    G
Sbjct: 25168 RTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKE--RNSILWTKVNKTIIHDTQ-FKALNLEEGIEYEFRVYAENIVGVGKASKNS-ECYVARDPCD---PPGTPEAIIVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQF------------TVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR-GDKEIEESARCEI-----------KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESA-PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNK-------RRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS----PATVYYKACDPVFKPG 25710          

HSP 43 Score: 195.667 bits (496), Expect = 9.077e-49
Identity = 190/645 (29.46%), Postives = 283/645 (43.88%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS-----VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWE-RNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQI-ASTDEVLITREEY-QGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            L+  +  + PD P    V  ++ NS +VK + P D+G + I  Y +E  +V+S+   WS+V +      K+ KV+ L+    Y FR  A N  G   P + S       DP    D    P      V D SS + +L W  P  +GG  I  Y ++ +      W +        I+++           T K + EG +Y  R+ AVN  G   P ET    +A+ +          +   I+I  G+T R      G P P+  W    G L   D +R+ IE    K+    KN +          D G Y I      G++ A   V V DVP     L P     +   L+W+ P DDGG+ IT ++I+  D     W   +ET+ +K  + GL  G  Y+F VIA NK G   P   + PI A +P  PP+ P+     +    ++TL W++P  DGG PI  YII+K+      F+ +        + + E       L E + Y+FR+ AVN  GES PS      + +   + P+I  + +    TIKV       I   V G P P+  W KN   I   TD + IT+EE  +  A  +L + K+   D GTY++ A NR G    ++ + V D
Sbjct: 16683 LLAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNST--HWSRVNKTLLSSLKT-KVDGLLEGLTYVFRVCAENAAG---PGKFSPPS----DPKTARDPISPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSR---CTEKMIKVR---------QFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPVPTKVWTIEEGEL---DKERVIIENVGTKSELIIKNALRK--------DHGRYVITATNSCGSKFAAVRVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVE-IGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE------NLDEHQMYEFRVKAVNDVGESEPSLPLN-VVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYD 17285          

HSP 44 Score: 193.356 bits (490), Expect = 5.318e-48
Identity = 178/646 (27.55%), Postives = 277/646 (42.88%), Query Frame = 0
Query:  586 YKIIIRNAQG------FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGS------LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENR 1218
            +++   NA G        + ++  +    P PP  + V  ++K    +K  PP +DGG  I+ YIIE  +      +W +  +  G    + +V ++I     +F+ RA N  G+  P E + + + I+DP   P  P    V D       +AW  PE +GG+PI  Y +E        W +       D++ K +           +G+V   EYV R++AVN  G S PSE S++V+AK    KP +     ++I + +G      + F   P P+V+W ++G        L   +D IS  L   K+V+                D G YTI L    G+  A+  V V+ +P   + +   +I      L+W  P  DGG+PI  YV++  +     ++  M  ++  + TVK L P   Y F V AVNK G  E      P+ A++P +PP  P +  + +   +++T+ W+ P  DGG  I  YII+K  K    +          E  +  L     GL EGK YQFR+ A N AG   PS  T P         P +     +S  +K          + G P P  TW K        DE +I  EE +  A   +   K +  +   +SL    R
Sbjct: 15944 FRVAAENAIGQSDYTEIGDSVLAKDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKE--KLGTRWVKAGKTSGPD-CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT-EILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVE-----------EGIVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDL-ETHDIVVIEGEKLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHA---------------DAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCN------EHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPIDAPKVI--LRTSLEVKRGDEIALDATISGSPYPTITWIK--------DENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTER 16542          

HSP 45 Score: 192.971 bits (489), Expect = 6.093e-48
Identity = 160/527 (30.36%), Postives = 238/527 (45.16%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQ---VAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKG-GASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            P PP T +V H +K++ VV    P +DGG+++  Y +E  +   SS  WS+   V  AD +    +KV+ L     Y +R  A N  G+    + + + +  +DP D    PG+P V + +  S  L W+ P  DGGA IT Y +E +E   G W +    N  +             +     L E   Y FR+ A N     S PSE++  +  K     P +     +   I +K G   + +    G P P ++W ++G  +    +R   E+ S      +  T LTV    R  DTG Y + L    GT+       VLD P  P   L  + + AE  +LSW  P +DGG  I  Y+++  +     W +   E + T   V  L  G+ Y F V  VNK G  EP  ++  +KA +P+  PS P    I      S+TL W +P  DGG  I+ YII++++K    W    K         + +L  +  GL EG  Y++R+ A N AG S PS ET P
Sbjct: 27376 PGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKE--RSSILWSKANKVLIADTQ----MKVSGLDEGLMYEYRVYAENIAGIGKCSK-ACEPVPARDPCD---PPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNVQE------------TYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEI---EERAKTEIVS-----TDYTTTLTVKDCVRR-DTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMA-VKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKP-------VYDLRVKSTGLREGCEYEYRVFAENAAGLSLPS-ETSP 27862          

HSP 46 Score: 191.045 bits (484), Expect = 2.627e-47
Identity = 153/545 (28.07%), Postives = 242/545 (44.40%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLT---VTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            ++I   N  G  + + +V ++ K     P PP T  V+++++ S  V    P  +GG+ +  Y +E  D   +S  W +  +   +     KV  +     Y FR  A N  G+  P   S   + I    D  + P    + D S NS +L+W  P  DGG+ IT Y +E ++   G W +    N  + +             T  GL + ++Y FR+ A N  G  S PSE    +     Y  P +  P  Y   ++ + G + +      G+P P++ W ++             EL +   V  E +T L    +  ANR +++G Y +KL    G+  AT  V +LD P  P   +    + AE I L W  P DDGG  IT Y+++  +     W + A   ++   T   +  G+ Y F V AVNK G  EP  + EP+ A+N +  P  P  P +      S+T+ W +P+ DGG  I  Y ++++DK    W   LK         I +   ++ GL+E   YQ+R+ AVN AG
Sbjct: 28431 FRIKAENRFGISDHIDSVCVVVKLPYTTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKD--RNSILWQKANKMIIRT-THFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAI----DACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQF------------TVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDK-----------ELQTNALVCVENSTDLASILIKDANR-LNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLES-EPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLK-------ETIRDTRQKVTGLTENSDYQYRVCAVNAAG 28936          

HSP 47 Score: 185.652 bits (470), Expect = 1.189e-45
Identity = 168/584 (28.77%), Postives = 266/584 (45.55%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPK--REKSGSYKIIIRNAQGFDER-LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPG---RPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP---FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDV--PEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            E  +G D   +         ++ P+  R  +G Y + I N  G  +   ++V ++D P   + ++V H+S  +  +   PP  DGG+ I +Y+IE  D  ++   WS V+        S KV +L  K  + FR  A N IG+ +P E +       +P    + P      S+ D +  S  L+W  P+ DGG+ IT Y +E K K    W    I  T +IEI                L E +   FR+ A N+ G S P  T   +  K   + P       PG   I ++ G     ++ + G+P PS++W ++G L L +S+ +    FSK      +N +    K ++    G YT+ L  D    + +  + ++ +  P KP+  +  DEI+A+   +SW  P DDGG  IT Y I+  +    +W +       T   V  L     YQF V A N+ G SEP  +   I A++ ++ P  P +P I +  +  ++L W  P  DGG  +T + ++KK++    +  + T      + I   E R  GL EG  YQFR+ A N AG SSPS  +K
Sbjct: 29098 EKNLGSDTRYSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRD--ATKRTWSVVSHKCSG--TSFKVTDLSEKTPFFFRVLAENEIGIGEPCETT-------EPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIEIGQ--------------LKEQSVLEFRVSARNEKGQSDPV-TIGPLTVKELVITPEVDLSEIPGA-QISVRIGHNVHLELPYKGKPKPSISWLKDG-LPLKESEYVR---FSKT-----ENKITLSIKNSKKEHGGKYTVIL--DNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDSEYQFRVRAENRYGVSEPLAS-NIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNT------SPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSK 29636          

HSP 48 Score: 182.185 bits (461), Expect = 1.358e-44
Identity = 159/565 (28.14%), Postives = 260/565 (46.02%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEK---PRXLN----PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV--KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            ++  +G YK+ + NA G  +  ++V I DKPD P   I +  + KNS V+   PP DDGG+ I +Y++E  +    + +W  V+ A      + ++ NL     Y FR  A N  G+S+P E++   +IIK P+++P  PG+P++   + +SC +AW  P SDGGA I +Y +E +EK    W     +  +  EI+  V        + + L+EG EY FR+K  N GG S  SE S+ V  K+       H +  + N+ ++            G P P V W R G  ++ D  +  I+ F  K  Y  +  + +VT  + ++    Y ++    GG+   T  + V +VP K   P+ L        +R E +++    P      P+ ++      IDN      + T+   + V   G++      + V A N+ G  +    L+     +P      P+   + D    SV L W +P+ DGG  +T+YI++K       W           +AR  E    +  L     YQFR+IA NK G S PS  ++P + + 
Sbjct: 32482 RKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGA-EWQLVSSAISV--TTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASI-VIIKSPFEKPGVPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLERREKKQNKW-----IAVTTEEIRETV-------FSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF--KGGY-HQLIIASVTDDDATV----YQVRATNQGGSVSGTASLEV-EVPAKIHLPKTLEGMGAVHALRGEVVSIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP------PRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWLRV-------GQAR--ETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKE 33005          

HSP 49 Score: 178.718 bits (452), Expect = 1.729e-43
Identity = 164/594 (27.61%), Postives = 260/594 (43.77%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLH-QPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR---HKNLTPSIDKGSSSSKT 1147
            R    V N  ++    +++   N  G  E L +  I+ K     P PP    + +++ +   +    P  DGG+E+  + +E  +   +S  W +V  +   G +  +   LI    Y+FR  A N  GLS P + S   + +       D PG P  +D +  +  L W  P  DGG+ I  Y IE ++ S   W +    + S+ +             T  GL  G+ Y FRI A N  G  S PS++S  ++ +   + P +   P  ++ + IK G + R      G P P VTW ++G  +     R+++E+          +T L V  A R    G YT++     G+ +A   V V D P K   + P     I  E + L W  P +DG  P+T Y+I+  +     W L     +    T   L  G+ YQF + AVNK G   P  + +P+ A+  Y  P  P  P   +    S+TL W +P  DGG  I HYI+++++K    W   +       +  I E   ++ GL EG  Y+F ++A N AG    S  ++   CR   +    PS+ K + +SKT
Sbjct: 29502 RTTFKVSNLVKDSEYQFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE--RNSILWQRVNTSPISG-REYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAV----SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGS-DRWVRCNFTDVSECQY------------TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENVPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEI---ERRMNMEITD-----VLGSTSLFVRDATRD-HRGVYTVEAKNVSGSTKAEVTVKVQDTPGK--VVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPLES-DPVVAQIQYTIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVI------SKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKT 30057          

HSP 50 Score: 159.458 bits (402), Expect = 1.234e-37
Identity = 179/659 (27.16%), Postives = 285/659 (43.25%), Query Frame = 0
Query:  586 YKIIIRNAQGFDER------LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPG-RPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK----GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRA---EHINLSWATPHDDGGTPITSYVIKMMDIDNG-DW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--------KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNG 1220
            ++II +N  G  E       ++  +  DKP  P  +E+  ISK+S  ++   P+ DGG EI  Y +E     S  + W +  +   K  +   +  L+    Y FR  A N  GLS P   +   + +K      + PG R  + D ++   + A  L     G P+   +I++      L Q  +   +SD    T          T     + +E V+   A N+ G     E+S  +L +     P  H PG Y ++ K     G T R  + + G P P++TW  +G  LL +S++I+IE         E  T L +    R    G Y ++L    GT  AT  V + D P+KP    P  I A     + +SW  P DDGG+ IT+YV++  +   G +W L +     T   +  L     Y F V A N  G SEP      +  ++P++ P  P +P I      S  + W+ P+ DGG  I +Y +++++K    + A+ T++      I E    +  L EG  Y+FR+   N  GES  S  ++P       +TP  D        K    +  ++    A    KV G P P   WY+ G +I + D +    +E++GG   +L ++     DA  Y + A N+ G
Sbjct: 32191 FRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEY--RQSGDSAWKKSNKERIKD-RQFTIGGLLEATEYEFRVFAENETGLSRPRRTA---MSVKTKLTSGEAPGVRKEMADVTTKLGEAA-QLSCQIVGRPLP--DIKWYRFGKELIQSRKYKMSSDGRTHT---------LTVMTDEQEDEGVYTCVATNEVGEV---ESSSKLLLQA---APQFH-PG-YPLKEKYYGAVGSTLRLHVMYIGRPVPAMTW-FHGQKLLQNSEKITIE-------NTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKP--TGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFEKPGVPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEE------IRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEP-------VTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGY-HQLIIASVTDDDATVYQVRATNQGG 32798          

HSP 51 Score: 156.762 bits (395), Expect = 8.625e-37
Identity = 157/592 (26.52%), Postives = 255/592 (43.07%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIK----KGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGT------QQATGYVNVLDVPEKPRXLNPDEIR-------AEHINLSWATPHDDGG--TPITSYVIKMMDIDNGDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEP-IKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            KDG+ ++    VN+        L++    RE  G+Y++ + N  G     I V ++D+P PP  I +  +S ++  +  +PP+ DGG +I +YI+E  + +S++  W  V+QA  +   SIK+  L     Y+FR  A NR G S   E S   ++ + P+  P  PG P V+  + ++  ++W +P +DGG+ +  Y +EYKE+S  LW +   +  +D ++K              GL EG  Y +R+ A N  G    S+  + V A+     P   QP + NI  K    K    RYD   GG        ER     L D   +     + +  Y E   V  +T+  R      Y  ++             ++TG + V D  E PR +   + R        E + ++     D  G   P+ S+    ++I+       + T   T  TVK        Q+ +   N  G     RT+    K  +   PP+ P E N      +  +L W +P +DGG  I +YI++K++     W          CEA +     ++  L +G  Y FR+  VNK G   P
Sbjct: 27219 KDGQVLRETTRVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTT--WQVVSQAVAR--TSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA--VVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVS------------GLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPP--GQPEVTNITRKSVSLKWSKPRYD---GGAKITGYIVERRE---LPDGRWLKCNFTNVQETYFE---VTELTEDQR------YEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKIN----ADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAG----TRTMAVNCKVLDKPGPPAGPLEIN--GLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAW--------TICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 27757          

HSP 52 Score: 145.591 bits (366), Expect = 1.946e-33
Identity = 88/279 (31.54%), Postives = 139/279 (49.82%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KD   +K  + + +    +   L + +  R+ SG Y I   N+ G     I + ++DKP PP ++++  +  +  ++   PP +DGG+EI +YII+  +  +S   W+QV+        S  V  LI  H Y+FR  A N+ G+ DP  I  +  I K+P+D P +   P + + + +   ++W  P  DGG+PIT Y +E +E     W              T VN KP++  T K  GL EG EY FR+ A+NK G   PS+ S +V A+     P
Sbjct: 21120 KDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRE--TSRPNWAQVSATVPI--TSCTVEKLIEGHEYQFRICAENKYGVGDP--ILTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNW--------------TKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYPP 21378          

HSP 53 Score: 140.969 bits (354), Expect = 5.018e-32
Identity = 119/423 (28.13%), Postives = 191/423 (45.15%), Query Frame = 0
Query:  715 DKPGRPS---VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTW----ERNGSLLLGD-SDRISIELFSKKTVYCEKNTVLTVTKANRSI-DTGHYTIKLLCD-----GGTQQATGYVNV---LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGES 1118
            DKPG P+   + D ++ SC L W  P  DGG+ IT+Y +E K     +W +     +S ++   D N K         L    EY+FR+ A N  G   P + +  ++AK ++  P              G   R +     + A ++TW    +  GS + G   +R+  +  + K V C K  V   T   + + +   Y  ++L +     G   ++T  + +   +D P  P      +I    + L+W  P  DGG  I SYVI+M+     +W+   E    T+  + GL  G  Y F V AVNK GESEP    +P+       PPS P+   +++    +  L+W  P  DGG PIT+YI++K+D +  GW         + +  + + +  +  L+EG  Y FR+ A N  G+S
Sbjct: 15571 DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHK----LSSTVK---DTNFK------ATKLTPNKEYIFRVAAENMYGVGEPVQAA-PIIAKYQFDPP--------------GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPD--TDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW--------QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQS 15955          

HSP 54 Score: 140.198 bits (352), Expect = 9.292e-32
Identity = 89/278 (32.01%), Postives = 136/278 (48.92%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KDGKE++    + I        L   +  R  SG+Y +   N  GF + + NV ++D+P PP+  + V+ ++   CV+   PP DDGG +I HYI++  + S  +  W+ VA         +KV  L+  + Y FR  A N+ G+ +P E   + ++  DP+  PD P  P V   + +S  + W  P+SDGG+ I +Y +E ++K+   W +      +D+  K              GL EG+EY FRI A N  G S PS TS    A     KP
Sbjct: 23286 KDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLA--WTNVATEVQV--TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE--SEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRFKVS------------GLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKP 23545          

HSP 55 Score: 139.813 bits (351), Expect = 1.109e-31
Identity = 96/297 (32.32%), Postives = 140/297 (47.14%), Query Frame = 0
Query:  947 NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECE 1238
             +SW  P  DGG+PIT Y ++  +I  G W+   +T   D K  V GL  G+ Y+F V A N  G S P  + +PIKA  P KPP  P  P + D   +S  L W KP  DGG PI  Y+++ +      +D +  D+      I +   R+PGL EG  Y+FRI A N  GE  P  E    +     L P    +D       T++V +T     +VKG P P+ TW K G  +     V +  +  +     +L + ++   D G Y + A+N +G  +    + VLD    C+
Sbjct: 19510 TVSWTLPKSDGGSPITGYYVERREI-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDEL-----IRQCAFRVPGLIEGNEYRFRIRAANIVGEGEPR-ELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDLIHDLPR----VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQ 19795          

HSP 56 Score: 137.117 bits (344), Expect = 6.637e-31
Identity = 96/306 (31.37%), Postives = 139/306 (45.42%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ-KKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKN--------GIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  +H+ +SW  P DDGG+PIT Y+++  +    +W         + T+K  GL+ G  Y+F V A+NK G  +P    + + A++P  PP  P  P + D    SV+L W KP+ DGG PI  Y+++ K+     W         +   ++ +    + GL E   YQFR+ AVNK G S PS     H C    L P    +D     +  ++   T    + VKG PPP+ TW K         G+ I STD     R E                 DAG Y L  EN  G+ +  + + VLD
Sbjct: 21288 ITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWV------RCNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKH-CPKDILIPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCE------------NVNKYDAGKYILTLENSCGKKEYTIVVKVLD 21574          

HSP 57 Score: 136.732 bits (343), Expect = 9.951e-31
Identity = 101/316 (31.96%), Postives = 153/316 (48.42%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET----KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQ-IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             DVP+ P   N  ++R + ++L+W  P   GG+PIT Y I+  + ++  W  A +T    KD K T  GL  G  Y+F V+A+N  G  +P    EP+ A +P  PP +P+   ++     SVTL W +P  DGG  +T YI++K+D     W  A   +   C   + +L        EG  Y+FRI A N AG  S+PS  T   +C+ +   P+I  D       T+K   + +   I + G+P P+ +W + G  I  +D   IT        T K    K    DAG Y++ A N  G  +  + + VLD+
Sbjct: 21962 FDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVT--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPE---VISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDL-------VEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYATRK----DAGEYTITATNPFGTKEEHVKVSVLDV 22261          

HSP 58 Score: 136.346 bits (342), Expect = 1.168e-30
Identity = 90/275 (32.73%), Postives = 143/275 (52.00%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +S  KDG  +K  + V  +   +++ L++ N K+E  G Y +I+ NA   +   I +  +  P  PK  I    I  +S ++    P+DDGG EI  Y IE  + S ++  W  V  +  +   + KV+NL+    Y+FR RA NR G+S+P  ++   I+ K  +  P  PG+P + + +S+   L W  P  DGG+ +T + +E KE++  LWQ+   +NTS I      +G+        GL+EG +Y FR+ A N  G S PS+ S   LA
Sbjct: 29384 ISWLKDGLPLKESEYVRFSKTENKITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTN--WKMVCSSVAR--TTFKVSNLVKDSEYQFRVRAENRYGVSEP--LASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQR---VNTSPI------SGR---EYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLA 29640          

HSP 59 Score: 134.42 bits (337), Expect = 4.985e-30
Identity = 89/300 (29.67%), Postives = 152/300 (50.67%), Query Frame = 0
Query:  524 VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVD--LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPD-PPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +A ++ N+ +   ++G     +    +K G++  +  D  ++     V+  L V + ++  +G Y I ++N  G  E  +++ ++ KP  P   I+   ++  +  +K  PP DDGG+EI +Y++E  D  S +N+W   A A  K   + +V  L     Y FR  A N+ G+ +   +  + I+ K P+D PD P  P+++D   +S  L W  P+  GG+PIT Y IE+KE++  LW++    N + I +K              GL EG EY FR+ A+N  G   PS  S+ V+A
Sbjct: 21782 LAKENSNFRLKIPIKGKPAPSVS---WKKGED-PLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRD--SVNNKWVTCASAVQK--TTFRVTRLHEGIEYTFRVSAENKYGVGE--GLKSEPIVAKHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRA---NKTPIRMK---------DFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVA 22059          

HSP 60 Score: 132.88 bits (333), Expect = 1.455e-29
Identity = 161/655 (24.58%), Postives = 265/655 (40.46%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILN--TSDIEIKTDVNGKPMVHGTCKG-LVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG-IYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDG--GTQQATGYVNVL-----DVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG------GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNL-TPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++ +N +D+P  P+ + +    K    +K   PD DGG+    Y +E       S  W +V +   K    + V+  +    Y FR +  N  G SD   +  +++++K+   +P       VLD       L+  L    G        +  K      W + +     T    +K D + +       K    +G +YV  I A N  G+ +   T +            L +PG + N++I    + R  I +           +N  L   +S R+    +S        N +       R I+   Y  ++  +   GT   T    V+     D P +P      ++  E + + W  P  DGG  IT Y ++  +     W+   ++   + +  V+ L PGH YQF V A N+ G  EP     P+ A++P +PP  P    +VD    S+TL W KP  DGG PI  Y+++ + K        GW         +  A++  +E  +  L E + Y+FR+ A N+ G   P+ E K  +   + L  P ID  +S  K + V      ++   V+G P P+ TW K GI     D V+   +       A L +  S   D+G YSL   N  G+    +++ VLD
Sbjct: 19881 ILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVER--RLKGSADWERVHKGSIKETHYM-VDKCVENQIYEFRVQTKNEGGESD--WVRTEEVVVKEDLQKP-------VLD-----LKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYV--ITATNPAGSFVAYATVN-----------VLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSA-------NVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW------KRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRPA-ELKEAIKPKEILEPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGI-----DNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLD 20486          

HSP 61 Score: 130.954 bits (328), Expect = 5.155e-29
Identity = 99/320 (30.94%), Postives = 145/320 (45.31%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRA--EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME---TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            N   +P +P    P+E+ A  EHI + W  P  DGG  I++Y++   +  +  W    +     DT+  V  L  G  YQF V AVN  G SEP      I    P   P  P  P +VD   +S++L W KP  DGG  I  Y+++ ++K    +  + T+     A I   E  +P L  G+ Y FR+ AVN  G S  S  T       +   P ++      KT+ V   A  +  + V G P P  TW K GI +A+   ++   E Y     + L V K    DAG Y++ AEN++G+    + + V D    C
Sbjct: 31024 NSFTIPSQPGI--PEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTN-----ATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLEIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLAN-RAIIDNTESY-----SLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPC 31330          

HSP 62 Score: 130.183 bits (326), Expect = 9.868e-29
Identity = 89/263 (33.84%), Postives = 127/263 (48.29%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            ++I    DR  L V +  R  SG Y + + N  G     I V ++ +P P    IEV+ +S  SCV+  + P DDGGTEI +YI+E  +  S +  W  +  +  +    IKV +L     Y FR  + NR G+S P E     I+ + P+  P  P RP V   S+N+  + W  P  DGG+ I  Y +E KE++  LW +               N  P +    K  GLVEG EY FR  A+N  G S  SE S  ++A+
Sbjct: 30483 MSIATTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRE--SGTTAWQLINSSVKR--TQIKVTHLTKYKEYCFRVSSENRFGVSKPLE--SVPIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKE--------------NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQ 30725          

HSP 63 Score: 129.413 bits (324), Expect = 1.582e-28
Identity = 90/300 (30.00%), Postives = 145/300 (48.33%), Query Frame = 0
Query:  940 EIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA--TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDA----SCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP---SFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++    ++LSW+ P DDGG+ +T Y I+  +     W+   +T+ T    TV GL P   YQF +IA N  G SE     EP+  ++P+  PS+P E  I+     SVTL+W+KP  DGG+ I           G W +  ++ D+    S + RI + +  I GL E   Y+FR+ A N+ G S P   +   K  L   +   P + K   +  T K+   A    ++ G P P+  WY+ G ++  + +  ++ +    G T  L V   +  D G Y+ VA N  G+ ++   L++
Sbjct: 32129 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI----------LGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGE--APGVRK-EMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSD----GRTHTLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLL 32411          

HSP 64 Score: 129.413 bits (324), Expect = 1.596e-28
Identity = 85/294 (28.91%), Postives = 142/294 (48.30%), Query Frame = 0
Query:  530 NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGE--ILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            N  V   + G     + LS  +DG  +K     N     + + +N+       +G Y+I   N+ G  +  IN+ ++D+P PP   + ++ I++ S  +K  PP  DGG+ + +YI+  +   +S+  WS+V+    +    IKV  L     Y+FR +A NR G+SD   I    +++K P+  P  P  P V + +  S  + W  P S+GG+ +T Y +E K+++  LWQ+    I+ T+  ++ T             GL+    Y FR+ A N  G   PS  S+ VLA
Sbjct: 28282 NLKVDIPISGKPLPKVTLS--RDGVPLKATMRFNTEITAENLTINLKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIV--LKRETSTAVWSEVSATVAR--TMIKVMKLTTGEEYQFRIKAENRFGISD--HIDSVCVVVKLPYTTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTT----------ISAGLI----YEFRVYAENAAGIGKPSHPSEPVLA 28553          

HSP 65 Score: 126.716 bits (317), Expect = 1.249e-27
Identity = 83/272 (30.51%), Postives = 132/272 (48.53%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKG-PKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSV 818
            K  KE+ + + +++ + G R    +    R  SG Y + ++NA G     + V ++D P P   + V+ +++  C +  S P +DGG EI HYI+E  +  +S   W  V   +G+    S  V  LI  + Y FR RA N+ GL  P  +  + I+ ++ +  P +PG P  +        + W  PESDGG  I++Y ++ +EK    W              T VN   +V+ T      L+EG +Y FR+ AVN  G S PSE S+ +
Sbjct: 30872 KGDKELDLCEKISLQYTGKRATAVIKYCDRSDSGKYTLTVKNASGTKSVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRE--TSRLNWVIV---EGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVP--VESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRW--------------TRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFI 31122          

HSP 66 Score: 125.946 bits (315), Expect = 1.824e-27
Identity = 100/317 (31.55%), Postives = 143/317 (45.11%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-------KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL-CRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
              VP  P       +  + + +SW  P  DGG+PI  Y I+  + +   W        +KA V        GL  G  Y+F VIA N  G+S+P +  EP+ A +P  PP +P   NI      +V L+W KP   GG  IT Y+++K+D   G W  A  ++       I E E  + GL+E   Y+FR+IA N AG  SP  E    + CR     P I  D     + T+K       +  V G PPP   W K+G ++  T ++ I   ++    +  L    S   D+G Y L A N  G  K   ++ VLD
Sbjct: 23045 FKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTV-----SKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFALDPIDPPGKPVPLNIT---RHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSN-------ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIADF----STHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLD 23342          

HSP 67 Score: 123.635 bits (309), Expect = 8.751e-27
Identity = 87/284 (30.63%), Postives = 135/284 (47.54%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            +S  KDG E++      I        L V +  R  +G Y + ++N  G     +N  ++DKP PP   +E+  ++   C +    P +DGG +I +YI+E  + S  +  W+ + +A+ +   S KV  L+  + Y FR    N+ G+ +P E      +  DP+  P  P    +   + +S  L W+ PE+DGG+ I+ Y IE +EK+   W +              VN KP+     K  GL EG EY +R+ A N  G SLPSETS  V A+     P
Sbjct: 27610 ISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLA--WT-ICEAELRT-TSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKAL--DPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMR--------------VNKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLP 27873          

HSP 68 Score: 123.25 bits (308), Expect = 1.117e-26
Identity = 85/299 (28.43%), Postives = 144/299 (48.16%), Query Frame = 0
Query:  534 SYAVEGYKQSDIELSVF----------KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            +Y+V+  +   IE+ V           KDG+ +K    VN+        L++    ++  G Y +   N+ G     ++V +++KP PP   ++   +S +  V+   PP   GG +I +YI+E  D ++++  W  V+    +   +IK++ L     Y+FR  A NR G S P  +  + ++++ P+ EP  PG P V   S +   + W  P +DGG+ +T Y +E KEK+  LW +   +   D + KT             GL EG EY FR+ A N  G   PS+ S+  +A+
Sbjct: 26109 TYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTN--WQMVSATVAR--TTIKISKLKTGTEYQFRIFAENRYGKSTP--LDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKT------------TGLDEGLEYEFRVSAENIVGIGKPSKVSECYVAR 26389          

HSP 69 Score: 122.865 bits (307), Expect = 1.476e-26
Identity = 83/268 (30.97%), Postives = 129/268 (48.13%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSD 816
            +KD KE++    V +    D   + + +  R  SGSY++ +RNA G     I V I+DKP PP   IE   ++     +   PP DDGG +I HYI+E  +  +S   WS VA+   +    +    +I  + Y FR RA N+ G+ +P E   + ++ K+ +  P  P  P V   + NS  + W  P  DGG+ I  Y +E ++K    W +  +L  +  + +  V           GL E ++Y +R+ AVN  G    SE SD
Sbjct: 28696 YKDDKELQTNALVCVENSTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRE--TSRVVWSMVAENLEEC--IVTTTKIIKGNEYVFRVRAVNKYGIGEPLE--SEPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLK--VLKETIRDTRQKVT----------GLTENSDYQYRVCAVNAAGVGPFSEPSD 28945          

HSP 70 Score: 122.865 bits (307), Expect = 1.776e-26
Identity = 91/314 (28.98%), Postives = 140/314 (44.59%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKG--SSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMI---DAGTYSLVAENRNGQDKTDLDLIVLD 1232
             DVP +P+     ++  + I ++W  P  DGG+PIT Y+I+  + ++  W+ A +T  + T+    GL  G  Y F + A+NK G S P +  E + A  P  PP +P+   +VD    S +L W +P  DGG  I  Y ++     G  W     T       +I + E    GL E   YQFR IA      S PS  + P     +N+ P I+      S  T+K          V G+P P  +W K+   I   + + +  +         LC  +   +   D+G Y++ AEN +G     + L VLD
Sbjct: 20878 FDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE---VVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNTTPH-----QIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENVPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKR-------NLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLD 21176          

HSP 71 Score: 122.094 bits (305), Expect = 2.574e-26
Identity = 144/592 (24.32%), Postives = 233/592 (39.36%), Query Frame = 0
Query:  548 SVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLG---DSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLL-CDGG----TQQATGYVNVLDVPEKPRXLNPDEIRAEHI------NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            S F  G +++  + V +  H     L +       +G Y + ++N  G     I V I+DKP PP   I++  I   S  +   PP+ DGG  +  Y++E  D       W  V+++  +   + K   L   + Y FR  A NR G+     +  + I  +     P  P    + D S +   L W  PE DGG+ +T Y +E KE     W +              VN  P  M      GL+EG EY  R+ A+N  G   PS  S   +A      P   Q P + +      RT     W       SV  +  GS + G   +  ++    ++K      K    T+T   +      Y  ++L C+ G      +  G V V ++ E P     DE   E +       +    P      P+  +  +  DI     +   ET  T+  +K         ++++  NK G+      ++ I + N    P  P E +  D   +SV + W+ P+DDGG  I  YI+++++     W+        + ++R+      + GL E   Y FR+ A N+ G S P
Sbjct: 31560 SWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPG--WLPVSESVTR--PTFKFTRLTEGNEYVFRVAATNRFGIGS--YLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR--------------VNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDT----TRTSVSLAW-------SVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIREYTLTHLPQG---AEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYP-DYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSET-HTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPN---TPEGPLEYD--DIQARSVRVSWRPPADDGGADILGYILERREVPKAAWY--------TIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKP 32102          

HSP 72 Score: 122.094 bits (305), Expect = 2.920e-26
Identity = 86/252 (34.13%), Postives = 126/252 (50.00%), Query Frame = 0
Query:  878 ELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVN--VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDT-KATVKGLKPGHI-YQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            E  S KTV    + T   +++A +  D G Y I L    G  +A G++N  V+DVP   R L   E     ++L+W  P  DGG+ I  YV++  DI    W+   +  D+ + TV GL+ G + Y F V A N+ G  EP  T  P++A + Y  P  P    I D +   V+L W+ P  DGG  IT+Y+I+ +DK    +D   T       R ++L A +  + EG+ Y FR+ A N+ G   PS  T
Sbjct: 14827 EPLSTKTVDTTAEQTSFRISEAKKD-DKGRYKIVLQNKHG--KAEGFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT------VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 15069          

HSP 73 Score: 121.324 bits (303), Expect = 4.377e-26
Identity = 161/726 (22.18%), Postives = 280/726 (38.57%), Query Frame = 0
Query:   98 QWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPV-DQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEF--YFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKH-RYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV 818
            +WF+  + +    +Y      +  T  L I  AR +++ ++ V L N  GE+             +   A L+  ++  R VE         P+ D E  E K   V    +++  NV  KW             T  G E+    R  +   +  ++LI+ +    + G++ + A  +         + +I    EF  + E + +T+          F+C L+   AN++W RNG  +    +Y+    G    L++    L+D         EY    ED  +  +L VE    EI            +R   D   + E    +        +F  ++      V +  N  I+V G   +M    M +GK H+L +  I   D G+             +    +  +   ++   +    P++ V   D           Y +++ E   FK+ + +       ++   ++    +   K++  G YKI+++N  G  E  IN+ ++D P P + +EVT        +    P  DGG++I  Y++E  D+   +  W  V   D        V  L      Y FR  A NR+G  +P E +   +  +  +D P  P   ++ D +     L W  PE DGGA IT+Y IE ++K+   W     +   D+              T   +VEG EY FR++A N+ G   PS  +  V
Sbjct: 14460 KWFRNEEAIFDSSKYIILQKDLVYT--LRIRDARLDDQANFNVSLTNHRGEN-------------VKSAANLIVEEEDLRIVE---------PLKDIETMEKK--SVTFWCKVNRLNVTLKW-------------TKNGEEVAFDNRISYRIDKYKHSLIIKDCGFPDEGEYVVTAGQDKSV----AELLIIEAPTEFVEHLEDQTVTEFDDAV-----FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLEDE-------CEYACGVEDRKSRARLFVEEIPVEI------------IRPPQD---ILEAPGAD-------VIFLAELNKDKVEVQWLRNNMIVVQGDKHQM----MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDAGQPLTMVVPYD----------AYPKAEAEW--FKENEPLSTK---TVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKT--W--VLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVE-TDSPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL------------SATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 15072          

HSP 74 Score: 117.857 bits (294), Expect = 5.212e-25
Identity = 92/321 (28.66%), Postives = 140/321 (43.61%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-------LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS--IDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW---------YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P KP+ L   E     + +SW  P D+GG+PIT Y ++  +     W        TK  +KG       L  G  YQF  +A+N  G   P    +P  A +P  PP  P  P + D    S++L W+ P+ DGG PI  YI++ +++    +  +   D    A     E  +P L E + Y+FR+ AVN+AGES PS  T           P   ID G+      K          +KG P P+ +W          K+G+     D  L T E      ++ + + +     +G YS+ A+N+ GQ   +  + V+D
Sbjct: 17391 PGKPKVL---ERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTA----CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLVCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAEN-----SSVIIIPECTRAHSGKYSITAKNKAGQKTANCRVKVMD 17699          

HSP 75 Score: 117.857 bits (294), Expect = 5.576e-25
Identity = 87/279 (31.18%), Postives = 128/279 (45.88%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            FKD  +V      +I      + L     KR  SG Y +++ N+ G  +    VN++D+P PP   +    ++K   V+   PP DDGG+EI +YIIE  ++    + W  V  A  K   + KV  L+    Y FR  A N  G+SDP  +    +  KD +  PD P +P V + + +S  + W  P +DGG PIT+Y +E +E     W +            T     P        L+EG +Y FR+ A N+ G   PS  S  V A+    KP
Sbjct: 18642 FKDEADVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKEL--GKDIWMPVTSASAK--TTCKVPKLLEGKDYIFRIHAENLYGISDP--LVSDSMKAKDRFRVPDAPEQPVVTEVTKDSALVTWNKP-NDGGKPITNYILEKRETMSKRWVR-----------VTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFARDPIAKP 18902          

HSP 76 Score: 115.931 bits (289), Expect = 2.041e-24
Identity = 86/291 (29.55%), Postives = 134/291 (46.05%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +SW  P +DGG+ +  Y ++  +  +  W  A +    DT+  V GL  G +Y++ V A N  G  +  +  EP+ A +P  PP +P+  NI     +SV+L+W KP  DGG  IT YI+++++   G W     T+       + E    +  L+E + Y+FR+ A N A   S PS  T P   +     P I         I V    + +I   + G P P  +W K+G++I    +  I   +Y    T K CV +    D G Y L  +N  G     ++  VLD
Sbjct: 27394 VSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNIT---RKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTN-------VQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRR----DTGQYVLTLKNVAGTRTMAVNCKVLD 27670          

HSP 77 Score: 115.546 bits (288), Expect = 2.907e-24
Identity = 83/276 (30.07%), Postives = 126/276 (45.65%), Query Frame = 0
Query:  550 FKDGKEV-KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +K G ++ K  Q VN+        LN+    R  SG Y +  +N  G    +I + + D P PP   I+   +S +       PP++DGG  I +Y++E     S++  W ++A    +   + K   L     Y+FR RA NR G+     I+   ++   P+  P  PG P V   + +S  ++W  P SDGG+PI  Y IE KE++  LWQ                  K +V G      GL +G  Y FR+ A N  G S PS+ S+ + A
Sbjct: 22888 WKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTT--WVELATTVIR--TTYKATRLTTGVEYQFRVRAQNRYGVGP--GITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQ---------------TVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFA 23142          

HSP 78 Score: 115.161 bits (287), Expect = 3.326e-24
Identity = 81/271 (29.89%), Postives = 132/271 (48.71%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            + GK+++      I        L V    R+ +G Y I   N  G  E  + V+++D P PP  IE++++S     +  +PP +DGG+ IK Y++E  +  +S   W+ V++ D +  + + V  LI  + Y FR  A N  G  +P  +  + + + D +  P  PG+P + + + N+  ++W  P  DGG+ IT Y +E +EK    W +      SD+  K              GL EGN Y FR+ A N+ G   PS+ S+ VL K
Sbjct: 22204 RAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRE--TSRLLWTVVSE-DIQACRHV-VTKLIQGNEYLFRVSAVNHYGKGEP--VQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCK------------VTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMK 22456          

HSP 79 Score: 115.161 bits (287), Expect = 3.743e-24
Identity = 84/279 (30.11%), Postives = 132/279 (47.31%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            +S  KDG  +K    +N+    D   L++    ++  G Y I + N  G     I +  +DKPDPPK  ++   IS  S  +  +PP   GG +I +YI++  D  +++  W  V+    +   ++KV  L     Y+FR  A NR G S    +  + ++ + P+ EP  PG P V   S  S  + W  P ++GG+P+  Y +E KE++  LW              T VN K ++H T      L EG EY FR+ A N  G    S+ S+  +A+
Sbjct: 25050 ISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITNYIVQKRD--TTTTVWDVVSATVAR--TTLKVTKLKTGTEYQFRIFAENRYGQS--FALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKERNSILW--------------TKVN-KTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 25307          

HSP 80 Score: 114.39 bits (285), Expect = 6.693e-24
Identity = 82/298 (27.52%), Postives = 137/298 (45.97%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  E I + W  P  +GG+ +T Y ++M D ++  W  A  M  + T   V  +  G IY+F V A N  G  +P    EP+ A +  +PP   +   I D    SV L WQ+P+ DGG  IT YI++++D   G W  A  T+       + E +  + GL++   Y+FR+ A N  G  S+PS    P  C      P ID     ++ +K       +++  + G+P P   WYK+  ++ +   V +          A + +  +  +++G+Y L   N  G     + + +LD
Sbjct: 28470 VTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPP---RNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN-------VIETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVE----NSTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILD 28753          

HSP 81 Score: 114.005 bits (284), Expect = 7.404e-24
Identity = 85/313 (27.16%), Postives = 146/313 (46.65%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYII--QKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLT--PSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            + +P  P  L   ++  + + L+W  P DDGG+ +T Y+++  ++    W+    +    T+    GL  G  Y+  V A+N  G  +P R  +P  A +P  PP +P+ P + D    SV+L W  P D+GG  +T Y+I  QK D+   W    K +    + R    E  +  L +G  Y+FR++A N  G   P+    P   +   +   P  +      + + V +  + +  I +KG+P P   W K G  I S   ++ T E +      +L + ++   D+GTY LV EN+ G+    + + V+
Sbjct: 31718 ISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ-REW---TKCNTTPTKIR----EYTLTHLPQGAEYRFRVLACNAGGPGEPA--EVPGTVKVTEMLEYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDI-SKRAMIATSETH-----TELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVI 32014          

HSP 82 Score: 113.235 bits (282), Expect = 1.217e-23
Identity = 93/320 (29.06%), Postives = 134/320 (41.88%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGG-ATAKLCVSKSQMIDAGTYSLVAENRNGQDKTD-LDLIVLDLMQECE 1238
            N    P  P      +I    + + W  P  DGG+ I  Y ++  D  +  WL  ++   +DT+  V GL     YQ+ V AVN  G        +  KA +P  PP  P +  I D    S+TL W KP  DGG  +T Y+++ K       D  +    S    +   E  +  L  G  Y F++ AVN AG+  P   T+P   +     P ID   +  +S   K        I  KG PPP  TW K+   + S      TR   Q   +++ L + +    D G Y L  EN  GQ K+  + + VLD    C+
Sbjct: 28850 NAFVTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQG-----DEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLEEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSD-----TRYSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQ 29159          

HSP 83 Score: 113.235 bits (282), Expect = 1.269e-23
Identity = 91/310 (29.35%), Postives = 149/310 (48.06%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW----LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P KP   N   + ++ ++L+W  P  DGG+ +T + ++  + ++  W       +  ++ +AT  GL  G  YQF V A N  G S P    +   A +P  PP  P   + +D   +++TL+W  P  DGG  I  Y I+K+     W     TD + C+  +        GLS G  Y+FRIIA N  G  S PS  +   + R +N+ P+++ G      + +      +IK  V+G P P  TW+K+G++I     + IT      G+T+ L V  +     G Y++ A+N +G  K ++ + V D
Sbjct: 29549 PGKPVIYN---VTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRAT--GLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTP---DYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVT-------GLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENVPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITD---VLGSTS-LFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQD 29839          

HSP 84 Score: 113.235 bits (282), Expect = 1.490e-23
Identity = 80/267 (29.96%), Postives = 122/267 (45.69%), Query Frame = 0
Query:  551 KDGKEVK-VGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETS 815
            KDG E++     + I     +  L V +  R   G Y + + N  G     I V ++D+P PP+  ++VT ++   C +  +PP  DGG  I HYIIE  + S  S  W+QV  ++     + KV  L+  + Y FR  A N+ G+ +  E   + +I  +P+  P  P  P     + +S  L W  P  DGGA I  Y +E ++K    W +      +D+  +              GL EG+ Y FR+ A N  G   PSE S
Sbjct: 26532 KDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLS--WTQV--SNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALE--SEPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFR------------VTGLTEGHSYEFRVAAENAAGVGEPSEPS 26780          

HSP 85 Score: 112.849 bits (281), Expect = 1.676e-23
Identity = 89/298 (29.87%), Postives = 136/298 (45.64%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW--LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  + + + W  P +DGG+ +T Y ++  + ++  W  L  +  +DTK    GL  G  Y+F V A N  G  +P +  E   A +P  PP  P+    +     SVTL+W+KP  DGG  IT YI++KKD   G W  A  T+       + E E  + GL E + Y+FR+IA N A   S PS  +     R +   P  S+D        +    T + +  ++G+P P+  W K+G ++  T   +  +   Q      L V      D G Y+L   N  G     + + VLD
Sbjct: 26305 ISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEA---IVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFTN-------VVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQ---KTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLD 26589          

HSP 86 Score: 112.464 bits (280), Expect = 2.328e-23
Identity = 83/290 (28.62%), Postives = 131/290 (45.17%), Query Frame = 0
Query:  947 NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
             +SW  P DDGG+ IT Y ++  +     W+ A +T   D +  V GL+ G+ Y+F V A N+ G   P     P+  ++   PP  P   ++ D   +S +L W KP  DGG  IT Y+++ + K G   DA   D      RI +    +P L   + Y FRI A+N AG   P+      +   K + P  +  +   +T+ V      +I   +KG P PE TW K+ I +     +  T       +   L + +    D G + +  EN  G+    +++ VLD
Sbjct: 22378 TVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQ-KVGD--DAWIKDTTGTALRITQF--VVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIV-EKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKHRANIENTE------SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 22655          

HSP 87 Score: 112.079 bits (279), Expect = 3.233e-23
Identity = 77/263 (29.28%), Postives = 127/263 (48.29%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI--KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            VN     D   L +   +R  +G Y I   N  G   + + +N++ +P PP   I+   IS +   +   PP DDGG++I +Y+IE  + +  +  W +V+      PK     +  L+  H Y FR  A N+ G+ +P  +  +    ++ +  P  P +P+V   + NS  + W  PE DGG+P+T Y +E K+ +   W++   +N   I+  T       V     GL+EG++Y FR+ A+N  G    S  SD V A+
Sbjct: 17959 VNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKT--WVRVSSE----PKECMYTIPKLLEGHEYVFRIMAQNKYGIGEP--LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKR---VNRDPIKAMTL-----GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTAR 18205          

HSP 88 Score: 109.768 bits (273), Expect = 1.713e-22
Identity = 88/295 (29.83%), Postives = 139/295 (47.12%), Query Frame = 0
Query:  944 EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            + + + W  P  DGG+ +  Y ++  + ++  W+   +T    TK    GL+ G  Y+F V A N  G  +P +  E   A +P  PP  P+    +     SVTL+W+KP+ DGG  IT YI++KK+   G W  A  T+       I + +  + GL E   Y+FR+IA N AG  S PS  T     R +   P I        T+ V     ++I   + G+P P   W K   +++ST  + I   ++       L V  +  +D+G Y L A+N  G+    +++ VLD
Sbjct: 24144 DSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPCDPPGRPEA---IIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTN-------IIDTQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDF----ATSLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLD 24424          

HSP 89 Score: 108.997 bits (271), Expect = 2.700e-22
Identity = 88/298 (29.53%), Postives = 138/298 (46.31%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  E + + W  P ++GG+P+  Y ++  + ++  W    +T   DT+     L+ G  Y+F V A N  G  +  +  E   A +P  PP  P+    +      +TL+W KP  DGG  IT YI++K+D   G W  A  T+       + E +  + GL+E + Y+FR+IA N AG  S PS  T P   + +   P I        TI VN    ++++  V G+P P   W +   +I  +    I   +++    A L V  +  ID G Y L A N  G     +++ VLD
Sbjct: 25223 ISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEA---IIVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTN-------VIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFK----ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLD 25506          

HSP 90 Score: 108.227 bits (269), Expect = 4.909e-22
Identity = 81/310 (26.13%), Postives = 130/310 (41.94%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK---DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKT--IKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +P+ P    P  +    I L+W  P  DGG+ I  Y+++  +  +  W+  +  +   +T+  V GL  G+ Y+F V+A N  G          IK   P  PPS P    + D    +V+L W +P  DGG  I  YII+  K   G W              + +L+A       G+ Y+FR+ AVN AG+      T       +   P +D  ++  +T  ++   +    I  +G P P   W K    ++   ++  T       + + L V      DAG Y+L  EN +G+      + VLD
Sbjct: 29940 IPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQA-------GEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTT------DSFSTLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLD 30236          

HSP 91 Score: 107.457 bits (267), Expect = 9.000e-22
Identity = 74/253 (29.25%), Postives = 117/253 (46.25%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLL 869
            V  ++K+S  +  S P DDGG+ +  Y IE  +  +S+++W +  +          V  L+    Y+FR  A N +GLS+    S + ++ KDP+D+P +PG   +L  S +S  L W  PE DGG  I  Y +EY++     W++       D +             T  GL+E  EY FR+ A N+ G S P  T+ SV  K    +    +  + ++  K G   +      G P P + W R G  L+
Sbjct: 32127 VLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE--TSTDKWVRHNKTQITT-TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPAS-EPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQF------------TIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELI 32363          

HSP 92 Score: 106.301 bits (264), Expect = 1.650e-21
Identity = 89/318 (27.99%), Postives = 141/318 (44.34%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-------LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            N+  VP  P       +    + ++W  P  DGG+P+T Y ++M D  +  W       + AM T      V GL  G  YQF V A+N  G        +P+ A +P  PP  P    + D+   SV L W  P  DGG  IT YI++ K++        +  +   +  +   +  + GL EG +Y+FR+ AVN AG   P   T     + + ++P +   +S    I V+   + +I   V G+PPP  TW  N   +     +  T        ++ + +   Q    G YSL+A+N  G+ K  + + VLD+
Sbjct: 18101 NLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM-TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPVAPPGPPFP-KVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEE------GKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTDVIEMKDRIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETT------AISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLDV 18404          

HSP 93 Score: 106.301 bits (264), Expect = 1.920e-21
Identity = 82/307 (26.71%), Postives = 131/307 (42.67%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX--AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF----GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFE-TKPHLCRHKNLTPSID---KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            + A  +++ W  P+ DGG+ I  Y ++  + +   W+    +   +    V GL  G  YQF   A+N  G S+      PI A+NP  PP  P+   + D    +V+L W  P  DGG  +  YII++K       G W     T        + +    +  LSEG  Y+FR++A N AG  S   E T P  CR +   P  +   +      TI+     +    V G+P P+  W K   ++   +++ +     +  A  K C       D+G Y+L  +N +G     + + VLD    C
Sbjct: 30641 VSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDPPGRPE---VTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTI-------VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKYC----DRSDSGKYTLTVKNASGTKSVSVMVKVLDSPGPC 30933          

HSP 94 Score: 102.449 bits (254), Expect = 2.611e-20
Identity = 77/261 (29.50%), Postives = 116/261 (44.44%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGG 807
            FKDG E++   ++ I        L V +  R+  G Y +  +N  G  +  + V + D P      I  T+I+     +    P +DG   + HYIIE  + S  +  W+ +   D     S     LI  + Y+FR  A N+ G+  P E     ++ +  +  PD PG P   + + NS  L W  PESDGG+ I HY +E +EK    W +              ++ +P+     K  GLVEGNEY F + A N  G
Sbjct: 29782 FKDGVEIERRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLA--WALIE--DNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPLE--SDPVVAQIQYTIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKV-------------ISKRPISETRFKVTGLVEGNEYEFHVMAENAAG 30023          

HSP 95 Score: 87.0409 bits (214), Expect = 1.275e-15
Identity = 78/285 (27.37%), Postives = 133/285 (46.67%), Query Frame = 0
Query:  439 PSAPVDFFLNGK-IIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKV-----GQD-VNINFHGDRVDLNVINP-------KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            P   V ++  GK II  G   R  +++   G HQLI+  +T +D    + R  TN G  +VS T S  V   E   K+     + G+           AV   +   + + +   GK   V     GQD ++ N H   +              +R+ +G Y +  +N  G D++ + +++ D PDPP+ ++V+ +S++S  +  + P  DGG+++ +YI+E    ++++ +W +V QA         V NL  K  Y+FR  A N+ GLS P E S   +  +D
Sbjct: 32744 PKPIVKWYRQGKEIIADGLKYR--IQEFKGGYHQLIIASVTDDDATVYQVRA-TNQGG-SVSGTASLEV---EVPAKIHLPKTLEGMG----------AVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVE--KCATTAERWLRVGQARE---TRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKED 33006          

HSP 96 Score: 85.5001 bits (210), Expect = 3.354e-15
Identity = 86/309 (27.83%), Postives = 135/309 (43.69%), Query Frame = 0
Query:  732 LAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-----GGTQQATGYVNVLDV---PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPS 1030
            LAW  P +DGG+ I  Y +E ++     W    +L T   +     + +  V G  KG   G EY+FR+ A N+ G   P ET   V A+++Y  P    P + N+ I      R+ +    EP          + ++   D+ SI   +  TV  E +   TVT     ++   Y+ ++        G    AT +V V D    P  P  LN  E     + L+W  P  DGG+PI  Y+I+  +    +W+        + T  V GL+ G+ Y + V A N  G S+P   L P+ A++ +  P+
Sbjct: 14897 LAWEEPLTDGGSKIIGYVVERRDIKRKTW----VLVTDRAD-----SCEFTVTGLQKG---GVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVP---GPPL-NVTITD--VNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAE-DLSATVTDV---VEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTYKVTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFVEPT 15183          

HSP 97 Score: 61.6178 bits (148), Expect = 6.239e-8
Identity = 107/493 (21.70%), Postives = 186/493 (37.73%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            ++WFK  +++   P++   T+G+    IL I  A  +++G+Y                   T +  +   A L+K +K    VEV V +     ++                LS P+V G+W L+             G  L  S   E I     + L+++N  ++ +G+ +  A   N        V+ +P      F   L   K        KF C ++      RW +    +    R+E    G +  LV+     +D         +Y+ + ED  TS KLI+EG                 +R+    KF++ +       ERE+ VF V++   + PV +F N + +     T   V    +GK H +    ++++D  QI            +S      V+ G+     KL D    +GV   +       +     ++D  +  FKDGKE+K  ++V I   G +  L +    +   G Y
Sbjct: 13481 VKWFKDGEEIVPSPKHSVKTDGLRR--ILKIKKAELKDKGEYVCDCGTD------------TTKANVTVEARLIKVEKPLYGVEVFVGETARFEIE----------------LSEPDVHGQWKLK-------------GEPLTASPDCEIIEDGKKHVLVLYNCQLDMTGEISFQAA--NAKSAANLKVKELP----LIFITPLSDVKV-FEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTRHSLVIKSAAFEDEA-------KYMFEAEDKRTSGKLIIEG-----------------IRL----KFLTPLKDVT-AKERENAVFTVELSHDNIPVSWFKNDQRL----HTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEA------MGISSEAKLTVLEGDPYFTGKLQD---YTGVEKDEVILQCEIS-----KADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQY 13876          

HSP 98 Score: 61.6178 bits (148), Expect = 6.507e-8
Identity = 106/507 (20.91%), Postives = 194/507 (38.26%), Query Frame = 0
Query:   20 LKPPEDAMKSGERKASLVLSDG-LTMNEDVEWEWEN--ESIPLRPEGKVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQ-LIVHYITMEDYGQIEARTPTNHGDKTV----------SCTGSFNVIMGEKA 512
            L+ PE  +K   +   L+L +  L     V+++  N   S  LR + +V  L+ P    +   G+      ++  + +P ++W+   K   +EP  K  T        L +   + E+ G+ ++  K+     + +   FV  E  ++F   L                      DQ V+E      VL   +S  N K KW+               G E+ KS+++E +       LI+H  T E+   +T  AK     F T  ++ V+PP  EF    + +T        + +F C +++    ++W ++GA +    +Y+   +G    LV+N+  L+D                               E +C      +S  L V  +    ++  +  E  E ++     +V  P A V ++   + I+     R E+  + DG+ + LI+    +ED G    R P++  D  V          S   +  ++ GEKA
Sbjct: 13936 LQTPECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWY--LKGKKLEPNDKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAKD----FKTQANLFVK-EPPVEFTKPLE---------------------DQTVEEEAT--AVLECEVSRENAKVKWF-------------KNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFL---RPLTDLQVKEKETARFECEISKENEKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEA-----------------------------EYSCEVRTARTSGMLTVLEEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEIIETG--RFEI--LTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHELAAEFISKPQNLEILEGEKA 14358          

HSP 99 Score: 56.9954 bits (136), Expect = 1.724e-6
Identity = 38/129 (29.46%), Postives = 62/129 (48.06%), Query Frame = 0
Query: 1028 PPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            PP  P E   V    + +TL W+ P+DDGG  ITHYI++K++     +  +  +   C     ++        +G  Y FR+ AVNK G   P  E++P + ++  +TP        +K  K + T +W
Sbjct: 28757 PPGGPIEFKTVT--AEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKI-------IKGNEYVFRVRAVNKYGIGEP-LESEPVVAKNAFVTPGPPSIPEVTKITKNSMTVVW 28875          

HSP 100 Score: 54.6842 bits (130), Expect = 8.801e-6
Identity = 73/297 (24.58%), Postives = 129/297 (43.43%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM--ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI--KAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDEL-----EARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTD--EVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++W  P  DGG  I +Y ++  +     W+     E ++T  +V+ L  G  Y+F V   N  GESE     EP+  K++ P + P   +E   ++   QS      K +    +PI  +  Q K+      D LK        RI E      +  I  +++     +++ A N+ G  S +   +  +    +L P   +G  +   ++    +I +I   G+P P  TW K    I +    +V++TR       T+ +  +  +  DAG Y + A+NR G D+  ++L V D+
Sbjct: 32632 VAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP-KPIVKWYRQGKEIIA---DGLK-------YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHL-PKTLEGMGAVHALRGEVVSI-KIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTR-----SFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV 32910          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:TTN "Uncharacterized protein" species:9913 "Bos taurus" [GO:0000794 "condensed nuclear chromosome" evidence=IEA] [GO:0001701 "in utero embryonic development" evidence=IEA] [GO:0002020 "protease binding" evidence=IEA] [GO:0003300 "cardiac muscle hypertrophy" evidence=IEA] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA] [GO:0004713 "protein tyrosine kinase activity" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005865 "striated muscle thin filament" evidence=IEA] [GO:0007076 "mitotic chromosome condensation" evidence=IEA] [GO:0007512 "adult heart development" evidence=IEA] [GO:0008307 "structural constituent of muscle" evidence=IEA] [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0030018 "Z disc" evidence=IEA] [GO:0030240 "skeletal muscle thin filament assembly" evidence=IEA] [GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IEA] [GO:0031430 "M band" evidence=IEA] [GO:0042802 "identical protein binding" evidence=IEA] [GO:0043056 "forward locomotion" evidence=IEA] [GO:0043621 "protein self-association" evidence=IEA] [GO:0045214 "sarcomere organization" evidence=IEA] [GO:0045859 "regulation of protein kinase activity" evidence=IEA] [GO:0048739 "cardiac muscle fiber development" evidence=IEA] [GO:0048769 "sarcomerogenesis" evidence=IEA] [GO:0051015 "actin filament binding" evidence=IEA] [GO:0051371 "muscle alpha-actinin binding" evidence=IEA] [GO:0051592 "response to calcium ion" evidence=IEA] [GO:0055003 "cardiac myofibril assembly" evidence=IEA] [GO:0055008 "cardiac muscle tissue morphogenesis" evidence=IEA] [GO:0060048 "cardiac muscle contraction" evidence=IEA] InterPro:IPR015129 InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 GO:GO:0005794 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0031430 GO:GO:0030018 GO:GO:0005509 GO:GO:0051592 GO:GO:0003300 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0018108 GO:GO:0004674 GO:GO:0001701 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0004713 GO:GO:0005865 GO:GO:0030240 GO:GO:0055008 GO:GO:0055003 GO:GO:0060048 GO:GO:0045214 GO:GO:0008307 GO:GO:0007512 GO:GO:0000794 GO:GO:0007076 GO:GO:0045859 InterPro:IPR013098 Pfam:PF07679 GO:GO:0030241 GO:GO:0048739 GO:GO:0043056 GO:GO:0048769 GeneTree:ENSGT00720000108588 OrthoDB:EOG7N8ZTK TreeFam:TF316477 InterPro:IPR004168 Pfam:PF02818 Pfam:PF09042 EMBL:DAAA02004137 Ensembl:ENSBTAT00000061449 OMA:VTIREPP Uniprot:F1N757)

HSP 1 Score: 264.233 bits (674), Expect = 5.296e-70
Identity = 186/577 (32.24%), Postives = 282/577 (48.87%), Query Frame = 0
Query:  557 KVGQDVNINFHG--DRVD----LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            KVG D N+   G  D VD    L + N  R+ SG Y + + N  G     +NV ++D P P   ++V+ ++K SC +  +PP++DGG+++ HYI+E  +    +  W+ V     K   S  V NL+    Y FR  A N  G   P ++  + ++  DP  EPD P +  V + + NS  LAW  P  DGGA I  Y + Y+E+     +  E     D+ +               GL EG +Y FR+ A N  G SLP E      AK + L P +  P    I IK G+  R +    G+P P   W++      G+ D ++    S   V+  +N+ + + K     D+G+Y++      GT      V V+D P  P+   +  +I A+  +LSW  P +DGG+ IT+Y+++  D+  GDW+ A+ +   T   V  L PG  Y F V A N+ G SEP  T   + A+ P+  PSEPK   +   +   + + W +P  DGG PIT Y+I++K++    +  +K +D      +   E    GL EG  Y FRI A+NKAG S PS  T+
Sbjct: 19584 KVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKT--WATVTPEVKK--TSFHVTNLVPGTEYFFRVTAVNEYGPGVPTDVP-KPVLATDPLSEPDPPRKLEVTEMTKNSAVLAWLPPLRDGGAKIDGYIVSYREEEQPADRWTEYSVVKDLSL------------VVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP--EQITIKAGKKLRIEAHVYGKPNPVCKWKK------GEDDVVT---SSHLAVHKAENSSVLIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPL-TSPKMVAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLW--VKANDTP----VRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 20124          

HSP 2 Score: 260.381 bits (664), Expect = 9.088e-69
Identity = 200/658 (30.40%), Postives = 297/658 (45.14%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++I   N  G  + L++ ++  K     PD P    VT ++K+S +V  +PP D GG  I +YI+E  +  + S  W++V +         +V +L+    Y FR  A N IG+ DP   S + +  KDP  +P  P  P  +D + NS DL W  P  DGG+ I  Y +EY++     W++      S  E    V G          L +G  Y FR+ AVN  G S P+   + VL K R   P   L         I+ G T R      G P P VTW++        + RI +     K         L +  A    D G Y++ +    G++  +  V VLD P  PR L   EIR +   L+W  P DDGG+ IT+YV++  D+ + +W     T   K+ + K L  G+ Y F V A N+ G      T +PIKA +P  PP  PK  + VD D   V+L W KP  DGG PIT Y+++ +++    +   KT        +  L   + GL +GK Y+FR+ A N  G   P   T P  C+ K + PS+  D        +K   T  +   ++G P P   W  +G +I + +   +  + +    T K C+ K    D G Y +   N  G     + L VLD+
Sbjct: 17926 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVSWNPPHD-GGKPITNYILEKRE--TMSKIWARVTKEPIHPYTKFRVPDLLEGCHYEFRVSAENEIGIGDPSPPS-KPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRRDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETNYKVTG----------LRDGQSYKFRVIAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDRAAPTKA-RIDVTPVGSK---------LEIRNAAHE-DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERKDVASTEWSPLSTTSKKKSHLAKHLNEGNQYVFRVAAENQYGRGPFVETPKPIKAVDPLHPPGPPKNLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTPDWIKFKT--------VTNLACVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPIPTAKWTTDGNEIKTDEHYTVETDNFSSVLTIKNCLRK----DTGEYQITVSNAAGTKTVAVHLTVLDV 18545          

HSP 3 Score: 256.144 bits (653), Expect = 1.611e-67
Identity = 181/564 (32.09%), Postives = 275/564 (48.76%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP-HLCR 1130
            L + N   E  G Y + + N  G     + V ++DKP PP+ +EV+ I K+SC +    P DDGG+ I +Y++E  DV+S+  +WS ++    K  KS    +L   ++Y FR  A N+ G   P   + + I   DP   P  P     +D       L W  P+ DGG+PIT Y +EY+E+    W          I+ KT  N   +V     GL +G  Y FR+KA N  G  LP +T+  +  + + + P   L    I  + +K G T R+     G P P+  W  +G+ +  D    +  + FS         +VLT+    R  DTG Y I +    GT+    ++ VLDVP  P   +N  E+  E++ +SW  P DDGG+P+ +Y+++  D     W + +  +  TK  V  L+ G+ Y F V A NK G   P  ++ P  A++ + PPS P +P + D    + T+ W  P  DGG PIT Y +++++  G W    KT        + +L+ R+ GL EG  Y+FR+ A N AG S PS  + P   CR
Sbjct: 18216 LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERKDVAST--EWSPLSTTSKK--KSHLAKHLNEGNQYVFRVAAENQYG-RGPFVETPKPIKAVDPLHPPGPPKNLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTPDW----------IKFKTVTNLACVV----TGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPIPTAKWTTDGNEIKTDEHYTVETDNFS---------SVLTIKNCLRK-DTGEYQITVSNAAGTKTVAVHLTVLDVPGPPTGPINILEVTPEYMTISWLPPKDDGGSPVINYIVEKKDTKKDTWGVVSSGSSKTKLKVPHLQKGYEYVFRVKAENKIGIGPPLDSV-PTVAKHKFSPPSPPGKPVVTDITENAATVAWTLPKSDGGSPITGYYLERREVTGKWVRVNKTP-------LVDLKFRVTGLYEGNTYEFRVFAENLAGLSGPSPSSDPIKACR 18741          

HSP 4 Score: 249.595 bits (636), Expect = 1.970e-65
Identity = 201/659 (30.50%), Postives = 305/659 (46.28%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL--INVNIMDK---PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDE--VLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++   N  G  E L  + V  +D    P PP ++E+T ++K    +  S P+ DGG+EI  YI+E  +   +S +W +V +      + +K   L     Y +R  A N  GLS P E S   I  +DP   P  P +P+V+D    +  + W  P  DGGAPIT Y +E+K+     WQ   I N    E             T  GL  G EYVFR++++NK GAS PS++SD  +AK R  +P   L       + +K G +F   + F G P PSV+W +  + L     R  I+         E  T LT+  ANR+ D+G YT+ +         T  V VLD P  P  +   ++  E   LSW  P +DGG P+ +Y I+  +     W+      +  +  +  L+ G IY F V   N+ G   P  T E +K     + PS P++  +      SV+L W KP  DGG  I HY+I+  +K        +T    C A +      + GL +   Y FR+ A N+AG S P     P L + +   P ID  +  S T+ V   +  +  I + G+P P+ T  ++G+ + +T      IT E         + + +S   DAG Y + A N +G  K  ++++VLD
Sbjct: 26897 FRVTGVNKYGVGEPLESMAVKALDPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIVERRE--KNSLRWVRVNKKPVYDLR-VKSTGLREGCEYEYRVYAENAAGLSLPSE-SSPLIRAEDPVFLPSPPSKPNVMDSGKTNITIGWVKPLFDGGAPITGYTVEFKKSDETDWQTA-IQNLRGTEY------------TVSGLTTGAEYVFRVRSINKVGASDPSDSSDPQIAKEREEEPVFDLDTEMRKTLIVKAGASFTMTVPFRGRPVPSVSWSKPDTDL---RTRAYID-------STESRTSLTIENANRN-DSGKYTLMIQNVLNAASLTLVVKVLDSPGPPANITVHDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKITNLQEGAIYYFRVSGENEFGVGVPAETKEGVKIT---EKPSPPEKLGVTSVSRDSVSLAWLKPEHDGGSRIVHYVIEALEKG-------QTTWMRC-AVVKSTHHVVSGLRQNSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLT------INLKESVAADAGRYEITAANSSGTTKAFINIVVLD 27510          

HSP 5 Score: 246.128 bits (627), Expect = 2.418e-64
Identity = 188/621 (30.27%), Postives = 284/621 (45.73%), Query Frame = 0
Query:  616 EVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            EV+ I+K+S VV  + P DDGG EI+ YI+E  D      +W++  +      +  +V  L   H Y FR  A N  G+ +P E S       D    P  P  P V D S +S  LAW  P  DGGAP+  Y +E KE +   W        +     T + GK     T   L E  EY FRI A+N  G   P+    SV AK R   P +         + ++   T R  +   G P P V WE+   +L   +DR  IE+ S         T+L +    R  D+G Y + L  + G++ A   V VLD P  P  L   E++ + + L+W  P  DGG  IT+Y+++  +     +       TK++   ++ L+ G  Y F V+A N+ G   P  T EP+KA    +PP  P    +VD    + T++W+KP  DGG  IT Y+++ + K         ++  S   ++  LEA I GL+ G+ Y FR+ A+N+ G+S P     P + R   + PS++   ++      ++  I  I  KG P    +W K+G  +  T  V ++  +        L + ++   D GTY L   N  G     + +IVLD
Sbjct: 25851 EVSAITKDSMVVTWARPVDDGGAEIEGYILEKRD--KEGVRWTKCNKKTLTDLR-FRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFSRAC-DALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYVVEVKEATADEW--------TTCTPPTGLQGK---QFTVTELKENTEYNFRICAINSEGVGEPATIPGSVAAKERQEPPEIELDADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGVL---TDRAQIEVTS-------SYTMLVIDNVTR-FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVILAWEPPLIDGGAKITNYIVEKRETTRKAYATVTNNCTKNS-FKIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKAS---EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK--------GSEKWSICTQVKTLEATISGLTAGEEYIFRVAAINEKGKSDPRQLGVPVIARDIEIKPSVELPFNTFNVKARDQLKI-DIPFKGRPQATVSWKKDGQTLKETTRVNVSSSK----TVTSLIIKEASREDVGTYELCVSNSAGSVTVPITVIVLD 26428          

HSP 6 Score: 244.588 bits (623), Expect = 7.039e-64
Identity = 176/563 (31.26%), Postives = 269/563 (47.78%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            L V N  R  +G Y + + N  G       V ++D P PP  I    +++ S  +    P  DGG  I HY++E  + S  S  W  V++   +  + ++V++L+    Y FR  A N  G+ +P+E+    +      ++P  P R  ++D S +S  LAW  P+ DGG+ IT Y +E ++K    W +               + K M   T + LVE  EY FR+KA N  G S P E   SV+ K   ++P     GI N  I  K G TF  D+   G PAP VTW+    + L ++DR+SI          +  T L+V  + R  D+G Y + L    G +  T  V V+  P      +    I AE   LSWA P D+GGT IT+Y+++  +     W L     K T+  V  L     Y F V + N+ G S+P  +  PI AE+P+ PPS P  P +      ++++RW++P  DGG  +  Y ++KK++    +  +K +   C     E   ++ GL EG  YQFR  A+N AG S  S  ++P + ++
Sbjct: 29355 LTVENCNRTDAGKYTLTVENNSGSKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRS--WQVVSEKCIR--QILRVSDLLEGVPYYFRVSAENEYGVGEPYEMPEPMVAT----EQPAPPRRLDIVDTSKSSVVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAG-------------HTKQMTF-TVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLE-EMRLKETDRVSI-------TTTKDRTTLSVKDSMRG-DSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISAESCVLSWAEPQDNGGTDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPVESA-PIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILW--VKENKVPCL----ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPVMAQN 29879          

HSP 7 Score: 239.58 bits (610), Expect = 2.457e-62
Identity = 185/554 (33.39%), Postives = 266/554 (48.01%), Query Frame = 0
Query:  583 SGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSS---NSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETS----DSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            +G Y + + N+ G  E  I V ++D P PP  + V  ISK+S  +   PP  DGG+ I +Y++E  D    S  WS V     K   S +V+NL     Y FR  A N  G+ DP E        +D     + PG    L  +S   +SC + W  P SDGG+ I  Y +++  +    WQ+  ++ +  ++             T K L EG EY FR+ A N+ G   PSE +    D V+A    LK       +     K+   FR  I   G+P PSV+W++    L  D+ R+S+E  +        NT L V    +S D G YTI L    GT++ T  + V+  P  P   +  +E+ AE + L W  P DDGG+ IT+Y+++  D  N  W+  A   + T   V  L  G  Y F V A NK G  E  ++ EPI A +P+  P  P  PNIVD  + SV+L W  P   GG PIT Y I+ K++    W  A KT        I   + ++ GL+EG  Y+FR++A+N AG   PS  ++P
Sbjct: 20703 AGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKS--WSTVTTECSK--TSFRVSNLEEGKSYFFRVFAENEYGIGDPGE-------TRDAVKASETPGPVVDLKVTSVTKSSCSIGWKKPRSDGGSRIIGYVVDFLTEE-NKWQR--VMKSLSLQY------------TTKDLTEGKEYTFRVSAENENGEGTPSEITAVAKDDVVAPDLDLKDLPDLCYL----AKENSNFRLKIPIKGKPVPSVSWKKGEDPLATDT-RVSVESSA-------VNTTLVVYDCRKS-DAGKYTITLKNVAGTKEGTLTIKVVGKPGIPTGPIKFEEVTAEAVTLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVMRLHEGMEYTFRVSAENKYGVGEGLKS-EPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLLWKRANKTP-------IRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEP 21209          

HSP 8 Score: 239.58 bits (610), Expect = 3.077e-62
Identity = 180/559 (32.20%), Postives = 268/559 (47.94%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-----KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  SG Y I  +N  G       V +MD P PPK ++V+ I++ SC +    PDDDGG  IK Y+IE   +   +  W++V         S  V +LI    Y FR RA NR G+  P E + Q    +DP   PD P +  +   + N+  L+W  P++DGG+P+THY +E             W+Q    N  D+E          +  T + L+EG EY FR+KAVN  G S PS T   V+ K +   P +       +E+++G          G P P++TW +       + + I  +    K V  +    L + ++ RS DT  YTI  + + GT      +NVL  P  P   +  + I A+ + LSW  P DDGG+ IT+YVI+  + +   W+  + E K+   T+  L  GH Y F ++A NK G  EP  + EP  A N +  P  P +P +      S+T+ W++P  DGG P+T Y ++ KD     +  +  D    +A    +  ++ GL EG  YQFR+ A+N AG    S  + P   R
Sbjct: 16824 KRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKA--WTKVNP--NCVSTSFVVPDLIAGQEYFFRVRAENRFGVGAPAE-TIQRTTARDPIYPPDPPIKLKIGLVTKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQ---CNKRDVE---------ELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSATVGPVIVKDQTCPPAIELKEF--MEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPIVYDTHVNKLV-VDDTCTLVIPQSRRS-DTALYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPIDDGGSKITNYVIEKREANRKTWVRVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTTKRWKRVNRD--PIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATAR 17358          

HSP 9 Score: 238.424 bits (607), Expect = 6.142e-62
Identity = 191/620 (30.81%), Postives = 284/620 (45.81%), Query Frame = 0
Query:  545 IELSVFKDGKEVKVGQDVNI--------------NF------HGDRVDLN--------VINP-KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ-GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            ++LS FKDG EV V   + I              +F       GDRV +         VI+P +R   G Y + + N        I+VN++ +P  P+ ++   I+K+S  +   PP+DDGG+ +  Y+IE  +VS  +  W++V   D        V +L+    Y F+  A N+ G  +P  +  + + +  P   PD P      D ++ S  L W  P+ DGG+ I  Y +E   +    W   GE +  + +E+               GL EG  Y +R+KA+N+ GAS PS+ ++ + A      P  FL    +  I +K G          G+P P +TW +   +LL    RI+IE   KK+        +T+  + RS DTG Y I+ +   G   A   VNVLD P  P   +  ++  E   L+W  P DDGG+ IT+YV++    D+  W     T KDTK     L P   Y F V A N  G  EP +   PI A+  + PP  P      D    +VTL W +P DDGG PIT Y +++ D +   W    K         I +   R+ GL+  K Y+FR++A N AG   PS  T+P L +
Sbjct: 14336 MDLSAFKDGLEVIVPNPIKILVPSTGYPRPTATWSFGDKVLEAGDRVKMKTLSAYAELVISPSERPDKGIYTLKLENRAKAISGEIDVNVIARPSAPRELKFGDITKDSVHLTWEPPEDDGGSPLTGYVIEKREVSRKT--WTKVI--DSVTDLEFTVPDLLQGKEYLFKVCACNKCGPGEPAYVD-EPVNMSAPATVPDPPENVKWRDRTAKSIFLTWDPPKHDGGSRIKGYIVEKCPRGSDRWVACGEPVADTKMEVT--------------GLEEGQWYAYRVKALNRLGASKPSKPTEEIQAIDTQEAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTK-ADMLLKQDKRITIENVPKKST-------VTIMDSKRS-DTGRYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSDMWHKLSSTVKDTKFKATKLTPNKEYIFRVAAENMYGVGEPVQAT-PITAKFQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPESDKWVRCNKMP-------IKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 14919          

HSP 10 Score: 236.884 bits (603), Expect = 2.004e-61
Identity = 181/641 (28.24%), Postives = 283/641 (44.15%), Query Frame = 0
Query:  608 KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGL-----WQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNG---SLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS-----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +PDPP   EVT +SK    V  +PP+ DGG  I  Y +E  +    S +W  V ++     + +KV NL+  H Y+FR +A N +G+ +P  +  + ++ KDP + P  P    V+D + +S  L W  P  DGGAPI  Y +E + K   +     W++    N +   ++ +         T   L E  EY FR+ A N+ G   P+E  D++  K     P +         + ++ G   R      G PAP VTW + G    +  G  D +    F            L +  + R  D+G Y++ L+   G +     V VLD P     L   ++     ++SWA P +DGG+ +T Y+++  + +   W     E K T   V  L PG  Y F V AVN+ G   P    +P+ A +P   P  P++  + +    S  L W  P  DGG  I  YI+  ++      +    D  +  + + +L   + GL EGK Y+FR+ A N  G S P      +E K  L   K L P          TIK  +    +  V G+P P   W K    + ++  + + + E     ++ L +      D+G YSL AEN +G D   + +IV+D
Sbjct: 19340 RPDPP---EVTKVSKEEMTVVWAPPEYDGGKSITGYYLEKKE--KHSTRWVPVNKS-AIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPS-LPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKKADMSPDEGWKR---CNAAAQLVRMEF--------TVTSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF------------LVIPNSTRD-DSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVEKREAERKTWATVTPEVKKTSFHVTNLVPGTEYFFRVTAVNEYGPGVPTDVPKPVLATDPLSEPDPPRKLEVTEMTKNSAVLAWLPPLRDGGAKIDGYIVSYRE------EEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP-------EQITIKAGKKLRIEAHVYGKPNPVCKWKKGEDDVVTSSHLAVHKAE----NSSVLIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMD 19932          

HSP 11 Score: 236.113 bits (601), Expect = 2.955e-61
Identity = 197/658 (29.94%), Postives = 299/658 (45.44%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G  E L +  ++ K     P PPK++EVT+I+K+S  V  + PD DGG+EI  YI+E  D   S  +W +  +      + ++V  L   H Y FR  A N  G+ +P   S   +  K  DP  +P  P    V+D + NS  LAW  P  DGG+ I  Y +E  +     WQ           I T   G          L E  EY  R+ A+NK G    +    +V  + +   P L         I ++ G + R  I F G P P +TW R        +D++ IE   K   Y    T L++   +R+ D G Y +KL    G++ A   V VLD P  P+ L   E+R + + L W  P  DGG  + +YVI   +     +   + +   T   V+ L  G IY F V+A N+ G   P  T++ +KA    +PPS P +  + D    S +L W+KP  DGG  I  Y+++ + K         T+  S  A      A + GLS G+ Y FR+ A N+ G+S P     P + +   + PS  K   ++ +++       +I V G P PE +W K+G  +  T     TR   +  AT+  L + +S   D G Y++ A N  G    +L +I+L+
Sbjct: 24733 FRIMAVNKYGAGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRD--RSGIRWIKCNKRRITDLR-LRVTGLTEDHEYEFRVSAENAAGVGEP---SPATLYYKACDPVFKPGPPINAHVVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQ-----------IVTPQTGLKATRFEISKLTEHQEYKVRVCALNKVGLGEATAVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSVRIHIPFKGRPTPEITWSREEGEF---TDKVQIE---KAANY----TQLSIDNCDRN-DAGKYVLKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWDPPLIDGGAKVKNYVIDKRESTRKAYANVSNKCSKTSLKVENLTEGAIYYFRVMAENEFGIGVPVETVDAVKAS---EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPK--------GTEKWSVVAESKVCSAVVTGLSSGQEYHFRVKAYNEKGQSDPRVLGVPVIAKDLTIQPSF-KLPFNTYSVQAGEDLKIEIPVIGRPRPEISWVKDGEPLKQT-----TRVNVEKTATSTILHIKESNKDDFGKYTVTATNSAGTATENLSIIILE 25345          

HSP 12 Score: 236.113 bits (601), Expect = 3.542e-61
Identity = 171/562 (30.43%), Postives = 266/562 (47.33%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            L + N  R  SG Y + I N+ G     +NV ++D P PP+ ++V  ++K S  +   PP  DGG++I +YI+E  +  S+   +S V     K   S KV+ L     Y FR  A N  G+  P E +     +K   + P  PG+ +++D + NS  L+W  PE DGG+ I  Y +E + K    W     +  ++               T  GL++G EY FR+ A N+ G S P + S  V+AK   + P           +  G   + D+ F G P P+VTW ++  + L  + R++ E         E N++LT+ +A R  D GHY +KL    G    T  V VLD P  P   +  +E+ A+ +  SW  P  DGG+ I +Y+++  D     W     T   + T+K   LK G  YQF + A N+ G+S    T EP+ A+ P+K P  P  P +      S+ + W +P  DGG  +  Y +++K++    W    KT        I + + +  GL EG  Y+FR+ A N  G   PS  ++ ++ R
Sbjct: 22858 LIIGNVNRFDSGKYILTIENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLIDGGSKINNYIVEKRE--STRKAYSTVTTNCHK--TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES---VKAS-ERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWVTCATVKVTE--------------ATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL-LFTTFTVLAGEDLKVDVPFTGRPTPAVTWHKD-DVPLKQTTRVNAE-------STENNSLLTIKEACRE-DVGHYIVKLTNSAGEATETLNVIVLDKPGPPTGPVKMEEVTADSVTFSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATV-ARTTIKACRLKTGCEYQFRIAAENRYGKST-YLTSEPVVAQYPFKVPGPPGTPFVTLSSKDSMEVHWNEPVSDGGSKVIGYHLERKERNSILWVKLNKTP-------IPQTKFKTTGLDEGIEYEFRVSAENIVGIGKPSKVSESYVAR 23378          

HSP 13 Score: 234.958 bits (598), Expect = 7.561e-61
Identity = 181/630 (28.73%), Postives = 281/630 (44.60%), Query Frame = 0
Query:  607 DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            D P PP  + VT +++    +   PP+ DGG EI +Y+IE  D +S   + +   +A+     S  V +++    Y FR RA NRIG+  P   +   I + DP + P  P   +  D + +S  L W  P  DGG+PI  Y IE  E+    W            I+ +    P +     GL +GN+Y++R+ A N+ G S PSE    + A     +P +      + +E+      +  +   G P P+ TW   G  +L   DR+ ++  S    Y E    L ++ + R  D G YT+KL            VNV+  P  PR L   +I  + ++L+W  P DDGG+P+T YVI+  ++    W   +++  D + TV  L  G  Y F+V A NK G  EP    EP+    P   P  P+     D   +S+ L W  P  DGG  I  YI++K  +    + A       C   + + +  + GL EG+WY +R+ A+N+ G S PS  T+          P I  D    +  T+K          V G+P P+ TW K  + +     + I     +   T    +  S+  D G Y + A N  G+    +++ VLD
Sbjct: 14130 DVPGPPLNVTVTDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWETAMTVRAEDL---SATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFIKVADPIERPSPPVNLNASDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNW------------IRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDADAEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPTATWS-FGDKVLEAGDRVKMKTLS---AYAE----LVISPSERP-DKGIYTLKLENRAKAISGEIDVNVIARPSAPRELKFGDITKDSVHLTWEPPEDDGGSPLTGYVIEKREVSRKTWTKVIDSVTDLEFTVPDLLQGKEYLFKVCACNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTAKSIFLTWDPPKHDGGSRIKGYIVEKCPRGSDRWVA-------CGEPVADTKMEVTGLEEGQWYAYRVKALNRLGASKPSKPTEEIQAIDTQEAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADMLLKQDKRITIENVPKKSTVT----IMDSKRSDTGRYIIEAVNVCGRATAVVEVNVLD 14723          

HSP 14 Score: 232.646 bits (592), Expect = 4.157e-60
Identity = 198/659 (30.05%), Postives = 286/659 (43.40%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS----GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L     + V+    PDPPK  EVT I+K+S VV    PD DGG+EI +YI+E  D   +  +W +  +      +  KV+ L   H Y FR  A NR G+S P   S      D + K     P  PG P VLD S +S  +AW  P  DGG+ IT Y +E        W+           I T  +G      T   L E  EY  RI A+N  G   P+    +  A+ R L P +         + I+   T R  +   G PAP V W R     L   D+ SIE  S         T+L +   NR  D+G Y + +    G++ A   V VLD P  P+ L   E+    + L+W  P  DGG+ I +Y+++  +     +         T   V  L+ G  Y F V+A N+ G   P  T E +KA    + P  P +  +VD    SV+L W+KP  DGG  I  YI++ + K         +D     A +   EA I GL +G+ Y FR+ A N+ G S P   + P + +   + P+  K   ++ T+         +   G P P  TW+K+ + +  T  V     E     T K    +    D G Y +   N  G+    L++IVLD
Sbjct: 22569 FRVMAVNKYGVGEPLDSEPVLAVDPYGPPDPPKNPEVTSITKDSMVVCWGHPDSDGGSEIINYIVERRD--KAGQRWVKCNKKTLTDLR-YKVSGLTEGHEYEFRVMAENRAGISAPSATSPFYKACDAVFK-----PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWK-----------IVTPPSGLKATSYTITNLTENQEYKIRIYAMNSEGIGEPALVPGTPKAEDRMLPPEIELDAELRKVVTIRACCTLRLFVPIKGRPAPEVKWTREHGESL---DKASIESTS-------SYTLLIIGNVNR-FDSGKYILTIENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLIDGGSKINNYIVEKRESTRKAYSTVTTNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS---ERPLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSK--------GSDKWVTCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAF-KLLFTTFTVLAGEDLKVDVPFTGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACRE----DVGHYIVKLTNSAGEATETLNVIVLD 23181          

HSP 15 Score: 229.565 bits (584), Expect = 3.816e-59
Identity = 184/661 (27.84%), Postives = 294/661 (44.48%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP----FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L +  +  K     PD PK  E+T ++K+S +V    P  DGG+EI  Y++E  D      +W++       G   ++V  L+  H Y FR  A N  GLS+P   S       DP  +P  P  P V D + +S  L+W  P  DGG  I  Y +E  + S+G W        +N ++IE++               L+E +EY FRI AVNK G    ++    V+ + +   P     L    I N  I+ G + R  +   G P P V W +    +   +   S   F          T L +   NR  D+G YT+ L    GT+ A   V VLD P  P  L   EI  + ++++W  P  DGG+ I +Y+++  +     +   +      +  +  L+ G  Y F V A N+ G   P  T +P+K     +PP    +  + D    SV+L W KP  DGG  I  YI++ + K    W +          AR+  LEA I  L++G+ Y FR++AVN+ G S P     P + +   + P + + + +S +++V +    ++ + G P P  TW K+ + +  T  + +T           L + ++   D G Y +   N  GQ    +++I LD
Sbjct: 23651 FRVMAVNKYGVGEPLESEPVTAKNPFVVPDAPKAPEITAVTKDSMIVVWERPAFDGGSEILGYVLEKRD--KEGIRWTR-CHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKAC-DPIYKPGPPNNPRVTDITRSSVFLSWGKPIYDGGCEIQGYIVEKCDTSVGEWTMCTPPTGINKTNIEVEK--------------LLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIDLDLELRKILN--IRAGGSLRLFVPIRGRPTPEVKWGKVDGEIRDAAIIDSTSSF----------TSLVLDNVNR-YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAHTDDPVKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC---------ARVKSLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV-RPAFNSYSVQVGQDLKIEVPISGRPKPTITWTKDDLPLKQTTRINVT----DSLDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEIITLD 24263          

HSP 16 Score: 229.18 bits (583), Expect = 4.570e-59
Identity = 162/546 (29.67%), Postives = 263/546 (48.17%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            L + N  R  SG Y + + N  G     +NV ++D P  P  + V  + K+S ++   PP  DGG +I +YI+E  +  ++   ++ V     K   S K+ NL     Y FR  A+N  G+  P E + + +   +P   P  PGR +++D + N+  + W  PESDGG+ IT Y +E + K    W            I T V     +  T  GL  G EY+FR+ A+N+ G S P +    V+A+   +KP +  P      +K     + DI F G P  +V+W+++G   L ++ R+++   S KTV     T L + +A+R  D G Y + +    G+      V VLD P  P  ++ DE+  ++I +SW  P  DGG  I++Y+++  +  +  W + +     T   +  L  G  YQF V A N+ G+S    +   + AE P+ PP  P  P +V     ++ + WQ P +DGG  +  Y ++ K++    W  A KT        I + + ++ GL EG  Y++ + A N AG
Sbjct: 26105 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVILAWEPPLIDGGAKITNYIVEKRE--TTRKAYATVTNNCTKN--SFKIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKASEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWS-----------ICTQVK---TLEATISGLTAGEEYIFRVAAINEKGKSDPRQLGVPVIARDIEIKPSVELP-FNTFNVKARDQLKIDIPFKGRPQATVSWKKDGQ-TLKETTRVNVS--SSKTV-----TSLIIKEASRE-DVGTYELCVSNSAGSVTVPITVIVLDKPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETTSTTWHVVSQAVARTSIKIVRLVTGSEYQFRVCAENRFGKSSYSES-SAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVLGYHLEYKERSSILWSKANKT-------LIADTQMKVSGLDEGLMYEYHVYAENIAG 26610          

HSP 17 Score: 228.024 bits (580), Expect = 1.050e-58
Identity = 166/564 (29.43%), Postives = 269/564 (47.70%), Query Frame = 0
Query:  577 NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDP---WDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRI----SIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            N  R  SG Y + + N+ G     + V ++D P PP  ++VT I+K+S  +   PP  DGG++IK+YI+E  + +  S  ++ V     K   S K++ L     Y FR  A N  G+  P           DP    + P  PG+ +V D + NS  L+W  PE DGG+ I  Y +E + K    W +   + +              +      L +G EY+FR+ AVN+ G S P   +  ++AK   ++P + +P   +  ++ G+  + ++   G P P++TW ++  L L  + RI    S++L           TVL++ + ++  D GHY I +    G + A+  +  LD P+ P+  +  DE+ AE I LSW  P   GG  IT+YV++  D     W + +     T   V  LK G  YQF + A N+ G+S    + EPI A+ PYK P  P  P +      S+ ++W +P ++GG P+  Y ++KK++    W    KT        I + + +   L EG  Y+FR+ A N  G    S  ++ ++ R
Sbjct: 23944 NVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKN--SWKIDQLQEGCSYYFRVTAENEYGIGLPAHTD-------DPVKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKS--------------LEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV-RPAFNSYSVQVGQDLKIEVPISGRPKPTITWTKD-DLPLKQTTRINVTDSLDL-----------TVLSIKETHKD-DGGHYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESITLSWEPPLYTGGCQITNYVVQKRDTTTTVWEVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-EPIVAQYPYKEPGPPGTPFVTAVSKDSMVVQWHEPINNGGSPVIGYHLEKKERNSILWTKVNKTI-------IHDTQFKAVNLEEGIEYEFRVYAENIVGIGKASKNSECYVAR 24460          

HSP 18 Score: 225.713 bits (574), Expect = 5.042e-58
Identity = 169/558 (30.29%), Postives = 261/558 (46.77%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  +G + + I N  G     +NV ++D P P   +  T I+K S  +    P  DGG+ I +YI+E  + +  S  +S V     K   + KV  L     Y FR  A N  G+ +P E +       +P    + P  P   +++D + ++  LAW  P+ DGG+ IT Y IE + K    W              T V G   +    K L EG EY F++ AVN  G S P E S  V+ K + + P L   GIY   +  K G   + +I   G P P+VTW++ G  +L  + R++ E           +T+L + +  RS D+G Y +      G       + V D+P  P   +  DE+ ++ +  SW  P +DGG PI++YV++M   D+  W+  + T   + T K   L  G  YQF V A N+ G   P  T  P+ A  P+K P  P  P +      S+T+ W +P  DGG PI  Y +++K++ G  +  +       +A +     +  GL++G  Y+FR+IA N AG+  PS  ++P L 
Sbjct: 21781 RYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKESVTLHWDLPLIDGGSRITNYIVEKREATRKS--YSTVTTKCHKC--TYKVTGLSEGCEYFFRVMAENEYGIGEPAETT-------EPVRASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTH-----------ITTVKG---LECVVKNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQRVNFE-------NTATSTILNINECVRS-DSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVE-LATTVIRTTYKATRLTTGVEYQFRVKAQNRYGVG-PSITSAPVVANYPFKVPGPPGTPQVAAVTKDSITISWHEPLSDGGSPILGYHVERKERNGILWQTV------SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKGKPSKPSEPILA 22295          

HSP 19 Score: 225.328 bits (573), Expect = 7.672e-58
Identity = 195/638 (30.56%), Postives = 284/638 (44.51%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQA--DGKGPKSIKVN--NLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ--KKDKFGGWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA---TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P PP   +V   +K S +V  +PP D+GG+ I  Y +E  +       WS+V++A     G K ++ N   LI   +Y+FRA A N  G+  P E S  ++   DP   P  P RP V D + +S  LAW  P  DGG+PI  Y +E +E+    W+    +N  D  +       P        L E  +Y FR+KAVN+ G S PS+T+  + A      P  F+       +  + G   R      G P P  +WE +G       D +       +    E ++V+ + +  RS  +G Y+I      G + A   V V+DVP  P+ L   +I      LSW  P DDGG  I  YVI+   ID   W         T   V  L  G  Y F V A N+ G   P  T++   A +P  PP  P +  I      +V L W+ P +DGG P+THYI++    D  G   +A +     C  R ++ELE  +  L EG  Y+FR+ AVN AG S PS    P + + +   P+I+  +     +   VN  A    K+KG P P  TW+K   +     E ++            T  L + +S+  D   Y++ A N  G    ++ L VL
Sbjct: 16541 PGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKRE--EGGAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPEVA-GDPIYPPGAPSRPEVKDKTKSSITLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKS---VNEPDKLL-------PTCECVVPNLKELKKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLICQAGTQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRS-HSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPNCVSTSFVVPDLIAGQEYFFRVRAENRFGVGAPAETIQRTTARDPIYPPDPPIKLKIGLVTKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWR----QCNKRDVEELEFTVEDLIEGGEYEFRVKAVNAAGVSKPSATVGPVIVKDQTCPPAIELKEFMEVEEGTDVNIVA----KIKGVPFPTLTWFKAPPKKPDNKEPIVYDTHVNKLVVDDTCTLVIPQSRRSDTALYTITAVNNLGTASKEMRLNVL 17156          

HSP 20 Score: 222.631 bits (566), Expect = 4.591e-57
Identity = 182/602 (30.23%), Postives = 276/602 (45.85%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQ--WSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ---GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL-LGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            V+G  + DI  S  K+GK +   + VNI     RV+L +    R   G Y I  +N+ G  +    VN++D+P P + ++VT+++K +C +    P D+GG+EI ++I+E        NQ  WS VA    K  + IK N L N + Y FR  A N++G+  P   +   I+  +P D P +P    + D       L W  P+ DGG+P   Y +E + K    W++   G I  T               H      VE   Y FR++  N+GG S   +T + V+ K    KP L       + +K G T R +    G+P P V+W ++     L  S R+ I+     + +       ++TKA RS D G Y +      G+  A   VNVLD P   R L   ++ ++  +L W  P DDGG  I +Y+++  +     W     T  T   TV  L  G+ Y F V A NK G   P  T +P+ A+  Y  P  P  P +     + +T+ W  P  DGG+ IT Y ++KK+K    W    K       + I E   ++  L  G  YQFR+ A N+ G   PS  ++P + +
Sbjct: 18874 VKGRPEPDITWS--KEGKALVRDKRVNIIHELPRVELQIKEAVRADHGKYIISAKNSSGHAQGFAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY----RKPNQKGWSIVASDVTK--RLIKANLLAN-NEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGAADWERVHKGSIKET---------------HYMVDKCVENQIYEFRVQTKNEGGESDWVKT-EEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKIDTSGDSSKF-------SLTKAKRS-DGGKYVVTATNTAGSFVAFATVNVLDKPGPIRNLKITDVCSDRCSLRWDPPEDDGGCEIQNYILEKCESKRMVWSTFSSTILTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTET-KPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWAPPEYDGGKSITGYYLEKKEKHSTRWVPVNK-------SAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAK 19433          

HSP 21 Score: 221.861 bits (564), Expect = 9.179e-57
Identity = 184/615 (29.92%), Postives = 284/615 (46.18%), Query Frame = 0
Query:  616 EVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS---IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF-LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQ 1221
            EV++++KN+  V    P DDGG+EI  Y +E  +    S +W +      K P S    KV  L   + Y FR  A N+ G+  P + S   +++KD    P  P    V D +  S  LAW  P  DGG  IT Y +E+++    +  +G I +T+   ++       +       L    +Y FRI A+N  G   P+   +  + +      F L       + ++ G + R  +   G PAP VTW ++   L    +R +IE         E  T+L + + NR  DTG + + +    G +     V VLD P     L P +I  E + L W  P  DGG+ IT+Y+++  +     +   + TK  K T  V GL  G  Y F V+A N+ G  EP  T EP++A    + PS P   NI+D    +V+L W KP  DGG  IT Y+I+ + K    +  + T        +  LE  +  L+EG+ Y F+++AVN AG S+P  E++P + + + + P +D      K +  K       +I V G P P  TW K G QI    +    R  ++  AT+  L +++    D+G Y L A N  G+
Sbjct: 21521 EVSNVTKNTATVSWKRPVDDGGSEITGYHVERRE--KKSLRWVRAT----KTPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSDASNP-VLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQK----VGDEGWIKDTTGTALR-------ITEFVVPDLETKEKYNFRISAINDAGVGEPAVIPNVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL---KNRANIE-------NTESFTLLIIPECNR-YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKESVTLHWDLPLIDGGSRITNYIVEKREATRKSY-STVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVRAS---EAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--------VKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQ----RVNFENTATSTILNINECVRSDSGPYPLTARNIVGE 22088          

HSP 22 Score: 219.935 bits (559), Expect = 3.635e-56
Identity = 178/645 (27.60%), Postives = 283/645 (43.88%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT-----VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKV--NRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            E ++  N    P  P   E     K   +++ + P+ DGG +I +Y+++  +    S +W++V +        +KV  L+    Y+FR  A N  G S+P E S   I  ++P   P  P  P V+D + +S  LAW  P  DGG  I  Y +E +EK    W +      ++  I+ +         T   L  G +Y FR+ AVN  G S  SE++  +    R   P L         + I+ G + R  +   G P P +TW + G           I+L S+  +   E  ++L V K NR  D G YTI+     G + AT  V V D P     +   E+  + + ++W  P  DGG P+ +Y+I+  +      + A +T  TK +     + GL  G +Y F V+  N  G  EPC T + +      + P  P +  +VD    +VTL W+KP  DGG  +T Y+++  +     W   +             LE  +  L+EG+ Y FR+ A N+ G S P         +   + P+ID  +   KTI V   R     I + G PPP  +W+  G ++  ++ V +          AKL + ++ + D G Y L  +N  G     + +IVL
Sbjct: 30171 EPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNDISNYLVDKRE--KKSLRWTRVNKDHVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNF-ISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWYRVH----TNATIRNN-------EFTVTDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKG-----------IDLASRAIIDTTESYSLLIVDKVNR-YDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEVPTIDGGAPVNNYIIEKREAA----MRAFKTVTTKCSKTLYRISGLIEGAMYYFRVLPENIYGIGEPCETSDAVLVS---EVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACRAGTERWMKVVTLKPTV-------LEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT----KVAKLTIRETTIKDTGDYVLELKNVTGTTSETIKVIVL 30771          

HSP 23 Score: 219.164 bits (557), Expect = 6.499e-56
Identity = 189/672 (28.12%), Postives = 295/672 (43.90%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNI-----MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD---------VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            +++   N  G  E +    I      D P PP  +E + I+K++  +    PDDDGG+ I  Y +E +D    S++W +  +   K   + +V  L NK +YRFR  A N  G   P + S + I+IKD  D P  PG+P V D    S  L W  PE DGGA I  Y IE  +     W +                G P       GL+EG EY FR++AVNK G S PSE SD VL + +   P   +   + NI  K     ++ +    GG P  +   E+       D  R   +     TV   K TV  +T+ +       Y  ++  +    Q+  Y  V D          P  P  L   ++   H++L W  P +DGG PI  YVI+  +     W+ A +T   D    V  +  G   QF+V A N+ G   P    E +K E+P  PPS P + ++ D   + + + W+ P  +GG PI  Y ++        W           + +++E      G+   K Y  R+ AVN  G S PS  ++  + +  +  P+ID  +     I+  + +I  +  +  P P  +W+K+G ++ ++D + +  +      +A L V KS   DAG Y++  EN+ G     +++ V+ L   C
Sbjct: 14796 FRVAAENMYGVGEPVQATPITAKFQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLD--PESDKWVRCNKMPIKD-TTYRVKGLTNKKKYRFRVLAENLAGPGKPSK-STEPILIKDAIDPPWPPGKPVVKDIGRTSLMLNWTKPEHDGGAKIDSYVIEMLKTGTEDWVRV-------------AEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINI-TKNTADLKWTVPEKDGGSPITNYIVEKR------DVRRKGWQTVDT-TVKDTKCTVTPLTEGSL------YVFRVAAENAIGQS-DYCEVEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAGKTSGPDCHFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILKIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEE------GVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCRPTIDLETHDIVVIEGEKLSI-PVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHI----SAHLEVPKSVRADAGIYTVTLENKLGSATASINVKVIGLPGPC 15424          

HSP 24 Score: 218.779 bits (556), Expect = 7.451e-56
Identity = 187/636 (29.40%), Postives = 283/636 (44.50%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY-------NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEY----QGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P PP    VT I++N+  V  + P  DGG+ I  Y +E  +V+    + ++    D K     +V  L   + Y FR  A N  GLS P   S   I    P   P  P  P + D +  S DL W  P SDGG+PI  Y +E ++     W +   +N  ++ I+      P       GL+EGNEY FRIKA N  G   P E ++SV+AK       LH P +         I ++ G+T R      G P P +TW + G  L+ D  R++I       ++      L + +A R+ D G Y I      G  Q    VNVLD P   + L    +  E+  +SW  P D+GG+ IT+++++    +   W   + +  TK  +K  L   + Y F V A NK G      T  PI A NP   P EP+  +I D     V L+W++P  DGG P   Y ++++ K    ++ +       +  I E    +    E + Y+FR+   N+ GES    +T+  + +     P +D   S   T+K   T   +  V+G+P PE +W K+       D   +TR         G ++K  ++K++  D G Y + A N  G       + VLD
Sbjct: 18646 PSPPGKPVVTDITENAATVAWTLPKSDGGSPITGYYLERREVTGKWVRVNKTPLVDLK----FRVTGLYEGNTYEFRVFAENLAGLSGPSP-SSDPIKACRPIKPPGPPINPKLKDKTRESADLVWTKPLSDGGSPILGYVVECQKAGTTQWDR---INKDEL-IRQCAFRVP-------GLIEGNEYRFRIKAANIVGEGEPRELAESVIAKD-----ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKALVRDK-RVNI-------IHELPRVELQIKEAVRA-DHGKYIISAKNSSGHAQGFAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGAADWERVH------KGSIKETHYMVDKCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVSWTKD------KDATDLTRSPRVKIDTSGDSSKFSLTKAKRSDGGKYVVTATNTAGSFVAFATVNVLD 19237          

HSP 25 Score: 218.394 bits (555), Expect = 9.962e-56
Identity = 191/660 (28.94%), Postives = 296/660 (44.85%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLN--PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+ +N  G  E L        N+   P  P    V+ +++NS  V    P+ DGG+ +  Y +E  D  +++ +W +V +   K      S KV  LI    Y+FR  A N  G+  P  +       +DP   P  P    V DW+ +S DL W+ P  DGG+ +T Y +EYKE+              +     +V G  +V     GL EG  Y FR++AVN  G   P E +D++  K R   P L         I +  G   R   +  G+P P+VTW  N   L  ++   +IE  +  +    KN         RS   G Y++      G ++ T  V+VLDVP  P  +      +  +   L+W +P DDGG+PIT+YVI+  + D+  W     T     ATV+GL  G  Y F + A N  G      T + +   +P   P  P++  + +   +SVTL W  P  DGG  I +Y+++ +      F  + +D+      +   +  + GL EG  Y++R+ AVN  G+  PSF TKP  C+ +   P++D       TI+V        +  G+P P+ +W+K+   +   D   I         T  L   K++  D+G YS+V EN  G  K    + V+D
Sbjct: 17231 FRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD--TTTKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVG-PASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSRVTGYIVEYKEEGK---------EEWEKAKDKEVRGTKLV---VTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRLELPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPQEA---TIETTAISSSMVIKN-------CQRS-HQGVYSLLAKNAAGERKKTIIVDVLDVP-GPVGIPFLAHNLTNDSCKLTWFSPEDDGGSPITNYVIEKREADHRAWTPVTYTVTRHNATVQGLIQGKAYFFRIAAENSIGMGPFVETTDALVIRDPITVPERPEDLEVKEVTKESVTLTWNPPKYDGGSDIINYVLESRLIGTEKFHKVTSDN------LMSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIK----TTPTTLALEKLKAKRSDSGKYSVVVENSTGSRKGVCQVNVVD 17852          

HSP 26 Score: 218.009 bits (554), Expect = 1.378e-55
Identity = 168/549 (30.60%), Postives = 257/549 (46.81%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            +++   N  G  E L +  ++ K     P  PK   VT ++K+   V    PD DGG+ I  Y+IE  +   +S  W +      +         L+    Y FR  A N+ G S P + + + +  + P D    PG+P V+D S ++  L WA P+ DGG+ I  Y +E  +     W +    NTS  +I       P    T  GL E  +Y FR  A      S PSE SD V      + P +         + +K G     D    G+P P+V+W+++G+LL   S+ I + +   K   C    + +VT+     D+G YTI      G++ AT  + VLD P  P  +  +++ ++   LSW  P +DGG+ IT+Y++   +    +W     T   T  +V+ L  GH YQF + A NK G  +P  T EP  A+NPY PP     P I +     +T+ W+ P+DDGG PIT Y+++K++     W    +         + E   +  GL EG  Y+FR+IA+NKAG   PS  +K
Sbjct: 20006 FRVRAENRFGISEPLTSPKMVAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKE--RNSLLWVKANDTPVRS-TEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT-EYVTARTPVD---PPGKPEVIDVSKSTVSLVWARPKHDGGSKIIGYFVEACKLPGDQWIR---CNTSPHQI-------PQEEFTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIMAESVPPRIELSVAMKSLLTVKAGTNVCLDATVFGKPKPTVSWKKDGTLL-KPSEGIKMAM---KRNLCTLE-LFSVTRK----DSGDYTITAENPSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPILT-EPAIAKNPYDPPGRCDPPVISNVTKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNWTKVNRKP-------VIERTIKATGLQEGTEYEFRVIAINKAGPGKPSDASK 20520          

HSP 27 Score: 216.468 bits (550), Expect = 4.181e-55
Identity = 164/519 (31.60%), Postives = 244/519 (47.01%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            P PP T +V  ++K+S  +    P  DGG+ I  Y +E  +   +   W  V++A   G    K + L +   Y FR  A N  G   P + S + I+  DP D    PG+P  L+ + ++  L WA PE  GG  IT Y +E ++   G W +    N  + E             T  GL E   Y FR+ A N  GA S PSE SD++  +     P +     +   I +K G  F+ +    G P P++ W ++G  L  ++ ++ I++    T    K+++          D G YT+     GG  +   +V VLD P  P   L   E+ +E   LSW  P DDGG  I  YV++  +     W   A E + TK  V  L   + Y F V+AVNK G  EP  + EP+ A +PY PP  PK P +      S+ + W  P  DGG  I +YI++++DK G  W    K         + +L  ++ GL+EG  Y+FR++A N+AG S+PS
Sbjct: 22201 PGPPGTPQVAAVTKDSITISWHEPLSDGGSPILGYHVERKE--RNGILWQTVSKALVPG-NIFKSSGLTDGIAYEFRVIAENMAGKGKPSKPS-EPILALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF------------TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDIEAPRIMVDVKFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKEL-ENTAKLEIKIADFSTNLVNKDSLRR--------DGGAYTLTATNPGGFAKHIFHVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIEYYVVQKRETSRLAWTNVASEVQVTKLKVTKLLKSNEYIFRVMAVNKYGVGEPLDS-EPVLAVDPYGPPDPPKNPEVTSITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNK-------KTLTDLRYKVSGLTEGHEYEFRVMAENRAGISAPS 22683          

HSP 28 Score: 215.312 bits (547), Expect = 8.419e-55
Identity = 155/558 (27.78%), Postives = 258/558 (46.24%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            V I    +   L++ N  R  +G Y + + N+ G     + V ++D P PP+ + V  + K+S ++   PP  DGG ++K+Y+I+  +  S+   ++ V+    K   S+KV NL     Y FR  A N  G+  P E +   +   +P   P  PG+ ++ D S  S  L W  PE DGG+ I  Y +E + K    W              + V    +      GL  G EY FR+KA N+ G S P      V+AK   ++P    P      ++ G   + +I   G P P ++W ++G   L  + R+++E    KT     +T+L + ++N+  D G YT+      GT      + +L+ P  P   +  DE+ A+ + +SW  P   GG  I++Y+++  D     W + +     T   +  LK G  YQF + A N+ G+S P  + +P+  + P+K P  P  P +       + ++W +P +DGG  +  Y +++K+K    W    KT        I + + +  GL EG  Y+FR+ A N  G
Sbjct: 25011 VQIEKAANYTQLSIDNCDRNDAGKYVLKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWDPPLIDGGAKVKNYVIDKRE--STRKAYANVSNKCSK--TSLKVENLTEGAIYYFRVMAENEFGIGVPVE-TVDAVKASEP---PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKW--------------SVVAESKVCSAVVTGLSSGQEYHFRVKAYNEKGQSDPRVLGVPVIAKDLTIQPSFKLP-FNTYSVQAGEDLKIEIPVIGRPRPEISWVKDGE-PLKQTTRVNVE----KTA---TSTILHIKESNKD-DFGKYTVTATNSAGTATENLSIIILEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKMGSEYQFRIFAENRYGKSAPLDS-KPVIVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKTP-------IQDTKFKTTGLDEGLEYEFRVSAENIVG 25528          

HSP 29 Score: 214.927 bits (546), Expect = 1.290e-54
Identity = 189/694 (27.23%), Postives = 300/694 (43.23%), Query Frame = 0
Query:  454 PGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLG-DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHG--DRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQA--DGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWF-----GGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNT---------VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            P ADT+MEV  + +G+     +   ++   ++ A  P+         T     I  ++AP++  D   ++G+  K    G    +        E  +     ++ + QD  I       +  + +++ KR  +G Y I   N  G    ++ VN++DKP PP   ++T ++  SC++  +PP DDGG++I +Y++E    ++ S+ W +++    D K     K   L     Y FR  A N  G+ +P  +    I  K  +D P  P R    D + ++  L W  P+ DGG+PIT Y +E  +     W +   +   D   +             KGL    +Y FR+ A N  G   PS++++ +L K     P+   +P + +I    GRT     W      GG    S   E    L  G  D + +      T +              V  V KA  S +    +  +LC             L  P  PR L    I     +L W  P  DGG+PIT+Y+++  D+    W     T KDTK TV  L  G +Y F V A N  G+S+ C   + + A++ +  P  P    +VD   + V L+W+ P +DGGRPI  Y+I+KK+K G  W  A KT    C  R+ +       + EG   QF++ A N+AG   PS  T+
Sbjct: 14581 PVADTKMEVTGLEEGQW----YAYRVKALNRLGASKPSKP-------TEEIQAIDTQEAPEIFLDVKLLAGITVKA---GTKIELPATVTGKPEPKITWTKADMLLKQDKRITIENVPKKSTVTIMDSKRSDTGRYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVER--RATDSDMWHKLSSTVKDTK----FKATKLTPNKEYIFRVAAENMYGVGEP--VQATPITAKFQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPESDKWVRCNKMPIKDTTYRV------------KGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDAIDPPWPPGKPVVKDI----GRTSLMLNWTKPEHDGGAKIDSYVIEM---LKTGTEDWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGES-EPSEPSDPVLCR----------EKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAGKTSGPDCHFRVTD-------VIEGTEVQFQVRAENEAGVGHPSEPTE 15215          

HSP 30 Score: 214.542 bits (545), Expect = 1.556e-54
Identity = 169/559 (30.23%), Postives = 262/559 (46.87%), Query Frame = 0
Query:  604 NIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKP-FLHQPGIYN-IEIKKGRTFRYD-IWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            ++ D P PP  ++V H   +S  +  + P   GG+ I  Y IE  +   +S  W +  +   +  K  KV  L     Y FR  A N  G+  P  +  + ++  DP D    PG+P V+  + NS  L W  P+ DGG  +T Y +E +E     W +   +N  D               T   LVEG +Y FR++A N  GA S PSE++D+++ K  Y  P  +  P I + + +K G T     I   G+P P  +W + G  +   SD + I            ++++ V  A R  D G YTI      GT+     V VLDVP  P  +    + AE   L+W  P +DGG+PI SYV++  +     W + A + +  +     L  G+ Y F V AVN+ G+ EP ++ EP+K  + + PP  P +P + +    + T+ W++P DDGG  IT Y +++++K    W  A KT        + +L  ++ GL EG  Y+FR+ A NKAG   PS  + P L +     P     +  + T K + +  W
Sbjct: 21116 DVPDAPPPPNIVDVRH---DSVSLTWTDPRKTGGSPITGYHIEFKE--RNSLLWKRANKTPIRM-KDFKVTGLTEGLEYEFRVMAINLAGVGKPS-LPSEPVVALDPID---PPGKPEVISVTRNSVTLVWTEPKYDGGHKLTGYIVEKRELPSKSWTKANHVNVPDCAF------------TVTDLVEGGKYEFRVRAKNTAGAISAPSESTDTIICKDEYEAPTIVLDPTIKDGLTVKAGDTIILSAISILGKPLPKSSWSKAGKDIR-PSDIVQI-------TSTPTSSMIAVKYATRK-DAGEYTITATNPFGTKSEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYVFRVSAVNQYGKGEPVQS-EPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRATKTP-------VSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSDASNPVLMKDVAYPPGPPSNARVTDTTKKSASLAW 21635          

HSP 31 Score: 214.157 bits (544), Expect = 1.878e-54
Identity = 165/571 (28.90%), Postives = 254/571 (44.48%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            I+    R  L + N  R  SG Y ++I+N        + V ++D P PP  I V  ++K S V+    P++DGG  +K+Y IE  +  +S   W  V     +   S K+ NL     Y FR    N  G+  P E + + + I +    P+K G  SV   S +S  LAW  PE DGG+ I HY IE  EK    W +  ++ ++              H    GL + +EY FR+ A N+ G S P E    VL K +   P +       + + ++ G   + DI   G+P P VT  R+G + L  + R + E+ ++      K +V        + D G Y I      GT +A   + VLD P  P   +   +I  + + L W  P  DGG+ +T+Y++   +     W     T   T   V  L  G  YQF + A N+ G S+   +   +  + PY  P  P  P + +   +S+T+ W +P  +GG P+T Y ++ KD+    W  A K         I     ++  +S G  Y+FR+ A N AG   PS  ++P L 
Sbjct: 27175 IDSTESRTSLTIENANRNDSGKYTLMIQNVLNAASLTLVVKVLDSPGPPANITVHDVTKESAVLSWDVPENDGGAPVKNYHIEKRE--ASKKAWVSVTNNCNR--LSYKITNLQEGAIYYFRVSGENEFGVGVPAE-TKEGVKITEKPSPPEKLGVTSV---SRDSVSLAWLKPEHDGGSRIVHYVIEALEKGQTTWMRCAVVKST--------------HHVVSGLRQNSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDG-VPLKATMRFNTEITAENLTINLKESV--------AADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEDSVTLKWEPPKYDGGSQVTNYIVLKRETSTAVWTEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSA-CVVVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSPVTGYHLEMKDRNSILWQKANK-------MVIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLA 27706          

HSP 32 Score: 213.386 bits (542), Expect = 3.411e-54
Identity = 164/574 (28.57%), Postives = 267/574 (46.52%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRY---LKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDID--NGDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            V I   G + +L + N  R+  G Y I   N+ G       V + D P P   ++    ++  C++  S P+DDGG+EI  +IIE  D  +  + W Q  + +        +  L+    Y FR  A N+ G   P EI    I+  DP   P  P R +  + + ++  L W  P S+GG PI  Y IE +             +  D E + + +  P      + L E   Y FR+KAVN+ G S PS   + V+        +K  L   G   I++K G          G P P + W +N +++   +D  ++++  ++    E  T L++ KA R  D G YT+      G+     +V V D P  PR L   +I+AE   L+W  P D+GG+ IT Y+I   D      +W     +  + +  +  L P   Y+F V AVNK G S+ C++ + +  ++PY+ P  P +P +++    S+ + W  P D+GG PIT Y ++K+++ G ++  +     + +  +  +E  +P L EG  YQFR +A+N AG   PS  + P + 
Sbjct: 16092 VEIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKD--AKMHTWRQPIETER---SKCDITGLLEGQEYMFRVIAKNKFGCGPPVEIG--PILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGCPIQGYIIEKRRH-----------DKPDFE-RVNKHLCPTTSFLVEDLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG-DTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTD--ALKITKEEVSRSEAKTELSIPKATRE-DKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKRAEWEEVTNSAVERRYGIWKLIPNGQYEFRVRAVNKYGISDECKS-DKVVIQDPYRTPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPIT-KVGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPEVA 16640          

HSP 33 Score: 211.846 bits (538), Expect = 1.051e-53
Identity = 166/588 (28.23%), Postives = 278/588 (47.28%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTH-ISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            E  + Q+  I        + + N +R   G Y ++ +NA G  ++ I V+++D P P     + H ++ +SC +    P+DDGG+ I +Y+IE  +  +    W+ V     +   +  V  LI    Y FR  A N IG+  P   +   ++I+DP   P++P    V + +  S  L W  P+ DGG+ I +Y +E +           ++ T      T  N     + T KGL EG+ Y +R+ AVN  G   PS  +  +  K     P L       + I+ G  F     + G+P P V+W ++ + +L D DR  I+  +  T+  EK       KA RS D+G Y++ +    G+++    VNV+D P  P  + P   DE+  +++ +SW  P DDGG+ IT+Y+I+  ++    W+     +  T   V  L  G  Y F + A N  G S+P  + + +KA++ ++ P  P +P + +    S  + W  P  DGG+PIT+YI++K++     +  +  +      +      R+P L EG  Y+FR+ A N+ G   PS  +KP   +     PS
Sbjct: 17504 ERALPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNAAGERKKTIIVDVLDVPGPVGIPFLAHNLTNDSCKLTWFSPEDDGGSPITNYVIEKRE--ADHRAWTPVTYTVTR--HNATVQGLIQGKAYFFRIAAENSIGMG-PFVETTDALVIRDPITVPERPEDLEVKEVTKESVTLTWNPPKYDGGSDIINYVLESR-----------LIGTEKFHKVTSDNLMSRKY-TVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED-DRTHIKT-TPTTLALEK------LKAKRS-DSGKYSVVVENSTGSRKGVCQVNVVDRPGPP--VGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS-DSMKAKDRFRVPDAPDQPIVTEVTKDSALVSWN-PPHDGGKPITNYILEKRETMSKIWARVTKEPIHPYTKF-----RVPDLLEGCHYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPS 18056          

HSP 34 Score: 211.846 bits (538), Expect = 1.135e-53
Identity = 169/520 (32.50%), Postives = 243/520 (46.73%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            P PP T  VT  SK+S  V  + P  DGG+++  Y +E  +   +S  W ++ +      K  K   L     Y FR  A N +G+  P ++S +  + +DP D    PGRP  +  + NS  L W  P  DGG+ IT Y +E KE   G W +    N  D + +              GLVE + Y FR+ A N  G  S PSE++ ++ A+     P +     Y   I +  G  F+ D    G+P P+  W + G   L ++ R+ I    K T +    T L+V  A R ID+G Y +K     G +  T  V VLD P  P   +    + AE   L+W  P  DGG+ I +Y+++  +     W       +     V  L  G+ Y F V+AVNK G  EP  + EP+ A+NP+  P  PK P I      S+ + W++P+ DGG  I  Y+++K+DK G  W          C  R I EL  R+ GL E   Y+FR+ A N AG S PS
Sbjct: 23283 PGPPGTPFVTLSSKDSMEVHWNEPVSDGGSKVIGYHLERKE--RNSILWVKLNKTPIPQTK-FKTTGLDEGIEYEFRVSAENIVGIGKPSKVS-ESYVARDPCD---PPGRPEPIIVTRNSVTLQWKKPAYDGGSKITGYIVEKKELPDGRWMKASFTNVIDTQFEV------------TGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPQIRMDPKYKDTIVVHAGELFKIDADIHGKPIPTTQWIK-GDHELSNTARLEI----KSTDFA---TSLSVKDAIR-IDSGSYILKAKNVAGEKSVTVNVKVLDRPGPPEGPIVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLGCKVTKLLEGNEYIFRVMAVNKYGVGEPLES-EPVTAKNPFVVPDAPKAPEITAVTKDSMIVVWERPAFDGGSEILGYVLEKRDKEGIRW--------TRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPS 23765          

HSP 35 Score: 209.92 bits (533), Expect = 3.809e-53
Identity = 176/629 (27.98%), Postives = 265/629 (42.13%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT-VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK--TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            PD P T E ++++ NS  +  + P+ DGG+EI+ YI+E  +    S +W +V           KV  L   + Y F   A N  G+     +S + I  ++P + P  P    V D S  +  L W+ P  DGG  I  Y IE  +  +G W             K +V        T   L  G EY FR+ A+N  G     E + ++ A  R   P L     +     ++ G + R  I + G P P+  W +  S L   +D  + + FS           LTV   NR+ D G YT+ +  + G++  T  V VLD P  P  +   ++      L W  P  DGG  I  YV++  +     W    E    +   V  L  G  Y F V A N+ G  EP    EP+ A    + P+ P+  +IVD    SV L W KP  DGG  IT Y+++ + K    W +A  T          ++   +  L E   Y+FR+ A N AG S P       + +   + P+ D    +++  T K   T    + + G P P+ TW    +++  TD V IT  + +      L V  S   D+G Y L  EN  G     + ++V+
Sbjct: 29094 PDAPGTPEPSNVTGNSITLTWARPESDGGSEIQQYILERRE--KKSTRWVKVISKRPICETRFKVTGLTEGNEYEFHVMAENAAGVGPASGVS-RLIKCREPVNPPGAPTVVKVTDTSKTTVSLEWSKPVFDGGLEIIGYIIEMCKADLGDWH------------KVNVEACVKTRYTVTDLQAGEEYKFRVSAINAAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFS----------TLTVENCNRT-DAGKYTLTVENNSGSKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCIRQILRVSDLLEGVPYYFRVSAENEYGVGEPYEMPEPMVAT---EQPAPPRRLDIVDTSKSSVVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT---------KQMTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDR----TTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVI 29680          

HSP 36 Score: 208.379 bits (529), Expect = 1.087e-52
Identity = 178/564 (31.56%), Postives = 259/564 (45.92%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQG----FDERLINVNI-MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            R  + +   K      ++I   N  G     D + + V     +P PP T  VT +SK+  +V+   P +DGG+++  Y +E  +   +S  W ++ +   +  K  K   L     Y FR  A N +G+    ++S +  + +DP D    PGRP  +  + N+  L W  P  DGG+ IT Y +E K+   G W +    N  D E             T  GLVE   Y FR+ A N  G  S PSE++ ++ A+     P       Y   I +  G TF  +    G+P P + W ++G  L   + R+ I    K T+   + T L V    RS D G Y +KL   GGT+     V VLD P  P   L    + AE   L+W  P  DGG  I+ Y+I+  +     W   + E +     V  L PG+ Y F V+AVNK G  +P  + EP+ A NPYKPP  P  P +      S+ + W +P DDGG  I  YI++K+DK G  W          C  + + +L  R+ GL+EG  Y+FR+ A N AG   PS
Sbjct: 25403 RTTIKITKLKMGSEYQFRIFAENRYGKSAPLDSKPVIVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKE--KNSILWVKLNKTPIQDTK-FKTTGLDEGLEYEFRVSAENIVGIGKASKVS-ECFVARDPCD---PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLDTEF------------TVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWSKDGRELEETAARMEI----KSTI---QRTTLVVKDCIRS-DGGQYILKLSNVGGTKTIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGTGDPLES-EPVIARNPYKPPGPPSPPEVSAITKDSMVVTWARPVDDGGAEIEGYILEKRDKEGVRW--------TKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPS 25930          

HSP 37 Score: 202.601 bits (514), Expect = 7.809e-51
Identity = 181/642 (28.19%), Postives = 286/642 (44.55%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIG---LSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF-GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +I  N    P PP   EVT I+KNS  V  S P  DGG++I  YI+E  D    S  W +V +   +  +  KV  L     Y++R  A N  G    S+P +         DP D P  P +  + D + +S  L W+ P  DGG+ +T Y +  +        QGE    + +  K +V     V      L  G  Y F++ AVN  G   P   ++ V AK    +P +     +   I  K G      + F G P P+VTW R     LG   R SI+         + +++LT+ +  R  DTG Y + +    G  + +T  V VLD P   + L    +    + L W  P  DGG+PI +Y+I+  D     W   + +   T   V  L     + F V AVN+ G  EPC T EP+KA    + P+  ++ ++ D    SVTL W KP  DGG  IT YI+++K K    W  A  +   +CE  + +L+     LSE    +FR+ A N+ G S  S    P   +   + P +D      +   +++      ++  KG+P P  +W K+G+ +  ++ V + + E +      L +  ++  + G Y+++ +N   ++   + +I L
Sbjct: 27999 VIARNAFVTPGPPSVPEVTKINKNSMTVVWSRPVADGGSDISGYILEKRD--KKSLGWFKVLKETIRDTRQ-KVTGLTEHSDYQYRVCAVNAAGQGPFSEPSDFYKA----ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMR--------QGEEEEWTVVSTKGEVRTTEYV---VSNLSPGVNYYFQVSAVNCAGQGEPIAMTEPVQAKDILEEPEIDLDVAFRTSIIAKAGEDVHALVPFKGRPPPTVTW-RKDEKNLGSDARYSIQ-------NTDSSSILTIPQVTRH-DTGKYILTIENGVGQPKSSTVSVKVLDTPAACQNLQVKHVSQGTVTLFWDPPLIDGGSPIINYIIEKKDATKRTWSSVSHKCSSTSFKVTDLSEKTPFFFRVFAVNEIGIGEPCETTEPVKAA---EVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITDYIVERKGKGEQTWSHAGISK--TCEIEVGKLKE----LSE---LEFRVSARNEKGLSD-SVSIGPVTVKELVIPPEVDLSEIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESELVRLGKTENK----LTLSIKNAKKENGGKYTIILDNAVCRNTYPITVITL 28596          

HSP 38 Score: 201.83 bits (512), Expect = 1.116e-50
Identity = 181/663 (27.30%), Postives = 278/663 (41.93%), Query Frame = 0
Query:  586 YKIIIRNAQG-----FDERLINVNIMDKP---DPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP---KSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            ++I   N  G       E  I  N  D P   DPP    +++++K+   V   PP DDGG+ I  Y++E  +  + +  W++V     + P   ++IK   L     Y FR  A N+ G   P + S + +  +DP   P  P  P V D + +S  L W  P  DGG+PI  Y +E K      W +  +   L  +  E+               GL+E  EY FR+ AVNK G S PS+  D    K   + P   L       + ++ G T R  +   G P P +TW +    L    +R+ +++ S      + +T L   K N+  D G Y + L    G ++ T  V VLD P  P  +   EI  +   ++W  P  DGG+PI +YV++  D +   W     E   T   V  L+ G  Y F V A N+ G  +P  T + +KA     P  + K   +      S ++ W+KP  DGG  I  Y++    +   W   +K+           L+     L+EGK Y FR+ A N+ GE +PS  T             +          K N     +I +KG+P P  +W K    +A+   V +            L V   +  DAG Y++  +N  G  +  L + V+
Sbjct: 20402 FRICAENKYGVGDPILTEPAIAKNPYDPPGRCDPPV---ISNVTKDHMTVSWKPPADDGGSPITGYLVEKRE--THAVNWTKV----NRKPVIERTIKATGLQEGTEYEFRVIAINKAGPGKPSDAS-KAVYAQDPLYPPGPPAFPKVYDTTRSSVSLTWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTRFEVT--------------GLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL---RERVGLDIKS-----TDFDTFLRCEKVNK-YDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLK---VTSVTKSSCSIGWKKPRSDGGSRIIGYVVDFLTEENKWQRVMKSLS---------LQYTTKDLTEGKEYTFRVSAENENGEGTPSEITAVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPVPSVSWKKGEDPLATDTRVSVE----SSAVNTTLVVYDCRKSDAGKYTITLKNVAGTKEGTLTIKVV 21015          

HSP 39 Score: 201.83 bits (512), Expect = 1.136e-50
Identity = 196/641 (30.58%), Postives = 288/641 (44.93%), Query Frame = 0
Query:  606 MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGL------SDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWE-RNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIAS-TDEVLITREEY-QGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
             + PD P    V  ++ NS +V  + P D+G + I  Y +E  +V+S+   WS+V +      K+ KV+ L+    Y FR  A N  G       SDP   + QD I          P  P V D SS + +LAW  P  +GG  I  Y + YK+          ++ T++    T+   KP  + T + + EG +Y  R+ AVN  G   P ET    +A+ +   P +         I+I  G+T R      G P P+  W    G L   D DR+ IE    K+    KN +          D G Y I      G++ A   V V DVP     L P     +   L+W+ P DDGG+ IT ++I+  D     W   +ET+ +K  + GL  G  Y F VIA NK G   P   + PI A +P  PP+ P+     +    ++TL W++P  +GG PI  YII+K+      F+ +        + + E       L E + Y+FR+ AVN+ GES PS      + +   + P+I  + S    TIKV       I   V G P P+  W KN   I   TD + IT+EE  +  A  +L + K+   D GTY++ A NR G    ++ + V D
Sbjct: 15841 FEPPDAPDKPIVEDVTSNSMLVTWNEPKDNG-SPILGYWLEKREVNST--HWSRVNRNLLNSLKT-KVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPK--TAQDPISPP------GPPVPRVTDTSSTTIELAWEPPAFNGGGEIVGYYV-YKQ----------LVGTNEWSRCTEKMIKPREY-TVREIREGADYKLRVTAVNVAGEGPPGETEPVTVAEPQAEPPTVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGEL---DKDRVEIENVGTKSELIIKNALRK--------DHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYMFRVIAKNKFGCGPPVE-IGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGCPIQGYIIEKRRHDKPDFERVNKHLCPTTSFLVE------DLDEHQMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKITKEEVSRSEAKTELSIPKATREDKGTYTVTASNRLGSVFRNVHVEVYD 16438          

HSP 40 Score: 201.445 bits (511), Expect = 1.892e-50
Identity = 166/603 (27.53%), Postives = 276/603 (45.77%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS------VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY---NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT---VYCEKNTVLTVTKANRSIDT------------------GHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD--WLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            +S  KDGKEVK    + +        L V    R  +G Y + + N  G     INV ++  P P + ++ + ++K+SC +   PP+ DGG+ I HY++E       + + + +    G+   S  V +LI    Y FR +A N+IG        G+ I +K+P    D    P       V + ++ +  + W  P  DGG+ I  Y IE   K    W+            + + +  P++  T KGL EG EY FR++A N  G S PS  +      T+ + P +  P +    ++E+++G     D    G P P++TW ++ S++  +  +  +E   ++    V  E+  VL +T+   SID                   G + IK   D G  +A   V VLD+P  P     +++R   +   W  P DDGG+ I +Y ++  D    D  W+    T +  K +V  L  G  Y F V A N+ G   PC + +P  A++P++PP  P +P + D  + S+ + W +P D+G  PI  Y ++K++     +  +  +       ++ L+ ++ GL EG  Y FR+ A N AG
Sbjct: 15359 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTVTLENKLGSATASINVKVIGLPGPCRDLKASDVTKSSCKLTWEPPEYDGGSPILHYVLE----RREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIG-------GGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWK------------RCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRAT----PPTKAVDP-IDAPKVIMKTSLEVRRGDEIALDAIISGSPYPTITWLKDESIITPEEIKKRVEPLVRRRRGEVQEEQPFVLPLTQ-RLSIDNSQKGESQLRVRDSVRPDHGLFMIKAENDHGIAKAPCTVCVLDIPGPPINFVFEDMRKTSVLCKWEPPLDDGGSEILNYTLEKKDKTKPDSEWMVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPFMAKDPFEPPDAPDKPIVEDVTSNSMLVTWNEPKDNGS-PILGYWLEKREVNSTHWSRVNRN------LLNSLKTKVDGLLEGLTYVFRVCAENAAG 15924          

HSP 41 Score: 199.904 bits (507), Expect = 4.663e-50
Identity = 168/609 (27.59%), Postives = 267/609 (43.84%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYK---EKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN---IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            +N    R  + V +  +    S+++   N  G  + + +  I+ +     P  P   EV ++S N+  ++   P  DGG+++  Y +E  +   ++  W +    + K P    + KV  L+    Y+FR  A N  G+S   E S + ++ ++P D    PGRP V D + ++  L W+ P  DGG+ +  Y IE K   E   G W +      SD               T   L EG+ Y FR+ A N  G  S  SE++  +  +  Y  P            + I+ G     D   GG+P P + W + G   L   ++IS++       Y  K     +   +RS D+G YT+ +    GT+  +  V VLD P     L    +  E   L+W+ P +DGG  IT Y+++  +    +W+    E       V  L   + Y F V AVNK G   P  + EPI A N +  PS+P  P  V    + + ++W KP  DGG  I++Y++ K++K    +  +  D    + R+     ++ GL EG  YQFR+ AVN AG S PS  +    CR  + TP          T K + +  W
Sbjct: 29733 VNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPVESAPIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKE--RNTILWVK----ENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS-RPVMAQNPVD---APGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD------------NFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPITCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDKELDMCEKISLQ-------YTGKRATAVIKFCDRS-DSGKYTLTVKNASGTKAVSVLVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSHVVTRLIKNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNDISNYLVDKREKKSLRWTRVNKDHVVYDTRL-----KVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAW 30304          

HSP 42 Score: 198.749 bits (504), Expect = 1.209e-49
Identity = 167/548 (30.47%), Postives = 249/548 (45.44%), Query Frame = 0
Query:  602 NVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI---KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-----LAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEP-IKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            ++NI   P PP+T+++  +S+    +   PP+DDGG+++  YI+E  +V +  ++W +V     K P ++   +   LI    Y  R  A N  G   P   S   + + DP   P KP  P V D +  S  LAW++PE +GG+ +T Y IE ++     W +    NT+  +I+           T   L +G EY FR+ A N GG   P+E   +V     L    Y     +Q GI    +++G   R  I   G+P P   W + G  +   S R  I          E +T L + +A+R  D+G Y + L    G +     V V+  P  P   L  D+I+A  + +SW  P DDGG  I  Y+++  ++    W       + T   VKGLK    Y F V A N+ G S+P ++ EP I       P      P I+D    SV+L W +P DDGG  +T Y I++K+     W    KT       +I      + GL     YQFRIIA N  G S  S  ++P +C+     PS
Sbjct: 30871 SINI---PGPPETLQIFDVSREGMTLTWYPPEDDGGSQVTGYIVERKEVRA--DRWVRV----NKVPVTMTRYRSTGLIEGLEYEHRVTAVNVRGTGKPSRPSKPTVAM-DPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK---CNTTPTKIR---------EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIL---VRQGGVIRLTIPIKGKPFPICKWTKEGQDI---SKRAMI-------ATSETHTELVIKEADRD-DSGTYDLILENKCGKKAVYIKVRVIGNPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKSAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEILDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKT-------QITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPS 31375          

HSP 43 Score: 197.978 bits (502), Expect = 1.881e-49
Identity = 195/692 (28.18%), Postives = 305/692 (44.08%), Query Frame = 0
Query:  586 YKIIIRNAQG------FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKT-IKVNR---TAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA---------------------TAKLCVSKSQ------------MIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            +++   NA G       ++ ++  +    P PP  + V  ++K    +K  PP +DGG  I+ Y+IE  +      +W +  +  G      +V ++I     +F+ RA N  G+  P E + + + I+DP   P  P    V D       +AW  PE +GG+PI  Y +E        W +       D++ K +           +G+V   EYV R++AVN  G S PSE S++V+AK    +P +     ++I + +G      + F   P P+V+W ++G  +   SDR+++     K  +   +  L V K+ R+ D G YT+ L    G+  A+  V V+ +P   R L   ++      L+W  P  DGG+PI  YV++  +     ++  M  ++  + TVK L P   Y F V AVNK G  E      P+ A++P +PP  P +  + +   +++T+ W+ P  DGG  I  YII+K  K    +          E  +  L     GL EGK YQFR+ A N AG S PS  T P     K + P ID      KT ++V R    A+  I + G P P  TW K        DE +IT EE +                        T +L +  SQ              D G + + AEN +G  K    + VLD+
Sbjct: 15096 FRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE--KLGTRWVKAGKTSGPD-CHFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT-EILKIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVE-----------EGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCRPTIDL-ETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKA-SDRLTM-----KNDHISAH--LEVPKSVRA-DAGIYTVTLENKLGSATASINVKVIGLPGPCRDLKASDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCN------EHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPT----KAVDP-IDAPKVIMKTSLEVRRGDEIALDAI-ISGSPYPTITWLK--------DESIITPEEIKKRVEPLVRRRRGEVQEEQPFVLPLTQRLSIDNSQKGESQLRVRDSVRPDHGLFMIKAENDHGIAKAPCTVCVLDI 15742          

HSP 44 Score: 197.978 bits (502), Expect = 1.980e-49
Identity = 170/586 (29.01%), Postives = 256/586 (43.69%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRN--AQGF---DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNT---VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKG 1141
            R  L V   K      ++I   N   Q F    E ++      +P PP T  VT +SK+S VV+   P ++GG+ +  Y +E  +   +S  W++V +      +  K  NL     Y FR  A N +G+    + S +  + +DP D    PG P  +    +   L W  P  DGG+ IT Y +E ++   G W +    N  + +             T  GL E   Y FR+ A N  GA S PS+++  + A+     P +     +   I +  G TFR +    G+P P++ W R G   + +S R  I           KNT    L + K    ID G Y ++     G++     V VLD P  P   +    + AE   L+W+ P  DGG+ I+ YV++  +     W + A E       V  L  G+ Y F ++AVNK G  EP  +  P+  +NP+  P  PK   + +    S+T+ W +P  DGG  I  YI++K+D+ G  W    K        RI +L  R+ GL+E   Y+FR+ A N AG   PS    P    +K   P    G
Sbjct: 24321 RTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPIVAQYPYKEPGPPGTPFVTAVSKDSMVVQWHEPINNGGSPVIGYHLEKKE--RNSILWTKVNKTIIHDTQ-FKAVNLEEGIEYEFRVYAENIVGIGKASKNS-ECYVARDPCD---PPGTPEAIIVKRHEITLQWTKPAYDGGSVITGYIVEKRDLPEGRWMKASFTNVIETQF------------TVSGLTEDQRYEFRVIAKNAAGAVSKPSDSTGPITARDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR-GDKEIEESARYEI-----------KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYIFRIMAVNKYGAGEPLESA-PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNK-------RRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS----PATLYYKACDPVFKPG 24863          

HSP 45 Score: 195.282 bits (495), Expect = 1.307e-48
Identity = 161/587 (27.43%), Postives = 257/587 (43.78%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI-KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVL-DVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI 1158
            R  +G Y I   N  G     + V + D P P  +++V  +S++S  +    P  DGG  + +YIIE  + +  + +         K  K++ +++ LI    Y FR    N  G+ +P E S   ++ + P      P +  V+D + ++  LAW  P  DGG+ +T Y +E        W +   L  + +E             T   L EG +Y+FR++A N+ G S P E   +V  +   + P +    +    I +  GR     I   G P P+ +W   GS L  +S+R+++E  +K      + T +         DTG Y ++L    GT   T  V VL D P  P   +  DEI A  + +SW  P  DGG P++ YV++  D     WL   E+  T++T K   L  G+ Y F V A N+ G     ++ E I+  +    P  P+   I D   + +TL W  P DDGG  +T YI+++K+ +   W    K         +     R  GL EG  Y+ R+ AVN  G   PS  +KP +       P   +    + T + + +  W +
Sbjct: 30451 RYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEVPTIDGGAPVNNYIIEKREAAMRAFK-----TVTTKCSKTLYRISGLIEGAMYYFRVLPENIYGIGEPCETSDAVLVSEVPL----VPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACRAGTERWMKVVTLKPTVLE------------HTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR-ESERVTVETHTKVAKLTIRETTIK--------DTGDYVLELKNVTGTTSETIKVIVLVDKPGPPSGPIKVDEIDATSVTISWGPPELDGGAPLSGYVVEQRDAHRPGWLPVSESV-TRSTFKFTRLIEGNEYVFRVAATNRFGIGSYLQS-EVIECRSSINIPGPPETLQIFDVSREGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP-------VTMTRYRSTGLIEGLEYEHRVTAVNVRGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSV 30998          

HSP 46 Score: 191.43 bits (485), Expect = 2.253e-47
Identity = 168/568 (29.58%), Postives = 263/568 (46.30%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDER-LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPG---RPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-------YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDV--PEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            L +    R  +G Y + I N  G  +   ++V ++D P   + ++V H+S+ +  +   PP  DGG+ I +YIIE  D  ++   WS V+        S KV +L  K  + FR  A N IG+ +P E +       +P    + P      SV D +  S  L+W  P+ DGG+ IT Y +E K K    W    I  T +IE+     GK         L E +E  FR+ A N+ G       SDSV      +K  +  P +         + ++ G     ++ + G+P PS++W ++G L L +S+ + +     KT   E    L++  A +  + G YTI L  D    + T  + V+ +  P KP+  +  DEI+A+ + +SW  P DDGG  IT Y I+  +    +W +       T   V  L     YQF V A N+ G S+P  +   I A++ ++ P  P +P   +  +  ++L W  P  DGG  +T Y ++KK++    +  +        + I   E R  GL EG  YQFR+ A N AG SSPS  +K
Sbjct: 28271 LTIPQVTRHDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQNLQVKHVSQGTVTLFWDPPLIDGGSPIINYIIEKKD--ATKRTWSSVSHKCSS--TSFKVTDLSEKTPFFFRVFAVNEIGIGEPCETT-------EPVKAAEVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITDYIVERKGKGEQTWSHAGISKTCEIEV-----GK---------LKELSELEFRVSARNEKGL------SDSVSIGPVTVKELVIPPEVDLSEIPGAQVAVRIGHNVHLELPYKGKPKPSISWLKDG-LPLKESELVRL----GKT---ENKLTLSIKNAKKE-NGGKYTIIL--DNAVCRNTYPITVITLGPPSKPKGPIRFDEIKADSVIMSWDVPDDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVS-NIILAKHQFRIPGPPGKPVTYNVTSDGMSLTWDAPVYDGGSEVTGYHVEKKERNSILWQRINM------SPISGREYRATGLMEGLDYQFRVFAENSAGLSSPSDPSK 28789          

HSP 47 Score: 188.348 bits (477), Expect = 1.916e-46
Identity = 153/548 (27.92%), Postives = 243/548 (44.34%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTV----LTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD--TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE 1117
            ++I   N  G  + + +  ++ K     P PP T  VT++++ S  V    P  +GG+ +  Y +E  D   +S  W +  +   +     KV  +     Y FR  A N  G+  P   S   + I    D  + P    + D S NS +L+W  P  DGG+ IT Y +E ++   G W +    N ++             H T  GL +  +Y FR+ A N  G  S PSE    +     Y  P +  P  Y   ++ + G + +      G+P P++ W ++   L  ++            + C +NT     + +  A R +++G Y +KL    G+  AT  + +LD P  P   +    + AE I L W  P DDGG  IT Y+++  +     W    E  +     T K +K G+ Y F V AVNK G  +   +  P+ A N +  P  P  P +   +  S+T+ W +P  DGG  I+ YI++K+DK   GWF  LK         I +   ++ GL+E   YQ+R+ AVN AG+
Sbjct: 27584 FRIKAENRFGISDHIDSACVVVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSPVTGYHLEMKD--RNSILWQKANKMVIRT-THFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAI----DACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYMVERRDLPDGRWAKASFTNVTE------------THFTVSGLTQNAQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNA------------LVCVENTTDLASILIKDATR-LNSGTYELKLRNALGSASATIRLQILDKPGPPGGPIEFKTVTAEKITLLWQPPADDGGAKITHYIVEKRETSRVVWSMVSENLEECIIKTTKIIK-GNEYIFRVRAVNKYGIGDALES-HPVIARNAFVTPGPPSVPEVTKINKNSMTVVWSRPVADGGSDISGYILEKRDKKSLGWFKVLK-------ETIRDTRQKVTGLTEHSDYQYRVCAVNAAGQ 28090          

HSP 48 Score: 187.578 bits (475), Expect = 3.108e-46
Identity = 171/596 (28.69%), Postives = 275/596 (46.14%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREK-SGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD-VPEK---PRXLN----PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV--KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            F+  K ++  +++ I        L + N +R+  +G YK+ + N  G  + +++V I DKPD P   I +  + KNS V+   PP DDGG+ I +Y++E  +    + +W  V+ A      + ++ NL     Y FR  A N  G+S+P E+S   +IIK P+++P  PG+P++   + +SC +AW  P SDGGA I +Y +E +EK    W    I  T+D EI+  V        + + L+EG EY FR+K  N GG S  SE S+ V  K+       H +  + N+ ++            G P P V W R G  ++ D  +  I+ F  K  Y  +  + +VT  + ++    Y ++    GG+   T  + V D VP K   P+ L        +R E I++    P      P+ ++      IDN      + T+   + V   G++      + V A N+ G  +    L+     +P      P+   + D    SV L W +P+ DGG  +T+YI++K       W           +AR  E    +  L     YQFRIIA NK G S PS  ++P + + 
Sbjct: 31606 FRGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVLGTVDTMLDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGA-EWQLVSSAISV--TTCRIVNLTENAGYYFRVSAQNMFGISEPLEVSSV-VIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKW----IAVTTD-EIRETVF-------SVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF--KGGY-HQLIIASVTDDDATV----YQVRATNQGGSVSGTASLEVEDTVPAKIHLPKNLEGMGAVHALRGEVISIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP------PRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWIRV-------GQAR--ETRYTVINLFGKTSYQFRIIAENKFGLSKPSEPSEPTVTKE 32161          

HSP 49 Score: 186.422 bits (472), Expect = 7.022e-46
Identity = 162/594 (27.27%), Postives = 263/594 (44.28%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLH-QPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKP----RXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR---HKNLTPSIDKGSSSSKT 1147
            R    V N  ++    +++   N  G  + L++  I+ K     P PP      +++ +   +    P  DGG+E+  Y +E  +   +S  W ++  +   G +  +   L+    Y+FR  A N  GLS P + S   + +       D PG P  +D +  +  L W  P  DGG+ I  Y IE ++ S   W +    + S+ +             T  GL  G+ Y FRI A N  G  S PS++S  ++ +   + P +   P  ++ I IK G + R      G P P VTW ++G  +     ++++E+          +T L V  A R    G Y ++     G+ +A   V V D P KP    R  N   I  E + L W  PH+DG  P++ Y+I+  +     W L     +    T   L  G+ YQF + AVNK G S P  + +P+ A+  Y  P  P  P   +    S+TL W +P  DGG  I  YI+++++K    +  + +    CE R      ++ GL+EG  Y+F ++A N AG    S  ++   CR   +    P++ K + +SKT
Sbjct: 28655 RTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSNIILAKHQFRIPGPPGKPVTYNVTSDGMSLTWDAPVYDGGSEVTGYHVEKKE--RNSILWQRINMSPISG-REYRATGLMEGLDYQFRVFAENSAGLSSPSDPSKFTLAV----SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGS-DRWTRCNFTDVSECQY------------TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGVIMTRDENVAPTVEFGPEYFDGITIKSGESLRIKALVQGRPVPRVTWFKDGVEI---EKKMNMEITD-----VLGSTSLFVRDATRD-HRGVYRVEAKNASGSTKAEITVRVQDTPGKPVGPIRFTN---ITGEKMTLWWDAPHNDGCAPVSHYLIEKRETSRLAWALIEDNCEALSYTATKLITGNEYQFRISAVNKFGVSRPLDS-DPVVAQIQYTIPDAPGTPEPSNVTGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPICETRF-----KVTGLTEGNEYEFHVMAENAAGVGPASGVSRLIKCREPVNPPGAPTVVKVTDTSKT 29210          

HSP 50 Score: 183.726 bits (465), Expect = 4.660e-45
Identity = 154/526 (29.28%), Postives = 236/526 (44.87%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            P PP T +V H +K++ +V    P +DGG+ +  Y +E  +   SS  WS+ A         +KV+ L     Y +   A N  G+    + S + +  +DP D    PG+P V + +  S  L W+ P  DGGA IT Y IE +E   G W            +K +    P  +     L E   Y FR+ A N   + S PSE++  +  K     P +     +   I +K G   + +    G P P ++W ++G  +    +R   E+ S      +  T+LTV    R  D+G Y + +    GT+       VLD P  P   L    + AE  +LSW  P +DGG  I  Y+++  +     W +   E + T   V  L  G+ Y F V  VNK G  EP  ++  +KA +P+  PS P    I     + +TL W +P  DGG  I+ YI+++++K    W    K         + +L  +  GL EG  Y++R+ A N AG S PS E+ P +
Sbjct: 26529 PGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVLGYHLEYKE--RSSILWSK-ANKTLIADTQMKVSGLDEGLMYEYHVYAENIAGIGKCSK-SCEPVPARDPCD---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIIERRELPDGRW------------LKCNFTNVPETYFEVTELTEDQRYEFRVFARNAADSISEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADVAGRPLPIISWAKDGVEI---EERARTEIVS-----TDYTTLLTVKDCVRR-DSGQYVLTVKNVAGTRSMAVNCKVLDKPGPPAGPLEITGLTAEKCSLSWGPPQEDGGAAIDYYIVEKRETSRLAWTICEGELRTTFCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMA-VKALDPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIVERREKNSLRWVRVNKKP-------VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ESSPLI 27017          

HSP 51 Score: 160.614 bits (405), Expect = 5.665e-38
Identity = 181/672 (26.93%), Postives = 283/672 (42.11%), Query Frame = 0
Query:  586 YKIIIRNAQGFDER------LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK----GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRA---EHINLSWATPHDDGGTPITSYVIKMMDIDNG-DW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--------KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLM 1234
            ++II +N  G  E       ++  +  DKP  P  +E+  ISK+S  ++   P+ DGG EI  Y +E     S  + W + ++ D    +   +  L+    Y FR  A N  GLS P   +   + +K      + PG    +   +     A  L     G P+   +I++      L Q  +   +SD    T          T     + +E V+   A N+ G     E+S  +L +     P  H PG Y ++ K     G T R  + + G P P++TW R G  LL +S+ I+IE         E  T L +    R    G Y ++L    GT      V + D P+KP    P  I A     + +SW  P DDGG+ IT+YV++  +   G +W L +     T   +  L     Y F V A N  G SEP      +  ++P++ P  P +P I      S  + W+ P+ DGG  I +Y ++K++K    + A+ TD+      I E    +  L EG  Y+FR+   N  GES  S  ++P       +TP  D        K    +  ++    A    KV G P P   WY+ G +I + D +    +E++GG   +L ++     DA  Y + A N+ G       L V D +
Sbjct: 31345 FRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEY--RQSGDSAWKKSSK-DRIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTA---MSVKTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLP--DIKWFRFGKELVQSRKYKMSSDGRTHT---------LTVMTEEQEDEGVYTCVATNEVGEV---ESSSKLLLQA---TPQFH-PG-YPLKEKYYGAVGSTLRIHVMYIGRPVPAITWFR-GQKLLQNSENITIE-------NTEHYTHLVMKNVQRKTHAGKYKVQLSNVLGTVDTMLDVEIQDKPDKP--TGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNMFGISEPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTDE------IRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEP-------VTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGY-HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEDTV 31966          

HSP 52 Score: 151.369 bits (381), Expect = 3.735e-35
Identity = 154/599 (25.71%), Postives = 256/599 (42.74%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGT------QQATGYVNVLDVPEKPRXLNPDEIR-------AEHINLSWATPHDDGG--TPITSYVIKMMDID--------NGDWLXAMETKDTKATVKG---LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            KDG+ +K    VN++       L +    RE  G+Y++ + N+ G     I V ++DKP PP  I +  +S ++  +  +PP+ DGG +I +YI+E  + +S++  W  V+QA  +   SIK+  L+    Y+FR  A NR G S   E S   ++ + P+  P  PG P V+  + ++  + W +P +DGG+ +  Y +EYKE+S  LW +      +D ++K              GL EG  Y + + A N  G    S++ + V A+     P   QP + NI  +K  + ++    + GG        ER     L D   +     +    Y E   V  +T+  R      Y  ++             ++TG + V D  E PR +   + R        E + ++     D  G   PI S+    ++I+        + D+   +  KD      G   L   ++     +AVN       C+ L     + P  PP+ P E  I     +  +L W  P +DGG  I +YI++K++     W          CE  +     ++  L +G  Y FR+  VNK G   P
Sbjct: 26372 KDGQTLKETTRVNVSSSKTVTSLIIKEASREDVGTYELCVSNSAGSVTVPITVIVLDKPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETTSTT--WHVVSQAVAR--TSIKIVRLVTGSEYQFRVCAENRFGKSSYSESSA--VVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVLGYHLEYKERSSILWSKANKTLIADTQMKVS------------GLDEGLMYEYHVYAENIAGIGKCSKSCEPVPARDPCDPP--GQPEVTNI-TRKSVSLKWSKPHYDGGAKITGYIIERRE---LPDGRWLKCNFTNVPETYFE---VTELTEDQR------YEFRVFARNAADSISEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKIN----ADVAGRPLPIISWAKDGVEIEERARTEIVSTDYTTLLTVKDCVRRDSGQYVLTVKNVAGTRSMAVN-------CKVL-----DKP-GPPAGPLE--ITGLTAEKCSLSWGPPQEDGGAAIDYYIVEKRETSRLAW--------TICEGELRTTFCKVTKLLKGNEYIFRVTGVNKYGVGEP 26910          

HSP 53 Score: 143.665 bits (361), Expect = 7.899e-33
Identity = 88/279 (31.54%), Postives = 139/279 (49.82%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KDG  +K  + + +    +   L + +  R+ SG Y I   N  G     I + ++DKP PP ++++  +  +  ++   PP +DGG+EI +YI++  +  +S   W+QV+        S  V  LI  H Y+FR  A N+ G+ DP  I  +  I K+P+D P +   P + + + +   ++W  P  DGG+PIT Y +E +E     W              T VN KP++  T K  GL EG EY FR+ A+NK G   PS+ S +V A+     P
Sbjct: 20273 KDGTLLKPSEGIKMAMKRNLCTLELFSVTRKDSGDYTITAENPSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRE--TSRPNWAQVSATVPI--TSCSVEKLIEGHEYQFRICAENKYGVGDP--ILTEPAIAKNPYDPPGRCDPPVISNVTKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNW--------------TKVNRKPVIERTIKATGLQEGTEYEFRVIAINKAGPGKPSDASKAVYAQDPLYPP 20531          

HSP 54 Score: 141.354 bits (355), Expect = 3.431e-32
Identity = 97/306 (31.70%), Postives = 141/306 (46.08%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ-KKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKN--------GIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  +H+ +SW  P DDGG+PIT Y+++  +    +W         + T+K  GL+ G  Y+F VIA+NK G  +P    + + A++P  PP  P  P + D    SV+L W KP+ DGG PI  Y+++ K+     W         +   ++ +    + GL E   YQFR+ AVNK G S PS     H C    L P    +D     +  ++   T    + VKG PPP+ TW K         G+ I STD     R E            K    DAG Y L  EN  G+ +  + + VLD
Sbjct: 20441 VTKDHMTVSWKPPADDGGSPITGYLVEKRETHAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVIAINKAGPGKPSDASKAVYAQDPLYPPGPPAFPKVYDTTRSSVSLTWGKPAYDGGSPIIGYLVEVKRADSDNWV------RCNLPQKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKH-CPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERVGLDIKSTDFDTFLRCE------------KVNKYDAGKYILTLENSCGKKEYTIVVKVLD 20727          

HSP 55 Score: 138.658 bits (348), Expect = 2.690e-31
Identity = 90/279 (32.26%), Postives = 139/279 (49.82%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            DG E+K  +   +        L + N  R+ +G Y+I + NA G     +++ ++D P PP   I +  ++     +   PP DDGG+ + +YI+E  D  +  + W  V+    K    +KV +L   + Y FR +A N+IG+  P  +     + K  +  P  PG+P V D + N+  +AW LP+SDGG+PIT Y +E +E + G W +              VN  P+V    +  GL EGN Y FR+ A N  G S PS +SD + A  R +KP
Sbjct: 18489 DGNEIKTDEHYTVETDNFSSVLTIKNCLRKDTGEYQITVSNAAGTKTVAVHLTVLDVPGPPTGPINILEVTPEYMTISWLPPKDDGGSPVINYIVEKKD--TKKDTWGVVSSGSSK--TKLKVPHLQKGYEYVFRVKAENKIGIGPP--LDSVPTVAKHKFSPPSPPGKPVVTDITENAATVAWTLPKSDGGSPITGYYLERREVT-GKWVR--------------VNKTPLVDLKFRVTGLYEGNTYEFRVFAENLAGLSGPSPSSDPIKA-CRPIKP 18745          

HSP 56 Score: 137.502 bits (345), Expect = 5.194e-31
Identity = 83/278 (29.86%), Postives = 138/278 (49.64%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KDGKE++    + I       +L   +  R   G+Y +   N  GF + + +V ++D+P PP+  + V+ ++   CV+   PP DDGG +I++Y+++  + S  +  W+ VA         +KV  L+  + Y FR  A N+ G+ +P  +  + ++  DP+  PD P  P V   + +S  + W  P+SDGG+ I +Y +E ++K+   W +      +D+  K              GL EG+EY FR+ A N+ G S PS TS    A     KP
Sbjct: 22439 KDGKELENTAKLEIKIADFSTNLVNKDSLRRDGGAYTLTATNPGGFAKHIFHVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIEYYVVQKRETSRLA--WTNVASEVQV--TKLKVTKLLKSNEYIFRVMAVNKYGVGEP--LDSEPVLAVDPYGPPDPPKNPEVTSITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKTLTDLRYKVS------------GLTEGHEYEFRVMAENRAGISAPSATSPFYKACDAVFKP 22698          

HSP 57 Score: 137.502 bits (345), Expect = 5.995e-31
Identity = 102/316 (32.28%), Postives = 152/316 (48.10%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET----KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQ-IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             DVP+ P   N  ++R + ++L+W  P   GG+PIT Y I+  + ++  W  A +T    KD K T  GL  G  Y+F V+A+N  G  +P    EP+ A +P  PP +P+   ++     SVTL W +P  DGG  +T YI++K++     W  A   +   C   + +L        EG  Y+FR+ A N AG  S+PS  T   +C+ +   P+I  D       T+K   T I   I + G+P P+ +W K G  I  +D V IT          K    K    DAG Y++ A N  G     + + VLD+
Sbjct: 21115 FDVPDAPPPPNIVDVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVT--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPE---VISVTRNSVTLVWTEPKYDGGHKLTGYIVEKRELPSKSWTKANHVNVPDCAFTVTDL-------VEGGKYEFRVRAKNTAGAISAPSESTDTIICKDEYEAPTIVLDPTIKDGLTVKAGDTIILSAISILGKPLPKSSWSKAGKDIRPSDIVQITSTPTSSMIAVKYATRK----DAGEYTITATNPFGTKSEHVKVTVLDV 21414          

HSP 58 Score: 137.117 bits (344), Expect = 8.192e-31
Identity = 163/650 (25.08%), Postives = 269/650 (41.38%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILN--TSDIEIKTDVNGKPMVHGTCKG-LVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG-IYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTV-TKANRSIDTGHYTIKLLCDG--GTQQATGYVNVL-----DVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNL-TPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++ +N +D+P  P+ + +    K    +K   PD DGG+    Y +E       +  W +V +   K    + V+  +    Y FR +  N  G SD   +  +++++K+   +P       VLD       L+  L    G        +  K      W + +     T    +K D +G        K    +G +YV  + A N  G+ +   T +            L +PG I N++I    + R  + +           +N  L   +S R+    FS        +T+LT  T   R I+   Y  ++  +   GT   T    V+     D P +P      ++  E + + WA P  DGG  IT Y ++  +  +  W+   ++   + +  V+ L PGH YQF V A N+ G  EP     P+ A++P +PP  P    +VD    S+TL W KP  DGG PI  Y+++ + K             +  A++  +E  +  L E + Y+FR+ A N+ G   P+ E K  +   + L  P ID  +S  K + V      ++   V+G P P+ TW K GI     D V+   +       A L +  S   D+G YSL   N  G+    +++ VLD
Sbjct: 19034 ILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVER--RLKGAADWERVHKGSIKETHYM-VDKCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKEDLQKP-------VLD-----LKLSGVLTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKIDTSGDSSKFSLTKAKRSDGGKYV--VTATNTAGSFVAFATVN-----------VLDKPGPIRNLKITDVCSDRCSLRWDPPEDDGGCEIQNYILEKCESKRMVWSTFS--------STILTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTETKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWAPPEYDGGKSITGYYLEKKEKHSTRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGWGKPVYDGGAPIIGYVVEMRPKKADMSPDEGWKRCNAAAQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPA-ELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRKVGI-----DNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD 19639          

HSP 59 Score: 136.732 bits (343), Expect = 1.101e-30
Identity = 101/320 (31.56%), Postives = 146/320 (45.62%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRA--EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME---TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            N   +P +P    P+E+ A  EHI + W  P  DGG  I++Y++   +  +  W    +     DT+  V GL  G  YQF V AVN  G SEP      I    P   P  P  P +VD    S++L W KP  DGG  I  Y+++ ++K    +  + T+     A I   E  +  L  G+ Y FR+ AVN  G S  S  T       +   P ++      KT+ +   A  +  + V G PPP  TW K GI +AS   ++ T E Y     + L V K    DAG Y++ AEN++G+    + + V D    C
Sbjct: 30177 NSFTIPSQPGI--PEEVGAGKEHIIIQWTKPESDGGNDISNYLVDKREKKSLRWTRVNKDHVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWYRVHTN-----ATIRNNEFTVTDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPVERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKGIDLAS-RAIIDTTESY-----SLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPC 30483          

HSP 60 Score: 134.035 bits (336), Expect = 6.049e-30
Identity = 84/266 (31.58%), Postives = 134/266 (50.38%), Query Frame = 0
Query:  558 VGQDVNINFHGDRVD--LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPD-PPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +  D  ++     V+  L V + ++  +G Y I ++N  G  E  + + ++ KP  P   I+   ++  +  +K  PP DDGG+EI +YI+E  D  S +N+W   A A  K   + +V  L     Y FR  A N+ G+ +   +  + I+ + P+D PD P  P+++D   +S  L W  P   GG+PIT Y IE+KE++  LW++    N + I +K              GL EG EY FR+ A+N  G   PS  S+ V+A
Sbjct: 20965 LATDTRVSVESSAVNTTLVVYDCRKSDAGKYTITLKNVAGTKEGTLTIKVVGKPGIPTGPIKFEEVTAEAVTLKWGPPKDDGGSEITNYILEKRD--SVNNKWVTCASAVQK--TTFRVMRLHEGMEYTFRVSAENKYGVGE--GLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRKTGGSPITGYHIEFKERNSLLWKRA---NKTPIRMK---------DFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVA 21212          

HSP 61 Score: 133.265 bits (334), Expect = 1.271e-29
Identity = 93/275 (33.82%), Postives = 138/275 (50.18%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +S  KDG  +K  + V +    +++ L++ N K+E  G Y II+ NA   +   I V  +  P  PK  I    I  +S ++    PDDDGG EI  Y IE  + S ++  W  V  +  +   + KV NL+    Y+FR RA NR G+S P  +    I+ K  +  P  PG+P   + +S+   L W  P  DGG+ +T Y +E KE++  LWQ+   +N S I      +G+        GL+EG +Y FR+ A N  G S PS+ S   LA
Sbjct: 28537 ISWLKDGLPLKESELVRLGKTENKLTLSIKNAKKENGGKYTIILDNAVCRNTYPITVITLGPPSKPKGPIRFDEIKADSVIMSWDVPDDDGGGEITCYSIEKREASQTN--WKMVCSSVAR--TTFKVPNLVKDAEYQFRVRAENRYGVSQP--LVSNIILAKHQFRIPGPPGKPVTYNVTSDGMSLTWDAPVYDGGSEVTGYHVEKKERNSILWQR---INMSPI------SGR---EYRATGLMEGLDYQFRVFAENSAGLSSPSDPSKFTLA 28793          

HSP 62 Score: 132.88 bits (333), Expect = 1.314e-29
Identity = 84/294 (28.57%), Postives = 145/294 (49.32%), Query Frame = 0
Query:  530 NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGE--ILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            N  V   + G     + LS  +DG  +K     N     + + +N+       +G Y+I   N+ G  +  IN+ ++D+P PP   + ++ I+++S  +K  PP  DGG+++ +YI+  +   +S+  W++V+    +    IKV  L     Y+FR +A NR G+SD   I    +++K P+  P  P  P V + +  S  + W  P S+GG+P+T Y +E K+++  LWQ+    ++ T+  ++ T             GL+    Y FR+ A N  G   PS  S+ VLA
Sbjct: 27435 NLKVDIPISGKPLPKVTLS--RDGVPLKATMRFNTEITAENLTINLKESVAADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEDSVTLKWEPPKYDGGSQVTNYIV--LKRETSTAVWTEVSATVAR--TMIKVMKLTTGEEYQFRIKAENRFGISD--HIDSACVVVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSPVTGYHLEMKDRNSILWQKANKMVIRTTHFKVTT----------ISAGLI----YEFRVYAENAAGIGKPSHPSEPVLA 27706          

HSP 63 Score: 130.954 bits (328), Expect = 5.197e-29
Identity = 89/263 (33.84%), Postives = 128/263 (48.67%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            V+I    DR  L+V +  R  SG Y + + N  G     I V ++ +P P    IEV+ IS  SCV+  + P D+GGT+I +YI+E  +  S +  W  V  +  +    IKV +L     Y FR  + NR G+S P  +    I+ + P+  P  P RP V   S+N+  + W  P  DGG+ +  Y +E KE++  LW +               N  P +    K  GLVEG EY FR  A+N  G S  SE S  V+A+
Sbjct: 29636 VSITTTKDRTTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSISAESCVLSWAEPQDNGGTDITNYIVEKRE--SGTTAWQLVNSSVKR--TQIKVTHLTKYMEYSFRVSSENRFGVSKP--VESAPIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKE--------------NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPVMAQ 29878          

HSP 64 Score: 128.642 bits (322), Expect = 2.558e-28
Identity = 89/300 (29.67%), Postives = 144/300 (48.00%), Query Frame = 0
Query:  940 EIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA--TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDA----SCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP---SFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++    ++LSW+ P DDGG+ +T Y I+  +     W+   +T+ T    TV GL P   YQF +IA N  G SE     EP+  ++P+  PS+P E  I+     SVTL+W+KP  DGG+ I           G W +  ++ D+    S + RI + +  I GL E   Y+FR+ A N+ G S P   +   K  L   +   P + K      T K+   A    ++ G P P+  W++ G ++  + +  ++ +    G T  L V   +  D G Y+ VA N  G+ ++   L++
Sbjct: 31283 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI----------LGYWVEYRQSGDSAWKKSSKDRIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGE--APGVRK-EMKDVTTKLGEAAQLSCQIVGRPLPDIKWFRFGKELVQSRKYKMSSD----GRTHTLTVMTEEQEDEGVYTCVATNEVGEVESSSKLLL 31565          

HSP 65 Score: 128.257 bits (321), Expect = 3.584e-28
Identity = 102/317 (32.18%), Postives = 143/317 (45.11%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-------KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL-CRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
              VP  P       +  + I +SW  P  DGG+PI  Y ++  + +   W        +KA V        GL  G  Y+F VIA N  G+ +P +  EPI A +P  PP +P   NI      +VTL+W KP   GG  IT YI++K+D   G W  A  ++       I E E  + GL+E   Y+FR+IA N AG  SP  E    + CR     P I  D     + T+K       +  V G PPP   W K+G ++ +T ++ I   ++    +  L    S   D G Y+L A N  G  K    + VLD
Sbjct: 22198 FKVPGPPGTPQVAAVTKDSITISWHEPLSDGGSPILGYHVERKERNGILWQTV-----SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKGKPSKPSEPILALDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN-------ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDIEAPRIMVDVKFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELENTAKLEIKIADF----STNLVNKDSLRRDGGAYTLTATNPGGFAKHIFHVKVLD 22495          

HSP 66 Score: 127.102 bits (318), Expect = 8.983e-28
Identity = 84/272 (30.88%), Postives = 133/272 (48.90%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSV 818
            K  KE+ + + +++ + G R    +    R  SG Y + ++NA G     + V ++D P P   + V+ +++  C +  S P +DGG EI HYI+E  +  +S   W  V   +G+ P  S  V  LI  + Y FR RA N+ G   P  +  + I+ ++ +  P +PG P  +        + W  PESDGG  I++Y ++ +EK    W              T VN   +V+ T     GL+EG +Y FR+ AVN  G S PSE S+ +
Sbjct: 30025 KGDKELDMCEKISLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVLVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRE--TSRLNWVIV---EGECPTLSHVVTRLIKNNEYIFRVRAVNKYGPGVP--VESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNDISNYLVDKREKKSLRW--------------TRVNKDHVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFI 30275          

HSP 67 Score: 125.946 bits (315), Expect = 1.763e-27
Identity = 90/283 (31.80%), Postives = 135/283 (47.70%), Query Frame = 0
Query:  546 ELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            ++S FKD  +V      +I      + L  +  KR  SG Y +++ N+ G  + +  VN++D+P PP   +    ++K+  V+   PP DDGG+EI +YIIE  +V    + W  V  A  K   + KV+ L+    Y FR  A N  G+SDP  +    +  KD +  PD P +P V + + +S  ++W  P  DGG PIT+Y +E +E    +W +            T     P        L+EG  Y FR+ A N+ G   PS  S  V AK    KP
Sbjct: 17791 KVSWFKDEADVLEDDRTHIKTTPTTLALEKLKAKRSDSGKYSVVVENSTGSRKGVCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEV--GKDVWMPVTSASAK--TTCKVSKLLEGKDYIFRIHAENLYGISDP--LVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVSWN-PPHDGGKPITNYILEKRETMSKIWAR-----------VTKEPIHPYTKFRVPDLLEGCHYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 18055          

HSP 68 Score: 125.561 bits (314), Expect = 2.429e-27
Identity = 163/647 (25.19%), Postives = 251/647 (38.79%), Query Frame = 0
Query:  607 DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGL-SDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIK-TDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT-----VYCEKNTVLTVTKANRSIDTGHYTIKLLC-------DGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            D  DPP   E   +++NS  ++   P  DGG++I  YI+E  ++     +W + +  +    +  +V  L+  HRY FR  A N  G+ S+P E +G  I  +D  + P     P   D         + +     G PI   +          W +G  E+ NT+ +EIK TD      V    +  ++   Y+  +KA N  G     E S +V  K       L +PG               I   G  A   T      L  G SD I+  +  ++T        + N      K  + ++   Y  +++        +    +     N   VP+ P+      +  + + + W  P  DGG+ I  YV++  D +   W    +    + +  V GL   H Y+F V A N  G SEP       KA +P   P  P  P + D    SV L W KP  DGG  I  YI++K D   G W         +    I++    +  L E   Y FRI AVNKAG    +    P +   K   P ID      K + +      +  + ++G P PE  W K   +I   D  +I        +   L +      D+G Y+L  EN +G     + + VLD
Sbjct: 23379 DPCDPPGRPEPIIVTRNSVTLQWKKPAYDGGSKITGYIVEKKEL--PDGRWMKASFTNVIDTQ-FEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA-ITARDEVEPPQIRMDPKYKDTIVVHAGELFKIDADIHGKPIPTTQ----------WIKGDHELSNTARLEIKSTDFATSLSVKDAIR--IDSGSYI--LKAKNVAG-----EKSVTVNVK------VLDRPG----------PPEGPIVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLGCKVTKLLEGNEYIFRVMAVNKYGVGEPLESEPVTAKNPFVVPDAPKAPEITAVTKDSMIVVWERPAFDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPRVTDITRSSVFLSWGKPIYDGGCEIQGYIVEKCDTSVGEW------TMCTPPTGINKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIDLDLELRKILNIRAGGSLRLFVPIRGRPTPEVKWGKVDGEIR--DAAIID----STSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLD 23974          

HSP 69 Score: 125.176 bits (313), Expect = 3.490e-27
Identity = 151/611 (24.71%), Postives = 241/611 (39.44%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFG-GEPAPSVTWERNGSLL------LGDSDRISIELFSKKTVYCEKNTVLTVT--KANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWA------------TPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP 1136
            FKDG E++   ++ I        L V +  R+  G Y++  +NA G  +  I V + D P  P   I  T+I+     +    P +DG   + HY+IE  + S  +  W+ +   D     S     LI  + Y+FR  A N+ G+S P  +    ++ +  +  PD PG P   + + NS  L WA PESDGG+ I  Y +E +EK    W +              ++ +P+     K  GL EGNEY F + A N  G    S  S   L K R  +P ++ PG   + +K   T +  +     +P      E  G ++      LGD  ++++E   K        T  TVT  +A          I     G + + TG +  +D    P        +  H+  + A            TP      P ++  I+  DI   D    +  ++   T  G       ++ +   N  G      T++ + +  P      P      D    S TL W  P  DGG  I HY+++K++     +  +      C  +I     R+  L EG  Y FR+ A N+ G   P    +P +   +   P
Sbjct: 28935 FKDGVEIEKKMNMEITDVLGSTSLFVRDATRDHRGVYRVEAKNASGSTKAEITVRVQDTPGKPVGPIRFTNITGEKMTLWWDAPHNDGCAPVSHYLIEKRETSRLA--WALIE--DNCEALSYTATKLITGNEYQFRISAVNKFGVSRP--LDSDPVVAQIQYTIPDAPGTPEPSNVTGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKV-------------ISKRPICETRFKVTGLTEGNEYEFHVMAENAAGVGPASGVSR--LIKCR--EP-VNPPGAPTV-VKVTDTSKTTVSLEWSKPVFDGGLEIIGYIIEMCKADLGDWHKVNVEACVK--------TRYTVTDLQAGEEYKFRVSAINAAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSIR-ADIHTTDSFSTLTVENCNRTDAG-------KYTLTVENNSGSKSITFTVKVLDSPGP------PGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVV---SEKCIRQI----LRVSDLLEGVPYYFRVSAENEYGVGEPYEMPEPMVATEQPAPP 29491          

HSP 70 Score: 124.79 bits (312), Expect = 3.961e-27
Identity = 164/724 (22.65%), Postives = 279/724 (38.54%), Query Frame = 0
Query:   98 QWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSY--TLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEF--YFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKH-RYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETS 815
            +WF+  + +    +Y      +  T  L I +A+ +++ +Y V L N  GE+       +  E   D R                    IE   D E  E K   V    +++  NV  KW             T  G E+    R   ++R D Y  +LI+ +    + G++ + A  +         + +I    EF  + E + +T+          F+C L+   AN++W RNG  +    +Y+    G    L++    LDD         EY    +D  +  +L VE    EI            +R   D   + E    +        VF  ++      V +  N  IIV G   +M    M +GK H+L +  I   D G+             +    +  +   ++   +    P++ V   D           + +++ E   FK+ + +       ++   ++    ++  K+E  G YK++++N  G  E  IN+ ++D P P + +EVT        +    P  DGG++I  Y++E  D+   +  W  V   D        V  L      Y FR  A NR+G  +P E +   +  +  +D P  P   +V D +     L W  PE DGGA IT+Y IE ++K+   W+    +   D+              T   +VEG EY FR++A N+ G   PS  +
Sbjct: 13612 KWFRNDEAIFDSSKYIILQKDLVYT--LRIRNAQLDDQANYNVSLTNHRGENVKSAANLIVEE--EDLRI-------------------IEPLKDIETMEKK--SVTFWCKVNRLNVTLKW-------------TKNGEEVAFDNRV--LYRIDKYKHSLIIKDCGFPDEGEYVVTAGQDKSV----AELLIIEAPTEFVEHLEDQTVTEFDDAV-----FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDE-------CEYACGVDDRKSRARLFVEEIPVEI------------IRPPQD---ILEAPGAD-------VVFLAELNKDKVEVQWLKNNMIIVQGDKHQM----MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYD----------AFPKAEAEW--FKENEPL---SSKTVDTTAEQTSFRILKAKKEDKGRYKVVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKT--W--VLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVE-TDSPVEARSKYDVPGPPLNVTVTDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWETAMTVRAEDL------------SATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 14221          

HSP 71 Score: 124.405 bits (311), Expect = 5.015e-27
Identity = 87/311 (27.97%), Postives = 144/311 (46.30%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMI---DAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VP +P+     ++  + I ++W  P  DGG+PIT Y+I+  + ++  W+ A +T  + T+    GL  G  Y F + A+NK G S P +  E + A  P  PP +P+   ++D    +V+L W +P  DGG  I  Y ++     G  +    T       +I + E  + GL E   YQFR IA      S PS  + P     +++ P I+   +  S  T+K          V G+P P  +W K+G  +  ++ + +  +         LC  +   +   D+G Y++ AEN +G     + L VLD
Sbjct: 20033 VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARTPVDPPGKPE---VIDVSKSTVSLVWARPKHDGGSKIIGYFVEACKLPGDQWIRCNTSPH----QIPQEEFTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIMAESVPPRIELSVAMKSLLTVKAGTNVCLDATVFGKPKPTVSWKKDGTLLKPSEGIKMAMKR-------NLCTLELFSVTRKDSGDYTITAENPSGSKSATIKLKVLD 20329          

HSP 72 Score: 122.094 bits (305), Expect = 2.944e-26
Identity = 85/252 (33.73%), Postives = 126/252 (50.00%), Query Frame = 0
Query:  878 ELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVN--VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDT-KATVKGLKPGHI-YQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            E  S KTV    + T   + KA +  D G Y + L    G  +A G++N  V+DVP   R L   E     ++L+W  P  DGG+ I  YV++  DI    W+ A +  D+ + TV GL+ G + Y F V A N+ G  EP  T  P++A + Y  P  P    + D +   V+L W+ P  DGG  IT+Y+I+ +DK    ++   T       R ++L A +  + EG+ Y FR+ A N+ G   PS  T
Sbjct: 13979 EPLSSKTVDTTAEQTSFRILKAKKE-DKGRYKVVLQNKHG--KAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTVTDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWETAMT------VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 14221          

HSP 73 Score: 121.324 bits (303), Expect = 4.680e-26
Identity = 91/302 (30.13%), Postives = 138/302 (45.70%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETS------DSVLAKTRYLKPFLHQPGIYNIEI 839
            +S  KDG E++      I        L V +  R  SG Y + ++N  G     +N  ++DKP PP   +E+T ++   C +   PP +DGG  I +YI+E  + S  +  W+ + + + +     KV  L+  + Y FR    N+ G+ +P E      +  DP+  P  P    +   +     L W+ PESDGG+ I+ Y +E +EK+   W +              VN KP+     K  GL EG EY +R+ A N  G SLPSE+S      D V   +   KP +   G  NI I
Sbjct: 26763 ISWAKDGVEIEERARTEIVSTDYTTLLTVKDCVRRDSGQYVLTVKNVAGTRSMAVNCKVLDKPGPPAGPLEITGLTAEKCSLSWGPPQEDGGAAIDYYIVEKRETSRLA--WT-ICEGELRT-TFCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKAL--DPFTVPSPPTSLEITSVTKEFMTLCWSRPESDGGSEISGYIVERREKNSLRWVR--------------VNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSESSPLIRAEDPVFLPSPPSKPNVMDSGKTNITI 27044          

HSP 74 Score: 120.168 bits (300), Expect = 1.223e-25
Identity = 92/322 (28.57%), Postives = 143/322 (44.41%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-------LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS--IDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW---------YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            P KP+ L   E     + +SW  P D+GG+PIT Y ++  +     W        TK  +KG       L  G  YQF  +A+N  G   P    +P  A +P  PP  P  P + D    S+TL W+ P+ DGG PI  YI++ +++    + ++   D      +   E  +P L E K Y+FR+ AVN+AGES PS  T           P   ID G+      +          +KG P P+ +W          K+G+     D  L T E      ++ + + + +   +G YS+ A+N+ GQ   +  + V+D+
Sbjct: 16544 PGKPKVL---ERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPEVAGDPIYPPGAPSRPEVKDKTKSSITLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKSVNEPD----KLLPTCECVVPNLKELKKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQDCLICQAGTQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAEN-----SSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDV 16853          

HSP 75 Score: 119.783 bits (299), Expect = 1.308e-25
Identity = 93/310 (30.00%), Postives = 149/310 (48.06%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW----LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P KP   N   + ++ ++L+W  P  DGG+ +T Y ++  + ++  W    +  +  ++ +AT  GL  G  YQF V A N  G S P    +   A +P  PP  P   + +D   +++TL+W  P  DGG  I  Y I+K+     W     TD + C+  +        GLS G  Y+FRIIA N  G  S PS  +   + R +N+ P+++ G      I +      +IK  V+G P P  TW+K+G++I     + IT      G+T+ L V  +     G Y + A+N +G  K ++ + V D
Sbjct: 28702 PGKPVTYN---VTSDGMSLTWDAPVYDGGSEVTGYHVEKKERNSILWQRINMSPISGREYRAT--GLMEGLDYQFRVFAENSAGLSSPSDPSKFTLAVSPVDPPGTP---DYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWTRCNFTDVSECQYTVT-------GLSPGDRYEFRIIARNAVGTISPPSQSSGVIMTRDENVAPTVEFGPEYFDGITIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKKMNMEITD---VLGSTS-LFVRDATRDHRGVYRVEAKNASGSTKAEITVRVQD 28992          

HSP 76 Score: 118.627 bits (296), Expect = 3.362e-25
Identity = 83/269 (30.86%), Postives = 134/269 (49.81%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSD 816
            +KD KE++    V +    D   + + +  R  SG+Y++ +RNA G     I + I+DKP PP   IE   ++     +   PP DDGG +I HYI+E  +  +S   WS V++   +    IK   +I  + Y FR RA N+ G+ D  E     +I ++ +  P  P  P V   + NS  + W+ P +DGG+ I+ Y +E ++ KS+G ++   +L  +  + +  V           GL E ++Y +R+ AVN  G    SE SD
Sbjct: 27849 YKDDKELQTNALVCVENTTDLASILIKDATRLNSGTYELKLRNALGSASATIRLQILDKPGPPGGPIEFKTVTAEKITLLWQPPADDGGAKITHYIVEKRE--TSRVVWSMVSENLEEC--IIKTTKIIKGNEYIFRVRAVNKYGIGDALE--SHPVIARNAFVTPGPPSVPEVTKINKNSMTVVWSRPVADGGSDISGYILEKRDKKSLGWFK---VLKETIRDTRQKVT----------GLTEHSDYQYRVCAVNAAGQGPFSEPSD 28098          

HSP 77 Score: 118.242 bits (295), Expect = 3.751e-25
Identity = 84/298 (28.19%), Postives = 137/298 (45.97%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  E I + W  P  +GG+P+T Y ++M D ++  W  A  M  + T   V  +  G IY+F V A N  G  +P    EP+ A +  +PP   +   I D    SV L WQ+P+ DGG  IT Y+++++D   G W  A  T+       + E    + GL++   Y+FR+ A N  G  S+PS    P  C      P ID     ++ +K       +++  + G+P P   WYK+  ++ +   V +          A + +  +  +++GTY L   N  G     + L +LD
Sbjct: 27623 VTRESITVGWHEPVSNGGSPVTGYHLEMKDRNSILWQKANKMVIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPP---RNVRITDISKNSVNLSWQQPAFDGGSKITGYMVERRDLPDGRWAKASFTN-------VTETHFTVSGLTQNAQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVE----NTTDLASILIKDATRLNSGTYELKLRNALGSASATIRLQILD 27906          

HSP 78 Score: 117.857 bits (294), Expect = 5.080e-25
Identity = 81/277 (29.24%), Postives = 132/277 (47.65%), Query Frame = 0
Query:  546 ELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            E+S  KDG+ +K    VN+        L++    ++  G Y +   N+ G     +++ I++KP PP   +    +S +  V+   PP   GG +I +YI+E  D ++++  W  V+    +   +IK+  L     Y+FR  A NR G S P  +  + +I++ P+ EP  PG P V   S +   + W  P +DGG+ +  Y +E KEK+  LW +       D + KT             GL EG EY FR+ A N  G    S+ S+  +A+
Sbjct: 25284 EISWVKDGEPLKQTTRVNVEKTATSTILHIKESNKDDFGKYTVTATNSAGTATENLSIIILEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTT--WHMVSATVAR--TTIKITKLKMGSEYQFRIFAENRYGKSAP--LDSKPVIVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKTPIQDTKFKT------------TGLDEGLEYEFRVSAENIVGIGKASKVSECFVAR 25542          

HSP 79 Score: 117.857 bits (294), Expect = 6.166e-25
Identity = 88/291 (30.24%), Postives = 136/291 (46.74%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++W  P +DGG+ +  Y ++  +  +  W  A +T   DT+  V GL  G +Y++ V A N  G  +  ++ EP+ A +P  PP +P+  NI     +SV+L+W KP  DGG  IT YII++++   G W     T+       + E    +  L+E + Y+FR+ A N A   S PS  T P   +     P I         I V    + +I   V G P P  +W K+G++I       I   +Y    T K CV +    D+G Y L  +N  G     ++  VLD
Sbjct: 26547 VTWQVPVNDGGSRVLGYHLEYKERSSILWSKANKTLIADTQMKVSGLDEGLMYEYHVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNIT---RKSVSLKWSKPHYDGGAKITGYIIERRELPDGRWLKCNFTN-------VPETYFEVTELTEDQRYEFRVFARNAADSISEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADVAGRPLPIISWAKDGVEIEERARTEIVSTDYTTLLTVKDCVRR----DSGQYVLTVKNVAGTRSMAVNCKVLD 26823          

HSP 80 Score: 116.701 bits (291), Expect = 1.103e-24
Identity = 86/313 (27.48%), Postives = 147/313 (46.96%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYII--QKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLT--PSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +++P  P  L   ++  E + L+W  P DDGG+ +T Y+++  ++    W+    +    T+    GL  G  Y+  V AVN  G  +P R  +P  A +P  PP +P+ P + D    SV+L W  P D+GG  +T Y+I  QK D+     +  K +    + R    E  +  L +G  Y+FR++A N  G   P+    P   +   +   P  +      + I V +  + +  I +KG+P P   W K G  I S   ++ T E +      +L + ++   D+GTY L+ EN+ G+    + + V+
Sbjct: 30872 INIPGPPETLQIFDVSREGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAVNVRGTGKPSRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ----HEWTKCNTTPTKIR----EYTLTHLPQGAEYRFRVLACNAGGPGEPA--EVPGTVKVTEMLEYPDYELDERYQEGILVRQGGVIRLTIPIKGKPFPICKWTKEGQDI-SKRAMIATSETH-----TELVIKEADRDDSGTYDLILENKCGKKAVYIKVRVI 31168          

HSP 81 Score: 116.316 bits (290), Expect = 1.519e-24
Identity = 84/272 (30.88%), Postives = 131/272 (48.16%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KD   +K    VN     +   L +    RE  G Y + + N+ G     +NV ++DKP PP   +++  ++ +S      PP  DGG+ I +YI+E  D S+++  W  V+    +   +IK   L     Y+FR  A NR G S    ++ + ++ + P+  P  PG P V   S +S ++ W  P SDGG+ +  Y +E KE++  LW +   LN + I         P       GL EG EY FR+ A N  G   PS+ S+S +A+
Sbjct: 23125 KDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYIVKLTNSAGEATETLNVIVLDKPGPPTGPVKMEEVTADSVTFSWGPPKYDGGSSINNYIVEKRDTSTTT--WQIVSATVAR--TTIKACRLKTGCEYQFRIAAENRYGKST--YLTSEPVVAQYPFKVPGPPGTPFVTLSSKDSMEVHWNEPVSDGGSKVIGYHLERKERNSILWVK---LNKTPI---------PQTKFKTTGLDEGIEYEFRVSAENIVGIGKPSKVSESYVAR 23378          

HSP 82 Score: 115.161 bits (287), Expect = 3.679e-24
Identity = 83/271 (30.63%), Postives = 131/271 (48.34%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            K GK+++    V I        + V    R+ +G Y I   N  G     + V ++D P PP  IE++++S     +  +PP +DGG+ IK Y++E  +  +S   W+ VA+ D +  + +    LI  + Y FR  A N+ G  +P  +  + + + D +  P  PG+P V + + N+  ++W  P  DGG+ IT Y +E +EK    W +      SD+  K              GL EGN Y FR+ A NK G   PS+ S+ VL K
Sbjct: 21357 KAGKDIRPSDIVQITSTPTSSMIAVKYATRKDAGEYTITATNPFGTKSEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKSYVLEKRE--TSRLLWTVVAE-DIQSCRHV-ATKLIQGNEYVFRVSAVNQYGKGEP--VQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRATKTPVSDLRCK------------VTGLQEGNTYEFRVSAENKAGIGPPSDASNPVLMK 21609          

HSP 83 Score: 114.39 bits (285), Expect = 5.946e-24
Identity = 88/319 (27.59%), Postives = 137/319 (42.95%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTD-LDLIVLDLMQECE 1238
            N    P  P      +I    + + W+ P  DGG+ I+ Y+++  D  +  W   ++   +DT+  V GL     YQ+ V AVN  G+       +  KA +P  PP  P +  I D    S+TL W KP  DGG  +T Y++  +      +  + T     +  +   E  +  LS G  Y F++ AVN AG+  P   T+P   +     P ID   +   +I  K        +  KG PPP  TW K+   + S     I   +    +++ L + +    D G Y L  EN  GQ K+  + + VLD    C+
Sbjct: 28003 NAFVTPGPPSVPEVTKINKNSMTVVWSRPVADGGSDISGYILEKRDKKSLGWFKVLKETIRDTRQKVTGLTEHSDYQYRVCAVNAAGQGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQGEEEEWTVVST-----KGEVRTTEYVVSNLSPGVNYYFQVSAVNCAGQGEPIAMTEPVQAKDILEEPEIDLDVAFRTSIIAKAGEDVHALVPFKGRPPPTVTWRKDEKNLGSDARYSIQNTD----SSSILTIPQVTRHDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQ 28312          

HSP 84 Score: 114.39 bits (285), Expect = 6.804e-24
Identity = 82/276 (29.71%), Postives = 125/276 (45.29%), Query Frame = 0
Query:  550 FKDGKEV-KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +K G ++ K  Q VN         LN+    R  SG Y +  RN  G    +I + + D P PP   I+   +S +       PP++DGG  I +Y++E     S++  W ++A    +   + K   L     Y+FR +A NR G+     I+   ++   P+  P  PG P V   + +S  ++W  P SDGG+PI  Y +E KE++  LWQ                  K +V G      GL +G  Y FR+ A N  G   PS+ S+ +LA
Sbjct: 22041 WKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTT--WVELATTVIR--TTYKATRLTTGVEYQFRVKAQNRYGVGP--SITSAPVVANYPFKVPGPPGTPQVAAVTKDSITISWHEPLSDGGSPILGYHVERKERNGILWQ---------------TVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKGKPSKPSEPILA 22295          

HSP 85 Score: 114.005 bits (284), Expect = 7.402e-24
Identity = 84/292 (28.77%), Postives = 132/292 (45.21%), Query Frame = 0
Query:  947 NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG--GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
             +SW  P DDGG+ IT Y ++  +  +  W+ A +T   D +  V GL+ G+ Y+F V A NK G   P     P+  ++   PP  P    + D   +S +L W KP  DGG  IT Y+++ + K G  GW      D      RI E    +P L   + Y FRI A+N AG   P+      +   + + P  +  +   +T+ V      +I   +KG P PE TW K+ I + +   +  T       +   L + +    D G + +  EN  G+    +++ VLD
Sbjct: 21531 TVSWKRPVDDGGSEITGYHVERREKKSLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSDASNPVLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQ-KVGDEGWIK----DTTGTALRITEF--VVPDLETKEKYNFRISAINDAGVGEPAVIPNVEIV-EREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTE------SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 21808          

HSP 86 Score: 113.62 bits (283), Expect = 1.063e-23
Identity = 92/295 (31.19%), Postives = 143/295 (48.47%), Query Frame = 0
Query:  944 EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            + + + W  P  DGG+ +  Y ++  + ++  W+   +T    TK    GL  G  Y+F V A N  G  +P +  E   A +P  PP  P EP IV     SVTL+W+KP+ DGG  IT YI++KK+   G W  A  T+       + + +  + GL E   Y+FR+IA N AG  S PS  T     R +   P I        TI V+   +++I   + G+P P   W K   ++++T  + I   ++       L V  +  ID+G+Y L A+N  G+    +++ VLD
Sbjct: 23297 DSMEVHWNEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLDEGIEYEFRVSAENIVGIGKPSKVSESYVARDPCDPPGRP-EPIIVT--RNSVTLQWKKPAYDGGSKITGYIVEKKELPDGRWMKASFTN-------VIDTQFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPQIRMDPKYKDTIVVHAGELFKIDADIHGKPIPTTQWIKGDHELSNTARLEIKSTDF----ATSLSVKDAIRIDSGSYILKAKNVAGEKSVTVNVKVLD 23577          

HSP 87 Score: 112.079 bits (279), Expect = 3.343e-23
Identity = 82/310 (26.45%), Postives = 131/310 (42.26%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK---DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKT--IKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +P+ P    P  +    I L+WA P  DGG+ I  Y+++  +  +  W+  +  +   +T+  V GL  G+ Y+F V+A N  G          IK   P  PP  P    + D    +V+L W KP  DGG  I  YII+  K   G W    K +  +C     +    +  L  G+ Y+FR+ A+N AG+      T       +   P +D  ++  +T  ++   +    I  +G P P   W K    ++   ++  T       + + L V      DAG Y+L  EN +G       + VLD
Sbjct: 29093 IPDAPGTPEPSNVTGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPICETRFKVTGLTEGNEYEFHVMAENAAGVGPASGVSRLIKCREPVNPPGAPTVVKVTDTSKTTVSLEWSKPVFDGGLEIIGYIIEMCKADLGDWH---KVNVEACV----KTRYTVTDLQAGEEYKFRVSAINAAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTT------DSFSTLTVENCNRTDAGKYTLTVENNSGSKSITFTVKVLD 29389          

HSP 88 Score: 109.383 bits (272), Expect = 1.895e-22
Identity = 87/298 (29.19%), Postives = 139/298 (46.64%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  + + + W  P ++GG+P+  Y ++  + ++  W    +T   DT+     L+ G  Y+F V A N  G  +  +  E   A +P  PP  P+    +      +TL+W KP+ DGG  IT YI++K+D   G W  A  T+       + E +  + GL+E + Y+FR+IA N AG  S PS  T P   R +   P I        TI VN    ++++  V G+P P   W +   +I  +    I   +++    A L V  +  ID G Y L A N  G     +++ VLD
Sbjct: 24376 VSKDSMVVQWHEPINNGGSPVIGYHLEKKERNSILWTKVNKTIIHDTQFKAVNLEEGIEYEFRVYAENIVGIGKASKNSECYVARDPCDPPGTPEA---IIVKRHEITLQWTKPAYDGGSVITGYIVEKRDLPEGRWMKASFTN-------VIETQFTVSGLTEDQRYEFRVIAKNAAGAVSKPSDSTGPITARDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARYEIKNTDFK----ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLD 24659          

HSP 89 Score: 109.383 bits (272), Expect = 2.319e-22
Identity = 88/298 (29.53%), Postives = 138/298 (46.31%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  + + + W  P +DGG+ +  Y ++  + ++  W+   +T  +DTK    GL  G  Y+F V A N  G  +  +  E   A +P  PP  P E  ++  +N  VTL+W+KP+ DGG  IT YI++KKD   G W  A  T+       + + E  + GL E + Y+FR+IA N AG  S PS  T     R +   P  S+D        +    T + +  ++G+P P+  W K+G ++  T   +  +   Q      L V      D G Y L   N  G     + + VLD
Sbjct: 25458 VSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKASKVSECFVARDPCDPPGRP-EAIVITRNN--VTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTN-------VLDTEFTVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWSKDGRELEETAARMEIKSTIQ---RTTLVVKDCIRSDGGQYILKLSNVGGTKTIPITVKVLD 25742          

HSP 90 Score: 108.997 bits (271), Expect = 2.566e-22
Identity = 84/278 (30.22%), Postives = 133/278 (47.84%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPK---REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KD   +K    +N+    D +DL V++ K   ++  G Y I + N  G     I +  +DKPDPPK  ++   +S  S  +   PP   GG +I +Y+++  D  +++  W  V+    +   ++KV  L     Y+FR  A NR G S    +  + I+ + P+ EP  PG P V   S +S  + W  P ++GG+P+  Y +E KE++  LW              T VN K ++H T      L EG EY FR+ A N  G    S+ S+  +A+
Sbjct: 24207 KDDLPLKQTTRINVT---DSLDLTVLSIKETHKDDGGHYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESITLSWEPPLYTGGCQITNYVVQKRD--TTTTVWEVVSATVAR--TTLKVTKLKTGTEYQFRIFAENRYGQS--FALESEPIVAQYPYKEPGPPGTPFVTAVSKDSMVVQWHEPINNGGSPVIGYHLEKKERNSILW--------------TKVN-KTIIHDTQFKAVNLEEGIEYEFRVYAENIVGIGKASKNSECYVAR 24460          

HSP 91 Score: 107.842 bits (268), Expect = 5.568e-22
Identity = 76/262 (29.01%), Postives = 129/262 (49.24%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK--SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGG---ASLPSETSDS 817
            VN     D   L +   +R  +  Y I   N  G   + + +N++ +P PP   I+   IS +   +   PP DDGG++I +Y+IE  + +  +  W +V+      PK  +  +  L+  H Y FR  A N+ G+ +P  +  +    ++ +  P  P +P+V   + NS  + W  PE DGG+P+T Y +E K+ +   W++   +N   I+  T       V     GL+EG++Y FR+ A+N  G   ASLPS+ + +
Sbjct: 17112 VNKLVVDDTCTLVIPQSRRSDTALYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPIDDGGSKITNYVIEKREANRKT--WVRVSSE----PKECTYTIPKLLEGHEYVFRIMAQNKYGIGEP--LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTTKRWKR---VNRDPIKAMTL-----GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA 17357          

HSP 92 Score: 105.916 bits (263), Expect = 2.621e-21
Identity = 73/253 (28.85%), Postives = 117/253 (46.25%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLL 869
            +  ++K+S  +  S P DDGG+ +  Y IE  +  +S+++W +  +          V  L+    Y+FR  A N +GLS+    S + ++ KDP+D+P +PG   +L  S +S  L W  PE DGG  I  Y +EY++     W++       D +             T  GL+E  EY FR+ A N+ G S P  T+ SV  K    +    +  + ++  K G   +      G P P + W R G  L+
Sbjct: 31281 ILDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE--TSTDKWVRHNKTQITT-TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPAS-EPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSSKDRIKDRQF------------TIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWFRFGKELV 31517          

HSP 93 Score: 105.531 bits (262), Expect = 3.076e-21
Identity = 72/245 (29.39%), Postives = 118/245 (48.16%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQV-AQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETS 815
            L+V +  R  SGSY +  +N  G     +NV ++D+P PP+  I ++ ++   C +   PP  DGG++I +YI+E  +  +S   W+ V A     G    KV  L+  + Y FR  A N+ G+ +P E   + +  K+P+  PD P  P +   + +S  + W  P  DGG+ I  Y +E ++K    W +       ++ ++              GL+E + Y FR+ A N  G S PS  S
Sbjct: 23543 LSVKDAIRIDSGSYILKAKNVAGEKSVTVNVKVLDRPGPPEGPIVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRE--TSRLVWTVVDANVQTLG---CKVTKLLEGNEYIFRVMAVNKYGVGEPLE--SEPVTAKNPFVVPDAPKAPEITAVTKDSMIVVWERPAFDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLR------------VTGLLENHNYEFRVSAENAAGLSEPSPPS 23768          

HSP 94 Score: 102.449 bits (254), Expect = 2.300e-20
Identity = 79/307 (25.73%), Postives = 130/307 (42.35%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX--AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF----GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFE-TKPHLCRHKNLTPSID---KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            + A  +++ W  P+ DGG+ +  Y ++  + +   W+    +   +    V GL  G  YQF   A+N  G S+      P+ A+NP   P  P+   + D    +V+L W  P  DGG  +  YII++K       G W     T        + +    +  LSEG  Y+FR++A N AG  S   E T P  CR +   P  +   +      TI+     +    V G+P P+  W K   ++   +++ +     +  A  K C       D+G Y+L  +N +G     + + VLD    C
Sbjct: 29794 VSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPVMAQNPVDAPGRPE---VTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTI-------VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPITCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDMCEKISLQYTGKRATAVIKFC----DRSDSGKYTLTVKNASGTKAVSVLVKVLDSPGPC 30086          

HSP 95 Score: 99.3673 bits (246), Expect = 2.491e-19
Identity = 91/318 (28.62%), Postives = 136/318 (42.77%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-------LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            N+  VP  P       +    + ++W  P  DGG+P+T Y ++M D     W       + AM T      V GL  G  YQF V A+N  G        +P  A +P  PP  P    + D+   S  L W  P  DGG  +T YI++ K++        +  + + +  +   +  + GL EG +Y+FR+ AVN AG   P   T     + +   P +   +S    I V+   + +I   V G+PPP  TW  N  + A   E  I           K C    Q    G YSL+A+N  G+ K  + + VLD+
Sbjct: 17254 NLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTTKRWKRVNRDPIKAM-TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSRVTGYIVEYKEE------GKEEWEKAKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRLELPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--ERALPQEATIETTAISSSMVIKNCQRSHQ----GVYSLLAKNAAGERKKTIIVDVLDV 17557          

HSP 96 Score: 89.7373 bits (221), Expect = 1.736e-16
Identity = 104/361 (28.81%), Postives = 151/361 (41.83%), Query Frame = 0
Query:  683 RFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVL-DWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFL-HQPGIYNI---EIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGH-YTIKLLCD-----GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGE-SEPCRTLEPIKAENPYKPP 1029
            R+   AAN  G +     +  +I++    D P  P  P V+ D + +S  L W  P+ DGG+ +T+Y +  +E S  +W           E+   V  + M+      L  G EY FRIKA N+ G S   + S  V+ K  Y  P     P + N+    I  G  +   +  GG P      E          DR SI L+ K      + T   VT    +I  G  Y  ++  +     G     +  V  +D  E PR +   +I    +NLSW  P  DGG+ IT Y+++  D+ +G W  A  T   +T  TV GL     Y+F V A N  G  S P   + PI   + Y  P
Sbjct: 27488 RYEITAANSSGTTK----AFINIVV---LDRPGPPTGPVVISDITEDSVTLKWEPPKYDGGSQVTNYIVLKRETSTAVWT----------EVSATV-ARTMIK--VMKLTTGEEYQFRIKAENRFGISDHID-SACVVVKLPYTTPGPPSTPWVTNVTRESITVG--WHEPVSNGGSPVTGYHLEMK--------DRNSI-LWQKANKMVIRTTHFKVT----TISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYMVERRDLPDGRWAKASFTNVTETHFTVSGLTQNAQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGP 27812          

HSP 97 Score: 89.3521 bits (220), Expect = 2.492e-16
Identity = 82/285 (28.77%), Postives = 135/285 (47.37%), Query Frame = 0
Query:  439 PSAPVDFFLNGK-IIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKV-----GQD-VNINFHGD----RVDLNVINP---KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            P   V ++  GK II  G   R  +++   G HQLI+  +T +D    + R  TN G  +VS T S  V          D  P     H   N     AV   +   I + +   GK   V     GQD ++ N H      R   +++ P   +R+ +G Y +  +N  G D++ + +++ D PDPP+ ++V+ +S++S  +  + P  DGG+++ +YI+E    ++++ +W +V QA         V NL  K  Y+FR  A N+ GLS P E S   +  +D
Sbjct: 31898 PKPIVKWYRQGKEIIADGLKYR--IQEFKGGYHQLIIASVTDDDATVYQVRA-TNQGG-SVSGTASLEV---------EDTVPAK--IHLPKNLEGMGAVHALRGEVISIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVE--KCATTAERWIRVGQARE---TRYTVINLFGKTSYQFRIIAENKFGLSKPSEPSEPTVTKED 32162          

HSP 98 Score: 82.8037 bits (203), Expect = 2.244e-14
Identity = 83/309 (26.86%), Postives = 136/309 (44.01%), Query Frame = 0
Query:  732 LAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-----GGTQQATGYVNVLDV---PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPS 1030
            LAW  P +DGG+ I  Y +E ++     W    +L T   +     + +  V G  KG   G EY+FR+ A N+ G   P ET   V A+++Y  P    P + N+ +      R+ +    EP          + ++   D+ SI   +  TV  E +   TVT     ++   Y+ ++        G    AT ++ V D    P  P  LN  +     + L+W  P  DGG+PI  Y+I+  +    +W+   +    + T  V GL+ G+ Y + V A N+ G S+P   L P+ A++    P+
Sbjct: 14049 LAWEEPLTDGGSKIIGYVVERRDIKRKTW----VLATDRAD-----SCEFTVTGLQKG---GVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVP---GPPL-NVTVTD--VNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWETAMTVRAE-DLSATVTDV---VEGQEYSFRVRAQNRIGVGKPSAATPFIKVADPIERPSPPVNLNASDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDADAEPT 14335          

HSP 99 Score: 70.4774 bits (171), Expect = 1.396e-10
Identity = 112/445 (25.17%), Postives = 178/445 (40.00%), Query Frame = 0
Query:  712 DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWER----NGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTG-------HYTIKLLCDGGTQQATGYVNVLDVPEKPRXL----------NPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQS---VTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            D P  P   +V +   +S  L W  P  DGGA + +Y I+ +E +   +      N S+   KT +          + L EG  Y FR+ A N+ G  +P ET D+V A      P              G+    D+    + + S+ WE+     GS +LG      +E+  K T   EK +V+  +K   ++ TG       H+ +K   + G         VL VP   + L          N   ++A   +L    P      P  S+V     +     +   +T   T   +K        ++ V A N  G +     L  I  E P  PP  P     V FD  S   V + W+ P+  GG  I++YI++K+D     +  +    A    +I +L+        G  YQFRI A N+ G+S+P  ++KP + ++
Sbjct: 25056 DTPGPPQNLAVKEVRKDSVLLVWDPPLIDGGAKVKNYVIDKRESTRKAYA-----NVSNKCSKTSLK--------VENLTEGAIYYFRVMAENEFGIGVPVETVDAVKASEPPSPP--------------GKVTLTDV---SQTSASLMWEKPEHDGGSRILG----YVVEMQPKGT---EKWSVVAESKVCSAVVTGLSSGQEYHFRVKAYNEKGQSDP----RVLGVPVIAKDLTIQPSFKLPFNTYSVQAGE-DLKIEIPVIGRPRPEISWVKDGEPLKQTTRVNVEKTATSTILHIKESNKDDFGKYTVTATNSAGTA--TENLSIIILEKP-GPPVGP-----VRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKM-------GSEYQFRIFAENRYGKSAP-LDSKPVIVQY 25442          

HSP 100 Score: 64.6994 bits (156), Expect = 7.892e-9
Identity = 104/483 (21.53%), Postives = 185/483 (38.30%), Query Frame = 0
Query:   20 LKPPEDAMKSGERKASLVLSDG-LTMNEDVEWEWEN--ESIPLRPEGKVPKLVNPQDKWSCGEGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQ-LIVHYITMEDYGQIEARTPTNHGDKTV 498
            L+ PE  +K   +   L+L +  L     V+++  N   S  LR + +V  L+ P    +   G+      ++  + +P ++W+   K L  EP  K           L +   + E+ G+ +++ K+     + + K FV  E  ++F   L                      DQ V+E      VL   +S  N K KW+               G E+ KS+++E +       LI+H  T E+   +T  AK     F T  ++ V+PP  EF    + +T          +F C ++   A + W ++GA +    +Y+   +G    LV+N+  LD                             D  E +C      +S  L V  +    ++  +  E  E ++     +V  P A V ++   + I+     R E+  + DG+ + LI+    +ED G    R P++  D  V
Sbjct: 13088 LQTPECEIKEEGKTHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDITVTAGETATFDCELSYEDIP-VEWYLRGKKL--EPSDKVVMRSEGRVHTLTLRDVKLEDAGEVQLVAKD----FKTQAKLFVK-EPPVEFTKPLE---------------------DQTVEEEAT--AVLECEVSRENAKVKWF-------------KNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFL---RPLTDLRVKEKEMARFECEISRENAKVHWFKDGAEIKKGKKYDIISKGAVRILVINKCLLD-----------------------------DEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTVKLVCEVSKPGAEVTWYKGDEEIIETG--RYEI--LTDGRKRILIIQNAHLEDAGNYNCRLPSSRTDGKV 13486          

HSP 101 Score: 56.225 bits (134), Expect = 2.903e-6
Identity = 108/493 (21.91%), Postives = 185/493 (37.53%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            ++WFK  ++L   P++    +G+    IL I  A  +++G+Y                   T +  +   A L+K +K    VEV V +     ++                LS P+V G+W L+             G  L  S   E I     + L+++N  ++ +GK +  A   N        V+ +P      F   L   K        KF C ++      RW +    +    R E    G K  LV+     +D         +Y+ + ED  TS KLI+EG                 +R+    KF++ +       ERES VF V++   +  V +F N + +     T   V    +GK H +    ++++D  QI+           +S      V+ G+     KL D    +GV  ++       +     ++D  +  FKDG+E+K  ++  I   G +  L +  P +   G Y
Sbjct: 12633 VKWFKDGEELLPSPKHSIKADGLRR--ILKIKKADLKDKGEYVCDCGTD------------TTKANVTVEARLIKVEKPLYGVEVFVGETARFEIE----------------LSEPDVHGQWKLK-------------GEPLTASPDCEIIEDGKKHILVLYNCRLDMTGKVSFQAA--NAKSAANLKVKELP----LIFITPLSDVKV-FEKDEAKFECEVSREPKTYRWLKGTQEITGDDRIELIKDGTKHSLVIKSAAFEDEA-------KYIFEAEDQHTSGKLIIEG-----------------IRL----KFLTPLKDVT-AKERESAVFTVELSHDNIRVRWFKNDQRL----HTSKFVSMDDEGKTHSITFRNLSIDDTSQIKVEA------MGLSSEAKLTVLEGDPYFTGKLQD---YTGVEKEEVILQCEIS-----KADAPVKWFKDGQEIKPSKNAVIKADGKKRMLILKKPLKSDIGQY 13028          

HSP 102 Score: 53.1434 bits (126), Expect = 2.332e-5
Identity = 74/299 (24.75%), Postives = 131/299 (43.81%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM--ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI--KAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDEL-----EARIPGLSEGKWYQFRIIAVNKAGESS--PSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTD--EVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++W  P  DGG  I +Y ++  +     W+     E ++T  +V+ L  G  Y+F V   N  GESE     EP+  K++ P + P   +E   ++   QS      K +    +PI  +  Q K+      D LK        RI E      +  I  +++     +++ A N+ G  S   S E +  +    +L  +++ G  +   ++    +I +I   G+P P  TW K    I +    +V++TR       T+ +  +  +  DAG Y + A+NR G D+  ++L V D+
Sbjct: 31786 VAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTDEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP-KPIVKWYRQGKEIIA---DGLK-------YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEDTVPAKIHLPKNLE-GMGAVHALRGEVISI-KIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTR-----SFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV 32066          

HSP 103 Score: 51.6026 bits (122), Expect = 7.434e-5
Identity = 115/495 (23.23%), Postives = 192/495 (38.79%), Query Frame = 0
Query:   95 PEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            P I+W+KG+ ++  EP  KT      N I L + +A  E+  +Y V ++                  G  + A L   ++     EV++   IE     E +    D     A +S  +V G+W L+             G  L  S   E    +    L +HN  ++++G+  ++ +  N   T    V+ I  D     +   + +K     R  +F C+L    AN+ W++    +    +++    G+K  LV+N  + DD GV       Y  + E   TS +L V G                 +R+    KF+S +  Q    E E+  F  ++      V +F N   +     T   V    +GK H+L +  +TM+D  QI+A+       K +S T +  VI  +     KL D    +GV  KD        +      D+ +  FKDG+E+      +I   G R  L +     +  G Y
Sbjct: 12275 PNIKWYKGYDEIPWEPTDKTEIIRDGNHIHLKVKNAMPEDIDEYAVEIE------------------GKRYPAKLTLGER-----EVELLKPIEDVTIYEKESASFD-----AEISEVDVPGQWKLK-------------GELLRPSPTCEIKAEDGKRFLTLHNVKLDQAGE--VLYQALNAVTTAILTVKEIELDFAVPLKDVTVPEK-----RQARFECVLTRE-ANVIWSKGPDIIKSSDKFDIITDGKKHILVINNSQFDDEGV-------YTAEVEGKKTSARLFVTG-----------------IRL----KFISPLEDQTVK-EGETATFVCELSHEKMHVVWFKNDAKL----HTSRTVLISSEGKTHKLEMREVTMDDISQIKAQV------KDLSSTANLKVIEADPYFTVKLHD---KTGV-EKD-----EIVLRCEVSKDVPVKWFKDGEELLPSPKHSIKADGLRRILKIKKADLKDKGEY 12672          

HSP 104 Score: 48.9062 bits (115), Expect = 4.091e-4
Identity = 105/469 (22.39%), Postives = 172/469 (36.67%), Query Frame = 0
Query:  264 ESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNC-ILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVK-DPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKD-GKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDE------RLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDD----DGGTEI----KHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRI-------GLSDPHEISGQDIIIK 708
            +SG++T  A  +         + V  P P+F   KKL   K      S+   C I       + W RN + L    +Y  S       L +N+   +D+G       +Y+ +  + V        GDA          S S+ L +     F  + S     ++    VF  ++   P   V +  + K +      ++  K      H L    +   D G+   +     G  T  CT  F V       KL D   + G A +     +   VEG++   I +   KD G  ++  ++  I+F  +   L + +P+   SG Y   I+N  G  E       L    I++KP+ P T+   +     CVV  +P         G EI    KH+I     V+S        A+   KG  S +V N + K         ++RI        L D + I G  ++++
Sbjct: 7239 DSGQYTCQATNDVGKDMCSAQLSVKEP-PKFV--KKLEASKVAKQGESIHLECKISGSPEIKVSWFRNDSELHESWKYNMSFVDSVAVLTINEASAEDSG-------DYICEAHNGV--------GDA----------SCSTALTIKAPPVFTQKPSPIG-ALKGSDVVFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDASLHIL---NLEAADVGEYYCKATNEVGSDTCVCTLKFKVEPPRFVKKLSDTSTLVGDAVE-----LRAVVEGFQP--ISVVWLKDKGDVIRESENTRISFVDNVATLQLGSPEASDSGKYVCQIKNDAGMRECSAILTVLEPARIIEKPE-PMTVTTGNAFALECVVTGTPELSAKWFKDGREIAADSKHHITFVNKVASLK---IPCAEMSDKGLYSFEVKNSVGKSTCTVSVHVSDRIVAPSFIRKLKDINAIVGASVVLE 7664          

HSP 105 Score: 48.1358 bits (113), Expect = 7.122e-4
Identity = 103/440 (23.41%), Postives = 172/440 (39.09%), Query Frame = 0
Query:  836 NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIR--AEHINLSWATPHDD----GGTPIT-SYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVD-FDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALK------TDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS---FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD---LMQECECDMFKTGD---LECN 1250
            +I +  G T   +    G P  +  W ++G  L  D ++  I  F+K +       ++ V  +    D+G Y+ ++    G    T  V V D     R + P   R   E   LS ++   +    G  PI+ S+  +  +I +G       T +T A TV  L+      +  IA N  G  E C     ++     +PPS  ++P+ +D     +VT                 I++    F   WF          T + S E  + ELE  +  +   +  ++  I  N+AG+ S +   +   P     K    SI+KG          +  I +    G PP   TW KNGI +  +    IT  E     +A L +  S + DAG Y+   EN +G+D     +++L+    +++ E      GD   L+C 
Sbjct: 8502 SITVTTGDTCTLECSVTGTPELTTKWFKDGKELTSD-NKYKISFFNKVSGL----KIINVAPS----DSGVYSFEVQNPVGKDSCTASVQVSD---SDRIVPPSFTRRLKETNGLSGSSVVMECKVYGSPPISVSWFHERNEISSGRKYQTTLTDNTCALTVNMLEESDAGNYTCIATNVAGSDE-CSAPLTVR-----EPPSFVQKPDPMDVLTGTNVTFT--------------SIVKGTPPFSVSWFKGSTELVPGDTCNVSLEDSVAELE--LFDVDTSQSGEYTCIVTNEAGKVSCTTHLYVKAPARFVKKLNDYSIEKG----------KPLILEGTYTGTPPISVTWKKNGINVTPSQRCNITTTER----SAILEIPSSTVEDAGQYNCYIENTSGKDSCSAQILILEPPYFVRQLEPVKVTVGDSASLQCQ 8893          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:TTN "Titin" species:9606 "Homo sapiens" [GO:0000794 "condensed nuclear chromosome" evidence=IDA] [GO:0001701 "in utero embryonic development" evidence=IEA] [GO:0002020 "protease binding" evidence=IPI] [GO:0002576 "platelet degranulation" evidence=TAS] [GO:0003300 "cardiac muscle hypertrophy" evidence=IMP] [GO:0004674 "protein serine/threonine kinase activity" evidence=IDA] [GO:0004713 "protein tyrosine kinase activity" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005516 "calmodulin binding" evidence=TAS;IPI] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005576 "extracellular region" evidence=TAS] [GO:0005634 "nucleus" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005794 "Golgi apparatus" evidence=IDA] [GO:0005829 "cytosol" evidence=TAS] [GO:0005865 "striated muscle thin filament" evidence=IDA] [GO:0006936 "muscle contraction" evidence=NAS;TAS] [GO:0006941 "striated muscle contraction" evidence=TAS] [GO:0007076 "mitotic chromosome condensation" evidence=IEP] [GO:0007512 "adult heart development" evidence=IEA] [GO:0007596 "blood coagulation" evidence=TAS] [GO:0008307 "structural constituent of muscle" evidence=IMP;TAS] [GO:0019899 "enzyme binding" evidence=IPI] [GO:0019901 "protein kinase binding" evidence=IPI] [GO:0030018 "Z disc" evidence=IDA] [GO:0030049 "muscle filament sliding" evidence=TAS] [GO:0030168 "platelet activation" evidence=TAS] [GO:0030240 "skeletal muscle thin filament assembly" evidence=IMP] [GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IMP] [GO:0031430 "M band" evidence=IEA;IDA] [GO:0031433 "telethonin binding" evidence=ISS;IPI] [GO:0031674 "I band" evidence=IDA] [GO:0035995 "detection of muscle stretch" evidence=TAS] [GO:0042802 "identical protein binding" evidence=IPI] [GO:0042805 "actinin binding" evidence=IDA;IPI] [GO:0043056 "forward locomotion" evidence=IEA] [GO:0043621 "protein self-association" evidence=IDA] [GO:0045214 "sarcomere organization" evidence=IMP] [GO:0045859 "regulation of protein kinase activity" evidence=IMP] [GO:0048739 "cardiac muscle fiber development" evidence=IMP] [GO:0048769 "sarcomerogenesis" evidence=IMP] [GO:0050790 "regulation of catalytic activity" evidence=IMP] [GO:0051015 "actin filament binding" evidence=IDA] [GO:0051371 "muscle alpha-actinin binding" evidence=IPI] [GO:0051592 "response to calcium ion" evidence=IDA] [GO:0055003 "cardiac myofibril assembly" evidence=IMP] [GO:0055008 "cardiac muscle tissue morphogenesis" evidence=IMP] [GO:0060048 "cardiac muscle contraction" evidence=IMP] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] [GO:0097493 "structural molecule activity conferring elasticity" evidence=TAS] [GO:0005730 "nucleolus" evidence=IDA] Reactome:REACT_604 InterPro:IPR015129 InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009 Pfam:PF00041 Pfam:PF00069 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005829 GO:GO:0005524 GO:GO:0005794 GO:GO:0070062 GO:GO:0030168 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0031430 GO:GO:0030018 GO:GO:0005509 GO:GO:0051592 GO:GO:0003300 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0018108 GO:GO:0004674 GO:GO:0001701 GO:GO:0002576 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0051015 Orphanet:155 Orphanet:154 GO:GO:0043621 GO:GO:0004713 GO:GO:0005516 GO:GO:0005865 GO:GO:0030240 Reactome:REACT_17044 GO:GO:0055008 GO:GO:0055003 GO:GO:0060048 GO:GO:0030049 GO:GO:0045214 GO:GO:0008307 GO:GO:0007512 GO:GO:0000794 GO:GO:0097493 GO:GO:0007076 GO:GO:0045859 InterPro:IPR013098 Pfam:PF07679 MEROPS:I43.001 Orphanet:169186 GO:GO:0030241 EMBL:AC023270 GO:GO:0035995 GO:GO:0042805 GO:GO:0031433 EMBL:AJ277893 GO:GO:0048739 Orphanet:293899 Orphanet:293888 Orphanet:293910 GO:GO:0043056 EMBL:AC009948 GO:GO:0048769 Orphanet:609 PDB:2WP3 PDB:2WWK PDB:2WWM PDB:3KNB PDBsum:2WP3 PDBsum:2WWK PDBsum:2WWM PDBsum:3KNB PDB:1YA5 PDB:2F8V PDBsum:1YA5 PDBsum:2F8V EMBL:X90568 EMBL:X90569 EMBL:AJ277892 EMBL:AC010680 EMBL:FJ695199 EMBL:BC013396 EMBL:BC058824 EMBL:BC070170 EMBL:BC107797 EMBL:X98114 EMBL:X98115 EMBL:X83270 EMBL:AF058332 EMBL:AF525413 EMBL:DQ248309 EMBL:X64698 EMBL:X64699 EMBL:X64697 EMBL:X69490 EMBL:AL713647 PIR:I38344 PIR:I38346 RefSeq:NP_001243779.1 RefSeq:NP_001254479.1 RefSeq:NP_003310.4 RefSeq:NP_596869.4 RefSeq:NP_596870.2 RefSeq:NP_597676.3 RefSeq:NP_597681.3 UniGene:Hs.134602 PDB:1BPV PDB:1G1C PDB:1NCT PDB:1NCU PDB:1TIT PDB:1TIU PDB:1TKI PDB:1TNM PDB:1TNN PDB:1WAA PDB:2A38 PDB:2BK8 PDB:2ILL PDB:2J8H PDB:2J8O PDB:2NZI PDB:2RQ8 PDB:2Y9R PDB:3B43 PDB:3LCY PDB:3LPW PDB:3PUC PDB:3Q5O PDB:3QP3 PDBsum:1BPV PDBsum:1G1C PDBsum:1NCT PDBsum:1NCU PDBsum:1TIT PDBsum:1TIU PDBsum:1TKI PDBsum:1TNM PDBsum:1TNN PDBsum:1WAA PDBsum:2A38 PDBsum:2BK8 PDBsum:2ILL PDBsum:2J8H PDBsum:2J8O PDBsum:2NZI PDBsum:2RQ8 PDBsum:2Y9R PDBsum:3B43 PDBsum:3LCY PDBsum:3LPW PDBsum:3PUC PDBsum:3Q5O PDBsum:3QP3 DisProt:DP00072 ProteinModelPortal:Q8WZ42 BioGrid:113124 DIP:DIP-33449N IntAct:Q8WZ42 MINT:MINT-2881875 PhosphoSite:Q8WZ42 DMDM:108861911 PRIDE:Q8WZ42 Ensembl:ENST00000342175 Ensembl:ENST00000342992 Ensembl:ENST00000359218 Ensembl:ENST00000360870 Ensembl:ENST00000436599 Ensembl:ENST00000460472 Ensembl:ENST00000589042 Ensembl:ENST00000591111 GeneID:7273 KEGG:hsa:7273 UCSC:uc002unb.3 UCSC:uc021vsy.2 UCSC:uc021vsz.2 UCSC:uc021vta.2 UCSC:uc021vtb.2 UCSC:uc031rqd.1 CTD:7273 GeneCards:GC02M179355 H-InvDB:HIX0030529 H-InvDB:HIX0161887 HGNC:HGNC:12403 HPA:CAB022682 HPA:HPA007042 MIM:188840 MIM:600334 MIM:603689 MIM:604145 MIM:608807 MIM:611705 MIM:613765 neXtProt:NX_Q8WZ42 Orphanet:140922 Orphanet:289377 Orphanet:178464 PharmGKB:PA37067 HOGENOM:HOG000203078 HOVERGEN:HBG080473 KO:K12567 OMA:TWFHNNR OrthoDB:EOG7N8ZTK TreeFam:TF316477 SignaLink:Q8WZ42 ChiTaRS:TTN EvolutionaryTrace:Q8WZ42 GeneWiki:Titin GenomeRNAi:7273 NextBio:28431 PRO:PR:Q8WZ42 ArrayExpress:Q8WZ42 Bgee:Q8WZ42 Genevestigator:Q8WZ42 InterPro:IPR004168 Pfam:PF02818 Pfam:PF09042 Uniprot:Q8WZ42)

HSP 1 Score: 262.692 bits (670), Expect = 1.600e-69
Identity = 203/663 (30.62%), Postives = 300/663 (45.25%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-----RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++I   N  G  + L++ ++  K     PD P    VT ++K+S +V  + P D GG  I +YI+E  +  + S +W++V +         +V +L+   +Y FR  A N IG+ DP   S + +  KDP  +P  P  P  +D + NS DL W  P  DGG+ I  Y +EY++     W++      S  E K  V G          L +G  Y FR+ AVN  G S P+   + VL K R   P   L         IK G T R      G P P VTW++       D D     RI +     K         L +  A    D G Y++ +    G++  +  V VLD P  PR L   EIR +   L+W  P DDGG+ IT+YV++  D+ +  W     T   K+   K L  G+ Y F V A N+ G      T +PIKA +P  PP  PK+ + VD D   V+L W KP  DGG PIT Y+++ +++    +   KT        +  LE  + GL +GK Y+FR+ A N  G   P   T P  C+ K + PS+  D        +K   T  +   ++G P P   W  +G +I + +   +  + +    T K C+ +    D G Y +   N  G     + L VLD+
Sbjct: 17911 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHD-GGKPITNYILEKRE--TMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPS-KPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTG----------LRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKE------DRDAPTKARIDVTPVGSK---------LEIRNAAHE-DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKT--------VTNLECVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRR----DTGEYQITVSNAAGSKTVAVHLTVLDV 18530          

HSP 2 Score: 262.307 bits (669), Expect = 2.156e-69
Identity = 185/577 (32.06%), Postives = 281/577 (48.70%), Query Frame = 0
Query:  557 KVGQDVNINFHG--DRVD----LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            KVG D N+   G  D VD    L + N  R+ SG Y + + N  G     +NV ++D P P   ++V+ ++K SC V  +PP++DGG+++ HYI+E  +    +  WS V     K   S  V NL+  + Y FR  A N  G   P ++  + ++  DP  EPD P +  V + + NS  LAW  P  DGGA I  Y   Y+E+     +  E     D+ +               GL EG +Y FR+ A N  G SLP E      AK + L P +  P    I IK G+  R +    G+P P+  W++ G   +  S  +++          + +++L +    R  D+G+Y++      GT      V V+D P  P+   +  +I A+  +LSW  P +DGG+ IT+Y+++  D+  GDW+ A+ +   T   V  L PG  Y F V A N+ G SEP  T   + A+ P+  PSEPK   +   +   + + W +P  DGG PI  Y+I++K++    +  +K +D      +   E    GL EG  Y FRI A+NKAG S PS  T+
Sbjct: 19569 KVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKT--WSTVTPEVKK--TSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVP-KPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSL------------VVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP--EQITIKAGKKLRIEAHVYGKPHPTCKWKK-GEDEVVTSSHLAVH-------KADSSSILIIKDVTRK-DSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPL-TSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLW--VKAND----TLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTE 20109          

HSP 3 Score: 261.151 bits (666), Expect = 4.237e-69
Identity = 198/658 (30.09%), Postives = 298/658 (45.29%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L        N    P PP T EV+ I+K+S VV  + P DDGGTEI+ YI+E  D      +W++  +      + ++V  L   H Y FR  A N  G+ +P E S   +  +  D    P  P  P V D S +S  LAW+ P  DGGAP+  Y +E KE +   W        +     T + GK     T   L E  EY FRI A+N  G   P+    SV+A+ R   P +         + ++   T R  +   G P P V WE+   +L   +DR  IE+ S         T+L +    R  D+G Y + L  + G++ A   V VLD P  P  L   E++ + + LSW  P  DGG  IT+Y+++  +     +   +    TK T  ++ L+ G  Y F V+A N+ G   P  T EP+K     +PP  P    +VD    + T++W+KP  DGG  IT Y+++ + K         ++  S   ++  LEA I GL+ G+ Y FR+ AVN+ G S P     P + R   + PS++    +   +K        +  KG P     W K+G  +  T  V ++  +        L + ++   D GTY L   N  G     + +IVLD
Sbjct: 25801 FRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRD--KEGVRWTKCNKKTLTDLR-LRVTGLTEGHSYEFRVAAENAAGVGEPSEPS---VFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW--------TTCTPPTGLQGK---QFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---TDRAQIEVTS-------SFTMLVIDNVTR-FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAY-ATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVS---EPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK--------GSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTF-NVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSK----TVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLD 26413          

HSP 4 Score: 258.07 bits (658), Expect = 4.602e-68
Identity = 181/564 (32.09%), Postives = 272/564 (48.23%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP-HLCR 1130
            L + N   E  G Y + + N  G     + V ++DKP PP+ +EV+ I K+SC +    P DDGG+ I +Y++E  DV+S+  QWS ++    K  KS    +L   ++Y FR  A N+ G   P   + + I   DP   P  P     +D       L W  P+ DGG+PIT Y +EY+E+    W          I+ KT  N    +     GL +G  Y FR+KA N  G  LP +T+  +  + + + P   L    I  + +K G T R+     G P P+  W  +GS +  D    +  + FS         +VLT+    R  DTG Y I +    G++    ++ VLDVP  P   +N  ++  EH+ +SW  P DDGG+P+ +Y+++  D     W + +  +  TK  +  L+ G  Y F V A NK G   P  +  P  A++ + PPS P +P + D    + T+ W  P  DGG PIT Y +++++  G W    KT        I +L+ R+ GL EG  Y+FR+ A N AG S PS  + P   CR
Sbjct: 18201 LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASA--QWSPLSATSKK--KSHFAKHLNEGNQYLFRVAAENQYG-RGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDW----------IKFKTVTN----LECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS---------SVLTIKNCLRR-DTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDST-PTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTP-------IADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACR 18726          

HSP 5 Score: 254.988 bits (650), Expect = 3.573e-67
Identity = 203/660 (30.76%), Postives = 308/660 (46.67%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNI-----MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF--LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDE--VLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++   N  G  E L +V I        P PP ++E+T ++K S  +  S P+ DGG+EI  YIIE  +   +S +W +V +      + +K   L     Y +R  A N  GLS P E S   I  +DP   P  P +P ++D    +  +AW  P  DGGAPIT Y +EYK+             + D + KT +        T  GL  G EYVFR+K+VNK GAS PS++SD  +AK R  +P   +       + +K G +F   + F G P P+V W +       D+D     L ++  V   +  T LT+  ANR+ D+G YT+ +         T  V VLD P  P  +   ++  E   LSW  P +DGG P+ +Y I+  +     W+      +  +  V  L+ G IY F V   N+ G   P  T E +K     + PS P++  +      SV+L W KP  DGG  I HY+++  +K  G  + +K   A     +      + GL E   Y FR+ A N+AG S P     P L + +   P ID  +  S T+ V   +  +  I + G+P P+ T  ++G+ + +T      IT E         + + +S   DAG Y + A N +G  K  ++++VLD
Sbjct: 26882 FRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERRE--KNSLRWVRVNKKPVYDLR-VKSTGLREGCEYEYRVYAENAAGLSLPSETSPL-IRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKK-------------SDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP------DTD-----LRTRAYVDTTDSRTSLTIENANRN-DSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKIT---EKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEK--GQKNWVKCAVAKSTHHV------VSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLT------INLKESVTADAGRYEITAANSSGTTKAFINIVVLD 27495          

HSP 6 Score: 249.98 bits (637), Expect = 1.452e-65
Identity = 193/585 (32.99%), Postives = 281/585 (48.03%), Query Frame = 0
Query:  563 NINFHGDRVDLNVI-----------NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDW-----SSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI--EIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            N+N   DR+ L++            N  +  +G Y + + N+ G  E  I V ++D P PP  + V  ISK+S  V   PP  DGG+ I +Y+++  D    S  WS V     K   S +V NL     Y FR  A N  G+ DP E        +D       PG   V+D      S +SC + W  P SDGG+ I  Y +++  +    WQ+  ++ +  ++             + K L EG EY FR+ A N+ G   PSE   +V+A+   + P L   G+ ++    K+   FR  I   G+PAPSV+W++    L  D+ R+S+E           NT L V    +S D G YTI L    GT++ T  + V+  P  P   +  DE+ AE + L WA P DDGG+ IT+Y+++  D  N  W+  A   + T   V  L  G  Y F V A NK G  E  ++ EPI A +P+  P  P  PNIVD  + SV+L W  P   GG PIT Y ++ K++    W  A KT        I   + ++ GL+EG  Y+FR++A+N AG   PS  ++P
Sbjct: 20658 NVNLR-DRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKS--WSTVTTECSK--TSFRVANLEEGKSYFFRVFAENEYGIGDPGE-------TRDAVKASQTPG--PVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEE-NKWQR--VMKSLSLQY------------SAKDLTEGKEYTFRVSAENENGEGTPSEI--TVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVE-------SSAVNTTLIVYDCQKS-DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKS-EPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTP-------IRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEP 21194          

HSP 7 Score: 242.662 bits (618), Expect = 3.023e-63
Identity = 178/559 (31.84%), Postives = 272/559 (48.66%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-----KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KR  +G Y I  +N  G       V +MD P PPK ++V+ I++ SC +    PDDDGG  IK Y+IE   +   +  W++V    G    +  V +L+++ +Y FR RA NR G+  P E + Q    +DP   PD P +  +   + N+  L+W  P++DGG+P+THY +E             W+Q    N  D+E          +  T + LVEG EY FR+KAVN  G S PS T   V  K +   P +       +E+++G          G P P++TW +       + + +  +    K V  +    L + ++ RS DTG YTI  + + GT      +NVL  P  P   +  + + A+ + LSW  P DDGG+ IT+YVI+  + +   W+  + E K+   T+  L  GH Y F ++A NK G  EP  + EP  A N +  P  P +P +      S+T+ W++P  DGG P+T Y ++ KD     +  +  D    +A    +  ++ GL EG  YQFR+ A+N AG    S  + P   R
Sbjct: 16809 KRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKA--WTKVNPDCGS--TTFVVPDLLSEQQYFFRVRAENRFGIGPPVE-TIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQ---CNKRDVE---------ELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIDLKEF--MEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLV-VDDTCTLVIPQSRRS-DTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDS-EPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRD--PIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATAR 17343          

HSP 8 Score: 242.276 bits (617), Expect = 4.131e-63
Identity = 190/657 (28.92%), Postives = 295/657 (44.90%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIM------DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++  RN  G  E +   N +      D P PP  + +T +++    +   PP+ DGG EI +Y+IE  D +S     +   +A+     S  V +++    Y FR RA NRIG+  P   +   + + DP + P  P   +  D + +S  L W  P  DGG+PI  Y IE  E+    W            I+ ++   P +     GL +GN+Y++R+ A NK G S PSE    + A   +++P +      + +E+         +   G P P+ TW   G  +L   DR+ ++  S    Y E    L ++ + RS D G YT+KL     T      VNV+  P  P+ L   +I  + ++L+W  P DDGG+P+T YV++  ++    W   M+   D + TV  L  G  Y F+V A NK G  EP    EP+    P   P  P+     D    S+ L W  P +DGG  I  YI+++  +    + A       C   + E +  + GL EGKWY +R+ A+N+ G S PS  T+          P I  D    +  T+K          V G+P P+ TW K  + +     + I  E     +T  +  SK    D GTY + A N  G+    +++ VLD
Sbjct: 14089 FRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL---SATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNW------------IRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATW-CFGDKVLETGDRVKMKTLS---AYAE----LVISPSERS-DKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVA-------CGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITI--ENVPKKSTVTIVDSKRS--DTGTYIIEAVNVCGRATAVVEVNVLD 14709          

HSP 9 Score: 240.736 bits (613), Expect = 1.148e-62
Identity = 176/563 (31.26%), Postives = 272/563 (48.31%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            L V N  R  SG Y + + N+ G     +NV ++D P PP+ ++V  ++K S  +   PP  DGG++IK+YI+E  +  S+   +S VA    K   S KV+ L     Y FR  A N  G+  P E +     +K   + P  PG+ +++D + NS  L+W  PE DGG+ I  Y +E + K    W     +  ++               T  GL++G EY FR+ A N+ G S P + S  V+AK   + P      ++N   +  G   + D+ F G P P+VTW ++ ++ L  + R++ E         E N++LT+  A R  D GHY +KL    G    T  V VLD P  P   +  DE+ A+ I LSW  P  DGG+ I +Y+++  D     W     T   + T+K   LK G  YQF + A N+ G+S    + EP  A+ P+K P  P  P +      S+ ++W +P  DGG  +  Y +++K++    W    KT        I + + +  GL EG  Y+FR+ A N  G   PS  ++ ++ R
Sbjct: 22843 LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRE--STRKAYSTVATNCHK--TSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAES---VKAS-ERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTE--------------ATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL--LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKD-NVPLKQTTRVNAE-------STENNSLLTIKDACRE-DVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATV-ARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTP-------IPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVAR 23363          

HSP 10 Score: 240.736 bits (613), Expect = 1.230e-62
Identity = 189/663 (28.51%), Postives = 304/663 (45.85%), Query Frame = 0
Query:  585 SYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP----FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWER-NGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++I+  N  G  E L +  ++ K     PD PK  EVT ++K+S +V    P  DGG+EI  Y++E  D      +W++       G   ++V  LI  H Y FR  A N  GLS+P   S       DP  +P  P  P V+D + +S  L+W+ P  DGG  I  Y +E  + S+G W        +N ++IE++               L+E +EY FRI A+NK G    ++    ++ + +   P     L    I N  I+ G + R  +   G P P V W + +G +     D   I++ S         T L +   NR  D+G YT+ L    GT+ A   V VLD P  P  L   EI  + ++++W  P  DGG+ I +Y+++  +     +   +      +  +  L+ G  Y F V A N+ G   P +T +PIK     +PP    +  + D    SV+L W KP  DGG  I  YI++ + K    W +          AR+  L+A I  L++G+ Y FR++AVN+ G S P     P + +   + P + K + SS +++V +    ++ + G P P  TW K+G+ +  T  + +T           L + ++   D G Y +   N  GQ    ++++ LD
Sbjct: 23635 TFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRD--KEGIRWTR-CHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKAC-DPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEK--------------LLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIIN--IRAGGSLRLFVPIKGRPTPEVKWGKVDGEI----RDAAIIDVTS-------SFTSLVLDNVNR-YDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPG---KITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSEC---------ARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV-KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT----DSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLD 24248          

HSP 11 Score: 238.424 bits (607), Expect = 5.732e-62
Identity = 192/643 (29.86%), Postives = 290/643 (45.10%), Query Frame = 0
Query:  522 SGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINF--------------------HGDRVDLN--------VINP-KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ-GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDK-FGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            +GV+      G   A + + +  ++LS FKDG EV V   + I                       GDRV +         VI+P +R   G Y + + N        I+VN++ +P  PK ++   I+K+S  +   PPDDDGG+ +  Y++E  +VS  +  W++V   D        V +L+    Y F+  A N+ G  +P  +  + + +  P   PD P      D ++NS  L W  P++DGG+ I  Y +E   +    W   GE +  + +E+               GL EG  Y +R+KA+N+ GAS PS  ++ + A      P  FL    +  + +K G          G+P P +TW +   ++L    RI+IE   KK+        +T+  + RS DTG Y I+ +   G   A   VNVLD P  P   +  ++  E   L+W  P DDGG+ IT+YV++    D+  W     T KDT      L P   Y F V A N  G  EP +   PI A+  + PP  P      D    +VTL W +P DDGG PIT Y +++ D     W    K         + +   R+ GL+  K Y+FR++A N AG   PS  T+P L +
Sbjct: 14299 AGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKT--WTKVM--DFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVD-EPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVT--------------GLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTK-ADMILKQDKRITIENVPKKST-------VTIVDSKRS-DTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQA-SPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMP-------VKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIK 14905          

HSP 12 Score: 238.039 bits (606), Expect = 7.959e-62
Identity = 183/639 (28.64%), Postives = 283/639 (44.29%), Query Frame = 0
Query:  608 KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMV---HGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNG---SLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS-----FETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +PDPP   EVT +SK    V  +PP+ DGG  I  Y +E  +    S +W  V ++     + +KV NL+  H Y+FR +A N IG+ +P  +  + ++ KDP + P  P    V+D + +S  L W  P  DGGAPI  Y +E + K         I + S  E     N    +     T   L E  EY FR+ A N+ G   P+E  +++  K     P +         + ++ G   R      G PAP VTW + G    +  G  D +    F            L +  + R  D+G Y++ L+   G +     V VLD P     L   ++     ++SWA P +DGG+ +T Y+++  + D   W     E K T   V  L PG+ Y F V AVN+ G   P    +P+ A +P   P  P++  + +    S TL W  P  DGG  I  YI   ++      +    D  +  + + +L   + GL EGK Y+FR+ A N  G S P      +E K  L   K L P          TIK  +    +  V G+P P   W K   ++ ++  + +    ++  +++ L +      D+G YSL AEN +G D   + ++V+D
Sbjct: 19325 RPDPP---EVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKE--KHSTRWVPVNKS-AIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPS-LPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPK---------IADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF------------LVIPNSTRD-DSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYRE------EEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP-------EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV----HKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 19917          

HSP 13 Score: 235.728 bits (600), Expect = 4.748e-61
Identity = 171/563 (30.37%), Postives = 261/563 (46.36%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            L V N  R  +G Y + + N  G       V ++D P PP  I    +++ S  +    P  DGG  I HY++E  + S  S  W  +++   +  +  KVN+L     Y FR  A N  G+ +P+E+    +      ++P  P R  V+D S +S  LAW  P+ DGG+ IT Y +E ++K    W               +      +  T + LVE  EY FR+KA N  G S P E   SV+ K   ++P     GI N  I  K G  F  D+   G PAP VTW+    + L ++DR+SI     +T    K+++          D+G Y + L    G +  +  V V+  P      +    + AE   LSW  P D GGT IT+Y+++  +     W L     K T+  V  L     Y F V + N+ G S+P  +  PI AE+P+ PPS P  P +      ++++RW++P  DGG  I  Y ++KK++    +  +K +   C     E   ++ GL EG  YQFR  A+N AG S  S  ++P + ++
Sbjct: 29340 LTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRS--WQVISEKCTR--QIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVAT----EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW--------------VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLE-EMRLKETDRVSITTTKDRTTLTVKDSMRG--------DSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA-PIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILW--VKENKVPCL----ECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN 29864          

HSP 14 Score: 234.187 bits (596), Expect = 1.246e-60
Identity = 202/659 (30.65%), Postives = 289/659 (43.85%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEIS----GQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L     + VN    PDPPK  EVT I+K+S VV    PD DGG+EI +YI+E  D   +  +W +  +      +  KV+ L   H Y FR  A N  G+S P   S      D + K     P  PG P VLD S +S  +AW  P  DGG+ IT Y +E        WQ           I T   G      T  GL E  EY  RI A+N  G   P+    +  A+ R L P +         + I+   T R  +   G PAP V W R+    L   D+ SIE  S         T+L V   NR  D+G Y + +    G++ A   V VLD P  P+ L   E+    + L+W  P  DGG+ I +Y+++  +     +   A     T   V  L+ G  Y F V+A N+ G   P  T E +KA    + P  P +  ++D    SV+L W+KP  DGG  I  YI++ + K    +       A+C A +   EA I GL +G+ Y FR+ A N+ G S P   + P + +   + P+  K   ++ T+         +   G P P  TW+K+ + +  T  V     E     T K    +    D G Y +   N  G+    L++IVLD
Sbjct: 22554 FRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRD--KAGQRWIKCNKKTLTDLR-YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFK-----PGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQ-----------IVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL---DKASIESTS-------SYTLLIVGNVNR-FDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS---ERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW-------ATC-ATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAF-KLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE----DVGHYVVKLTNSAGEAIETLNVIVLD 23166          

HSP 15 Score: 233.802 bits (595), Expect = 1.699e-60
Identity = 193/657 (29.38%), Postives = 297/657 (45.21%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+  N  G  E L +  ++ K     P PPK++EVT+I+K+S  V  + PD DGG+EI  YI+E  D   S  +W +  +      + ++V  L   H Y FR  A N  G+ +P   S   +  K  DP  +P  P    ++D + NS  LAW  P  DGG+ I  Y +E  +     WQ           I T   G  +       L E  EY  R+ A+NK G    +    +V  + +   P L         I ++ G + R  I F G P P +TW R        +D++ IE   K   Y    T L++   +R+ D G Y +KL    G++ A   V VLD P  P+ L   E+R +   L W  P  DGG  + +YVI   +     +   + +   T   V+ L  G IY F V+A N+ G   P  T++ +KA    +PPS P +  + D    S +L W+KP  DGG  +  Y+++ + K         T+  S  A      A + GLS G+ YQFR+ A N+ G+S P     P + +   + PS+ K   ++ +I+       +I V G P P  +W K+G  +  T  V +     +   +  L + +    D G Y++ A N  G    +L +IVL+
Sbjct: 24718 FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRD--RSGIRWIKCNKRRITDLR-LRVTGLTEDHEYEFRVSAENAAGVGEP---SPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQ-----------IVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEF---TDKVQIE---KGVNY----TQLSIDNCDRN-DAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAA---EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPK--------GTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSL-KLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE----ETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLE 25330          

HSP 16 Score: 232.261 bits (591), Expect = 5.111e-60
Identity = 178/564 (31.56%), Postives = 258/564 (45.74%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQG----FDERLINVNI-MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX-AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            R  + +   K      ++I   N  G     D + + V     +P PP T  VT ISK+  +V+   P +DGGT+I  Y +E  +   +S  W ++ +   +  K  K   L     Y F+  A N +G+  P ++S +  + +DP D    PGRP  +  + N+  L W  P  DGG+ IT Y +E K+   G W +    N  + E             T  GLVE   Y FR+ A N  G  S PS++S ++ A+     P       Y   I +  G TF  +    G+P P V W ++G  L   + R+ I+   +KT    K+ + T        D G Y +KL   GGT+     V VLD P  P   L    + AE   L+W  P  DGG  I+ Y+I+  +     W   + E +     V  L PG+ Y F V+AVNK G  EP  +  P+ A NPYKPP  P  P +      S+ + W +P DDGG  I  YI++K+DK G  W          C  + + +L  R+ GL+EG  Y+FR+ A N AG   PS
Sbjct: 25388 RTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKE--KNSILWVKLNKTPIQDTK-FKTTGLDEGLEYEFKVSAENIVGIGKPSKVS-ECFVARDPCD---PPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEF------------TVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRT--------DGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLES-GPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRW--------TKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPS 25915          

HSP 17 Score: 229.18 bits (583), Expect = 5.333e-59
Identity = 182/646 (28.17%), Postives = 287/646 (44.43%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT-----VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKV--NRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            E ++  N    P PP   E     K   +++ + P+ DGG EI +Y+++  +    S +W++V +        +KV +L+    Y+FR  A N  G S+P E S   I  ++P   P  P  P V+D + +S  LAW  P  DGG  I  Y +E +EK    W +   ++T+     T+         T   L  G +Y FR+ AVN  G S  SE+   +    R   P L         + I+ G + R  +   G P P +TW + G           I+L S+  +   E  ++L V K NR  D G YTI+     G + AT  V V D P     +   E+  + + ++W  P  DGG P+ +Y+++  +      + A +T  TK +     + GL  G +Y F V+  N  G  EPC T + +      + P  P +  +VD    +VTL W+KP  DGG  +T Y+++  K     W   +             LE  +  L+EG+ Y FRI A N+ G S P         +   + P+ID  +   KTI V   R     I + G PPP  +W+  G ++  ++ V +          AKL + ++ + D G Y+L  +N  G     + +I+LD
Sbjct: 30156 EPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKRE--KKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNF-ISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYR---VHTNATIRNTEF--------TVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQG-----------IDLASRAIIDTTESYSLLIVDKVNR-YDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAA----MRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVS---EVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTV-------LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHT----KVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD 30757          

HSP 18 Score: 228.794 bits (582), Expect = 6.278e-59
Identity = 156/546 (28.57%), Postives = 264/546 (48.35%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            L + N  R  SG Y + + N  G     +NV ++D P  P  + +  + K+S  +   PP  DGG +I +YI+E  +  ++   ++ +     K   + ++ NL     Y FR  A+N  G+  P E + + + + +P   P  PGR +++D + N+  + W  PESDGG+ IT Y +E + K    W       ++  ++KT       +  T  GL  G EYVFR+ AVN+ G S P +    V+A+   +KP +  P  +   +K     + D+ F G P  +V W ++G   L ++ R+++   S KTV     T L++ +A++  D G Y + +    G+      + VLD P  P  +  DE+  + I +SW  P  DGG  I++Y+++  +  +  W + +     T   +  L  G  YQF V A N+ G+S    +   + AE P+ PP  P  P +V     ++ + WQ P +DGG  +  Y ++ K++    W  A K         I + + ++ GL EG  Y++R+ A N AG
Sbjct: 26090 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRE--TTRKAYATITNNCTK--TTFRIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKVSEP---PLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKW-------STCTQVKT-------LEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELP-FHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQ-TLKETTRVNVS--SSKTV-----TSLSIKEASKE-DVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSES-SAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKI-------LIADTQMKVSGLDEGLMYEYRVYAENIAG 26595          

HSP 19 Score: 227.254 bits (578), Expect = 1.698e-58
Identity = 188/614 (30.62%), Postives = 281/614 (45.77%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS---IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPF-LHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQ 1221
            V++++KN+  V    P DDGG+EI  Y +E  +    S +W +      K P S    KV  L     Y FR  A NR G+  P E S   +++KD    P  P  P V D +  S  LAW  P  DGG  IT Y +E+++     W    I +T+   ++       +       L    +Y FRI A+N  G   P+   D  + +      F L       + ++ G + R  +   G PAP VTW ++   L    +R +IE         E  T+L + + NR  DTG + + +    G +     V VLD P     L P +I  + + L W  P  DGG+ IT+Y+++  +     +  A  TK  K T  V GL  G  Y F V+A N+ G  EP  T EP+KA    + PS P   NI+D    +V+L W KP  DGG  IT Y+I+ + K    +  + T        +  LE  +  L+EG+ Y F+++AVN AG S+P  E++P + + + + P +D      K +  K       +I V G P P  TW K G QI    +    R  ++  AT+  L +++    D+G Y L A N  G+
Sbjct: 21507 VSNVTKNTATVSWKRPVDDGGSEITGYHVERRE--KKSLRWVRAI----KTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEAS-DSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAW----IKDTTGTALR-------ITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL---KNRANIE-------NTESFTLLIIPECNR-YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTAT-TKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKAS---EAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITT--------VKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTW-KKGDQILKQTQ----RVNFETTATSTILNINECVRSDSGPYPLTARNIVGE 22073          

HSP 20 Score: 224.557 bits (571), Expect = 1.198e-57
Identity = 197/638 (30.88%), Postives = 285/638 (44.67%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQA--DGKGPKSIKVN--NLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ--KKDKFGGWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA---TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            P PP   +V   +K S +V  +PP D+GG+ I  Y +E  +    S  WS+V++A     G K ++ N   L+   +Y+FRA A N  G+  P E S  ++   DP   P  P  P V D + +S  L W  P  DGG+PI  Y +E +E+    W++   +N  D  I T              L E  +Y FR+KAVN+ G S PS+T+  + A     +P  F+       +  K G   R      G P P  +WE +G       D +       +    E ++V+ + +  RS  TG Y+I      G + A   V V+DVP  P+ L   +I      LSW  P DDGG  I  YVI+   ID   W     +   T   V  L     Y F V A N+ G   P  T++   A +P  PP  P +  I      +V L W+ P +DGG P+THYI++    D  G   +A +     C  R ++EL+  +  L EG  Y+FR+ AVN AG S PS    P   + +   PSID  +     +   VN  A    K+KG P P  TW+K   +     E ++            T  L + +S+  D G Y++ A N  G    ++ L VL
Sbjct: 16526 PGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKRE--EGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVA-GDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKR---VNEPDKLITT-------CECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRS-HTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWR----QCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVTVKDQTCPPSIDLKEFMEVEEGTNVNIVA----KIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL 17141          

HSP 21 Score: 224.557 bits (571), Expect = 1.283e-57
Identity = 163/577 (28.25%), Postives = 273/577 (47.31%), Query Frame = 0
Query:  564 INFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDP---WDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRI----SIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            I+       L + N  R  SG Y + + N+ G     + V ++D P PP  ++VT I+K+S  +   PP  DGG++IK+YI+E  + +  S  ++ V     K   S K++ L     Y FR  A N  G+  P + +       DP    + P  PG+ +V D + NS  L+W  PE DGG+ I  Y +E + K    W +   + +              +      L +G EY+FR+ AVN+ G S P   +  ++AK   ++P + +P   +  ++ G+  + ++   G P P++TW ++G L L  + RI    S++L           T L++ + ++  D G Y I +    G + A+  +  LD P+ P+  +  D++ AE I LSW  P   GG  IT+Y+++  D     W + +     T   V  LK G  YQF + A N+ G+S    + +PI A+ PYK P  P  P        S+ ++W +P ++GG P+  Y +++K++    W    KT        I + + +   L EG  Y+FR+ A N  G    S  ++ ++ R
Sbjct: 23916 IDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKN--SWKIDQLQEGCSYYFRVTAENEYGIGLPAQTA-------DPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKS--------------LQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV-KPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDG-LPLKQTTRINVTDSLDL-----------TTLSIKETHKD-DGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-DPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTI-------IHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 24445          

HSP 22 Score: 224.557 bits (571), Expect = 1.339e-57
Identity = 171/520 (32.88%), Postives = 243/520 (46.73%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSD-RISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            P PP T +VT ++K+S  +    P  DGG+ I  Y +E  +   +   W  V++A   G    K + L +   Y FR  A N  G S P + S + ++  DP D    PG+P  L+ + ++  L WA PE  GG  IT Y +E ++   G W +    N  + E             T  GL E   Y FR+ A N  GA S PSE SD++  +     P +     +   + +K G  FR +    G P P++ W ++G  L G +   I I  FS   V           K +   D+G YT+     GG  +    V VLD P  P   L   E+ +E   LSW  P DDGG  I  Y+++  +     W   A E + TK  V  L  G+ Y F V+AVNK G  EP  + EP+ A NPY PP  PK P +      S+ + W  P  DGG  I +YI++++DK G  W    K         + +L  ++ GL+EG  Y+FRI+A N AG S+PS
Sbjct: 22186 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKE--RNGILWQTVSKALVPG-NIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPS-EPMLALDPID---PPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEF------------TVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLV----------NKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLES-EPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNK-------KTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 22668          

HSP 23 Score: 223.016 bits (567), Expect = 4.108e-57
Identity = 169/559 (30.23%), Postives = 263/559 (47.05%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK-SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  +G + + I N  G     +NV ++D P P   +  T I+K+S  +    P  DGG+ I +YI+E  + +  S      + A  K  K + KV  L     Y FR  A N  G+ +P E +       +P    + P  P   +++D + ++  LAW  P+ DGG+ IT Y IE + K    W              T V G   +    + L EG EY F++ AVN  G S P E S  V+ K + + P L   GIY   +  K G   + +I   G P P+VTW++ G  +L  + R++ E  +        +T+L + +  RS D+G Y +      G       + V D+P  P   +  DE+ ++ +  SW  P +DGG PI++YV++M   D+  W+  + T   + T K   L  G  YQF V A N+ G   P  T   I A  P+K P  P  P +      S+T+ W +P  DGG PI  Y +++K++ G  +  +       +A +     +  GL++G  Y+FR+IA N AG+S PS  ++P L 
Sbjct: 21766 RYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS-----YSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETT-------EPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTH-----------ITTVKG---LECVVRNLTEGEEYTFQVMAVNSAGRSAPRE-SRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK-GDQILKQTQRVNFETTAT-------STILNINECVRS-DSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVE-LATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTV------SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLA 22280          

HSP 24 Score: 222.246 bits (565), Expect = 6.922e-57
Identity = 168/586 (28.67%), Postives = 284/586 (48.46%), Query Frame = 0
Query:  555 EVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTH-ISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            E  + Q+  I        + + N +R   G Y ++ +N  G  ++ I V+++D P P  T  + H ++  SC +    P+DDGG+ I +Y+IE  +  S    W+ V     +  ++  V  LI    Y FR  A N IG+  P   + + ++I++P   P++P    V + + N+  L W  P+ DGG+ I +Y +E   + +G  +  ++ N + +  K           T KGL EG+ Y +R+ AVN  G   PS  +  +  K     P LH      + I+ G  F     + G+P P V+W ++ + +L D DR  I+  +  T+  EK       KA RS D+G Y + +    G+++    VNV+D P  P   ++ DE+  +++ +SW  P DDGG+ IT+Y+I+  ++    W+     +  T   V  L  G  Y F + A N  G S+P  + + +KA++ ++ P  P +P + +    S  + W KP  DGG+PIT+YI++K++     +  +  D      +      R+P L EG  Y+FR+ A N+ G   PS  +KP   +     PS
Sbjct: 17489 ERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRE--SDRRAWTPVTYTVTR--QNATVQGLIQGKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLE--SRLIGTEKFHKVTNDNLLSRKY----------TVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLED-DRTHIKT-TPATLALEK------IKAKRS-DSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVS-DSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKF-----RVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPS 18041          

HSP 25 Score: 221.861 bits (564), Expect = 8.074e-57
Identity = 185/648 (28.55%), Postives = 290/648 (44.75%), Query Frame = 0
Query:  606 MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLD---------VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECE 1238
             D P PP  +E + I+K++  +    PDDDGG+ I  Y +E +D    +++W +  +   K   + +V  L NK +YRFR  A N  G   P + S + I+IKDP D P  PG+P+V D    S  L W  PE DGGA I  Y I             E+L T   E      G P       GL+EG EY FR++AVNK G S PSE SD VL + +   P   +   + NI  K     ++ +    GG P  +   E+       D  R   +     TV   K TV  +T+ +       Y  ++  +    Q+  Y  + D          P  P  L   ++   H++L W  P +DGG PI  YVI+  +     W+ A +T   D    V  +  G   QF+V A N+ G   P    E +  E+P  PPS P + ++ D   + + + W+ P  +GG PI  Y ++        W           + +++E      G+   K Y  R+ AVN  G S PS  ++  + +  +  P+ID  +     I+  + +I  +  +  P P  +W+K+G ++ ++D + +  +      +A L V KS   DAG Y++  EN+ G     +++ V+ L   C+
Sbjct: 14807 FDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLD--PDTDKWVRCNKMPVKD-TTYRVKGLTNKKKYRFRVLAENLAGPGKPSK-STEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVI-------------EMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINI-TKNTADLKWTVPEKDGGSPITNYIVEKR------DVRRKGWQTVD-TTVKDTKCTVTPLTEGSL------YVFRVAAENAIGQS-DYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEE------GVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSI-PVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHI----SAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCK 15411          

HSP 26 Score: 218.394 bits (555), Expect = 9.464e-56
Identity = 191/659 (28.98%), Postives = 291/659 (44.16%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKP-RXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I+ +N  G  E L        N+   P  P    V+ +++NS  V    P+ DGG+ +  Y +E  D  ++S +W +V +   K      S KV  LI    Y+FR  A N  G+  P  +       +DP   P  P    V DW+ +S DL W+ P  DGG+ +T Y +EYKE+              +     +V G  +V     GL EG  Y FR++AVN  G   P E +D +  K R + P L         I +  G   R   +  G+P P+VTW  N   L  ++   +IE  +  +    KN         RS   G Y++    + G ++ T  V+VLDVP           +  E   L+W +P DDGG+PIT+YVI+  + D   W     T   + ATV+GL  G  Y F + A N  G      T E +    P   P  P++  + +    +VTL W  P  DGG  I +Y+++ +      F  +  D+      +   +  + GL EG  Y++R+ AVN  G+  PSF TKP  C+ +   P++        TI+V        +  G+P P+ +W+K+   +   D   I        AT  L   K++  D+G Y +V EN  G  K    + V+D
Sbjct: 17216 FRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD--TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVG-PASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGK---------EEWEKGKDKEVRGTKLV---VTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAISSSMVIKN-------CQRS-HQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDN------LLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIK----TTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD 17837          

HSP 27 Score: 216.468 bits (550), Expect = 3.525e-55
Identity = 189/633 (29.86%), Postives = 283/633 (44.71%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY-------NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGA-TAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P PP    VT I++N+  V  + P  DGG+ I  Y +E  +V+    + ++   AD K     +V  L   + Y FR  A N  GLS P   S   I    P   P  P  P + D S  + DL W  P SDGG+PI  Y +E ++     W +   +N  ++ I+      P       GL+EGNEY FRIKA N  G   P E ++SV+AK       LH P +         I ++ G+T R      G P P +TW + G +L+ +     I+   +          L + +A R+ D G Y I      G  Q +  VNVLD P   + L    +  E+  +SW  P D+GG+ IT+++++    +   W   + +  TK  +K  L   + Y F V A NK G      T  PI A NP   P EP+  +I D     V L+W++P  DGG P   Y ++++ K  G  D  +    S    I E    +    E + Y+FR+   N+ GES    +T+  + +     P +D   S   T+K   T   +  V+G+P PE  W K+     +TD     R +    A ++K  ++K++  D G Y + A N  G       + VLD
Sbjct: 18631 PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLK----FRVTGLYEGNTYEFRVFAENLAGLSKPSP-SSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNR---INKDEL-IRQCAFRVP-------GLIEGNEYRFRIKAANIVGEGEPRELAESVIAKD-----ILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPR--------VELQIKEAVRA-DHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGW-SIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLK--GSDDWERVHKGS----IKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDK---DATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLD 19222          

HSP 28 Score: 214.157 bits (544), Expect = 2.045e-54
Identity = 159/563 (28.24%), Postives = 259/563 (46.00%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            V I    +   L++ N  R  +G Y + + N+ G     + V ++D P PP+ + V  + K+S  +   PP  DGG ++K+Y+I+  +  S+   ++ V+    K   S KV NL     Y FR  A N  G+  P E +   +   +P   P  PG+ ++ D S  S  L W  PE DGG+ +  Y +E + K    W    I+  S +            +    GL  G EY FR+KA N+ G S P      V+AK   ++P L  P      I+ G   + +I   G P P+++W ++G   L  + R+++E  +        +TVL + + N+  D G YT+      GT      V VL+ P  P   +  DE+ A+ + +SW  P   GG  I++Y+++  D     W + +     T   +  LK G  YQF + A N+ G+S P  + + +  + P+K P  P  P +       + ++W +P +DGG  I  Y +++K+K    W    KT        I + + +  GL EG  Y+F++ A N  G   PS
Sbjct: 24996 VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRE--STRKAYANVSSKCSK--TSFKVENLTEGAIYYFRVMAENEFGVGVPVE-TVDAVKAAEP---PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWS---IVAESKV-----------CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLP-FNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGE-PLKQTTRVNVEETA-------TSTVLHIKEGNKD-DFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDS-KAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTP-------IQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPS 25518          

HSP 29 Score: 210.69 bits (535), Expect = 2.152e-53
Identity = 169/570 (29.65%), Postives = 259/570 (45.44%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIK--VNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL--------LGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP 1136
            +++   N  G  E L +  ++ +     P  PK   VT ++K+   V    PD DGG+ I  Y+IE  +   +S  W    +A+    +S +     L+    Y FR  A N+ G S P + + + +  + P D    PG+P V+D + ++  L WA P+ DGG+ I  Y +E  +     W +    NT+  +I       P    T  GL E  +Y FR  A      S PSE SD V      + P +         + +K G     D    G+P P+V+W+++G+LL            +  ++ELFS                 NR  D+G YTI      G++ AT  + VLD P  P  +  +++ ++   LSW  P +DGG+ IT+Y++   +    +W     T   T  +V+ L  GH YQF + A NK G  +P  T EP  A+NPY PP     P I +     +T+ W+ P+DDGG PIT Y+++K++     W    +         I E   +  GL EG  Y+FR+ A+NKAG   PS  +K    R     P
Sbjct: 19991 FRVRAENRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKE--RNSLLW---VKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPT-EYVTARMPVD---PPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVR---CNTAPHQI-------PQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFS----------------VNRK-DSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT-EPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKP-------IIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 20516          

HSP 30 Score: 209.92 bits (533), Expect = 3.713e-53
Identity = 176/602 (29.24%), Postives = 274/602 (45.51%), Query Frame = 0
Query:  537 VEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQ--WSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ---GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLL-LGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            V+G  + DI  +  K+GK +   + V++     RV+L +    R   G Y I  +N+ G  +    VN++D+P P + ++VT+++K +C +    P D+GG+EI ++I+E        NQ  WS VA    K  + IK N L N + Y FR  A N++G+  P   +   I+  +P D P +P    + D       L W  P+ DGG+P   Y +E + K    W++   G I  T               H      VE   Y FR++  N+GG S   +T + V+ K    KP L       + +K G T R +    G+P P V W ++     L  S R+ I+  +  + +       ++TKA RS D G Y +      G+  A   VNVLD P   R L   ++ ++   + W  P DDGG  I +Y+++  +     W     T  T   TV  L  G+ Y F V A NK G   P  + +P+ A+  Y  P  P  P +     + +T+ W  P  DGG+ IT Y ++KK+K    W    K       + I E   ++  L     YQFR+ A N+ G   PS  ++P + +
Sbjct: 18859 VKGRPEPDITWT--KEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY----RKPNQKGWSIVASDVTK--RLIKANLLAN-NEYYFRVCAENKVGVG-PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET---------------HYMVDRCVENQIYEFRVQTKNEGGESDWVKT-EEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKF-------SLTKAKRS-DGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTES-KPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNK-------SAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAK 19418          

HSP 31 Score: 209.534 bits (532), Expect = 5.090e-53
Identity = 190/670 (28.36%), Postives = 288/670 (42.99%), Query Frame = 0
Query:  586 YKIIIRNAQG-----FDERLINVNIMDKP---DPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP---KSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI---LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQP-GIYNIEIKK------GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KG-SSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            ++I   N  G     F E  I  N  D P   DPP    +++I+K+   V   PP DDGG+ I  Y++E  +  + +  W++V     + P   +++K   L     Y FR  A N+ G   P + S +    +DP   P  P  P V D + +S  L+W  P  DGG+PI  Y +E K      W +  +   L  +  E+               GL+E  +Y FR+ AVNK G S PS+  D       Y K  L  P G  + +++K      G T R  +   G P P +TW +    L    DRI +++ S      + +T L     N+  D G Y + L    G ++ T  V VLD P  P  +   EI  +   ++W  P  DGG+PI +YV++  D +   W     E   T   V  L+ G  Y F V A N+ G  +P  T + +KA     P  + K   +      S ++ W+KP  DGG  I  Y++    +   W   +K+      A+          L+EGK Y FR+ A N+ GE +PS  T   + R   + P +D KG        K N     +I +KG+P P  +W K    +A+   V +            L V   Q  DAG Y++  +N  G  +  + + V+
Sbjct: 20387 FRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPV---ISNITKDHMTVSWKPPADDGGSPITGYLLEKRE--TQAVNWTKV----NRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDAS-KAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEV--------------TGLMEDTQYQFRVYAVNKIGYSDPSDVPDK-----HYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL---RDRIGLDIKS-----TDFDTFLRCENVNK-YDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLK---VRSVSKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAK---------DLTEGKEYTFRVSAENENGEGTPSEITV--VARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE----SSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV 21000          

HSP 32 Score: 209.149 bits (531), Expect = 7.218e-53
Identity = 164/574 (28.57%), Postives = 267/574 (46.52%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRY---LKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDN--GDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            V I+  G + +L + +  R+  G Y I   N+ G       V + D P P   ++    ++  C++  S P+DDGG+EI  +IIE  D  +  + W Q  + +        +  L+    Y+FR  A N+ G   P EI    I+  DP   P  P R +  + + ++  L W  P S+GG+PI  Y IE +             +  D E + +    P      + L E   Y FR+KAVN+ G S PS   + V+        +K  L   G   I++K G          G P P + W +N +++   +D  ++++  ++    E  T L++ KA R  D G YT+      G+     +V V D P  PR L   +I+AE   L+W  P D+GG+ IT YVI   D      +W     T  + +  +  L P   Y+F V AVNK G S+ C++ + +  ++PY+ P  P +P ++     S+ + W  P D+GG PIT Y ++K+++   ++  +     + +  +  +E  +P L EG  YQFR +A+N AG   PS  + P + 
Sbjct: 16077 VVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKD--AKMHTWRQPIETERS---KCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG--PILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRH-----------DKPDFE-RVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRG-DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTD--ALQITKEEVSRSEAKTELSIPKAVRE-DKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKS-DKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPIT-KVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVA 16625          

HSP 33 Score: 207.608 bits (527), Expect = 2.076e-52
Identity = 187/666 (28.08%), Postives = 296/666 (44.44%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIG---LSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-------YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF-GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            +++   N  G  E L + +++ K     P PP   EVT I+KNS  V  S P  DGG++I  Y +E  D    S  W +V +   +  +  KV  L     Y++R  A N  G    S+P E         DP D P  P +  + D + +S  L W+ P  DGG+ +T Y +E +        QGE    + +  K +V     V      L  G  Y FR+ AVN  G   P E ++ V AK       L  P I        ++  K G   +  I F G P P+VTW R     LG   R SIE         + +++LT+ +  R+ DTG Y + +    G  + +T  V VLD P   + L    +    + L W  P  DGG+PI +YVI+  D     W + + +   T   +  L     + F V+A N+ G  EPC T EP+KA    + P+  ++ ++ D    SV L W KP  DGG  IT Y++++K K    W  A  +   +CE  + +L+       E    +FR+ A N+ G S P     P   +   +TP +D      +  T+++      ++  KG+P P  +W K+G+ +  ++ V  ++ E +      L +  ++    G Y+++ +N   +    + +I L
Sbjct: 27965 FRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRD--KKSLGWFKVLKETIRDTRQ-KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKA----ADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIR--------QGEEEEWTTVSTKGEVRTTEYV---VSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKD-----ILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDEKNLGSDARYSIE-------NTDSSSLLTIPQVTRN-DTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAA---EVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISK--TCEIEVSQLK-------EQSVLEFRVFAKNEKGLSDP-VTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENK----ITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITL 28581          

HSP 34 Score: 206.838 bits (525), Expect = 3.674e-52
Identity = 164/569 (28.82%), Postives = 248/569 (43.59%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESE----PCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  L + N  R  SG Y + I+N        + V ++D P PP  I V  ++K S V+    P++DGG  +K+Y IE  +  +S   W  V     +   S KV NL     Y FR    N  G+  P E + + + I +    P+K G  S+   S +S  L W  PE DGG+ I HY +E  EK    W +  +  ++              H    GL E +EY FR+ A N+ G S P E    VL K +   P +       + + ++ G   + DI   G+P P VT  R+G + L  + R + E+ ++      K +V        + D G Y I      GT +A   + VLD P  P   +   +I  E + L W  P  DGG+ +T+Y++   +     W     T   T   V  L  G  YQF + A N+ G S+     C T+     + PY  P  P  P + +   +S+T+ W +P  +GG  +  Y ++ KD+    W  A K         I     ++  +S G  Y+FR+ A N AG   PS  ++P L 
Sbjct: 27166 RTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKRE--ASKKAWVSVTNNCNR--LSYKVTNLQEGAIYYFRVSGENEFGVGIPAE-TKEGVKITEKPSPPEKLGVTSI---SKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKST--------------HHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDG-VPLKATMRFNTEITAENLTINLKESV--------TADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTV-----KLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANK-------LVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLA 27691          

HSP 35 Score: 206.453 bits (524), Expect = 4.319e-52
Identity = 161/586 (27.47%), Postives = 261/586 (44.54%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI-KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI 1158
            R  +G Y I   N  G     + V + D P P  +++V  +S++S  +    P  DGG  + +YI+E  + +  + +         K  K++ +++ L+    Y FR    N  G+ +P E S   ++ + P      P +  V+D + ++  LAW  P  DGG+ +T Y +E  +     W +   L  + +E             T   L EG +Y+FRI+A N+ G S P ET  +V  +   + P +    +    I +  GR     I   G P P+ +W   GS L  +S+R+++E  +K      + T +         DTG YT++L    GT   T  V +LD P  P   +  DEI A  I +SW  P  DGG P++ YV++  D     WL   E+  T++T K   L  G+ Y F V A N+ G     ++ E I+  +  + P  P+   I D     +TL W  P DDGG  +T YI+++K+ +   W    K         +     R  GL+EG  Y+ R+ A+N  G   PS  +KP +       P   +    + T + + +  W +
Sbjct: 30436 RYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFK-----TVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPL----VPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLE------------HTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR-ESERVTVETHTKVAKLTIRETTIR--------DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESV-TRSTFKFTRLTEGNEYVFRVAATNRFGIGSYLQS-EVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVP-------VTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSV 30982          

HSP 36 Score: 206.068 bits (523), Expect = 6.612e-52
Identity = 181/632 (28.64%), Postives = 268/632 (42.41%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHG--TCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKV--KGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            PD P   E ++I+ NS  +  + P+ DGG+EI+ YI+E  +    S +W +V           KV  L   + Y F   A N  G+     IS + I  ++P + P  P    V D S  +  L W+ P  DGG  I  Y IE  +  +G W +              VN +  V    T   L  G EY FR+ A+N  G     E + ++ A  R   P L     +     ++ G + R  I + G P P+  W +  S L   +D  + + FS           LTV   NR+ D G YT+ +  + G++  T  V VLD P  P  +   ++      L W  P  DGG  I  YV++  +     W    E K T+   K   L  G  Y F V AVN+ G  EP    EPI A    + P+ P+  ++VD    S  L W KP  DGG  IT Y+++ + K    W +A  T          +L   +  L E   Y+FR+ A N AG S P       + +   + P+ D    +++ I     + + I V   G P P+ TW    +++  TD V IT  + +   T K     S   D+G Y L  EN  G     + ++V+
Sbjct: 29079 PDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE--KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGIS-RLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHK--------------VNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFS----------TLTVENCNRN-DAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISE-KCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVAT---EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT---------KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVK----DSMRGDSGRYFLTLENTAGVKTFSVTVVVI 29665          

HSP 37 Score: 205.682 bits (522), Expect = 9.061e-52
Identity = 172/603 (28.52%), Postives = 278/603 (46.10%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS------VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY---NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT---VYCEKNTVLTVTKANRSIDT------------------GHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD--WLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            +S  KDGKEVK    + +        L V    R  +G Y I + N  G     INV ++  P P K I+ + I+K+SC +   PP+ DGGT I HY++E       + + + +    G+   S  V +LI    Y FR +A N++G        G+ I +K+P    D    P       V + ++ +  + W  P  DGG+ I  Y IE   K    W+            + + +  P++  T KGL EG EY FR++A N  G S PS  +      T+ + P +  P +    ++E+K+G     D    G P P++TW ++ ++++ +  +       ++    V  E+  VL +T+   SID                   G Y IK+  D G  +A   V+VLD P  P     ++IR   +   W  P DDGG+ I +Y ++  D    D  W+    T +  K +V  L  G  Y F V A N+ G   PC + +P+ A++P+ PP  P +P + D  + S+ ++W +P D+G  PI  Y ++K++     +  +       ++ ++ L+A + GL EG  Y FR+ A N AG
Sbjct: 15345 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLE----RREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVG-------GGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWK------------RCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRAT----PPTKAVDP-IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQ-RLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNGS-PILGYWLEKREVNSTHWSRVN------KSLLNALKANVDGLLEGLTYVFRVCAENAAG 15910          

HSP 38 Score: 205.297 bits (521), Expect = 1.252e-51
Identity = 165/559 (29.52%), Postives = 261/559 (46.69%), Query Frame = 0
Query:  604 NIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKP-FLHQPGIYN-IEIKKGRTFRYD-IWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            ++ D P PP  ++V H   +S  +  + P   GG+ I  Y +E  +   +S  W +  +   +  +  KV  L     Y FR  A N  G+  P  +  + ++  DP D    PG+P V++ + NS  L W  P+ DGG  +T Y +E ++     W +   +N             P    T   LVEG +Y FRI+A N  GA S PSE++++++ K  Y  P  +  P I + + IK G T   + I   G+P P  +W + G  +   SD   I            +++LT+  A R  D G YTI      GT+     V VLDVP  P  +    + AE   L+W  P +DGG+PI SY+++  +     W    E  +  +     L  G+ Y F V AVN  G+ EP ++ EP+K  + + PP  P++P + +    + T+ W++P DDGG  IT Y +++++K    W  A+KT        + +L  ++ GL EG  Y+FR+ A N+AG   PS  +   L +     P        + T K + +  W
Sbjct: 21101 DVPDAPPPPNIVDVRH---DSVSLTWTDPKKTGGSPITGYHLEFKE--RNSLLWKRANKTPIRM-RDFKVTGLTEGLEYEFRVMAINLAGVGKPS-LPSEPVVALDPID---PPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNV------------PECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIR-PSDITQI-------TSTPTSSMLTIKYATRK-DAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGEPVQS-EPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTP-------VSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAW 21620          

HSP 39 Score: 201.83 bits (512), Expect = 1.175e-50
Identity = 190/681 (27.90%), Postives = 295/681 (43.32%), Query Frame = 0
Query:  494 GDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDC--NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYK---EKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN---IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            G KT S T    V++G   P  G    VS V+ + C  +WG      G + ++  +   + G      Q VN +    R  + V +  +    S+++   N  G  + L +  I+ +     P  P   EV H+S N+  ++   P  DGG++I  Y +E  +   ++  W +    + K P    + KV  L+    Y+FR  A N  G+S   E S + I+ ++P D    PGRP V D + ++  L W+ P  DGG+ +  Y IE K   E   G W +      SD               T   L EG+ Y FR+ A N  G  S  SE++  V  +  Y  P        +   + I+ G     D   GG+P P + W + G   L   +++S++       Y  K     +   +RS D+G YT+ +    GT+  +  V VLD P     L    +  E   L+W+ P +DGG  IT Y+++  +    +W+    E       V  L   + Y F V AVNK G   P  + EPI A N +  PS P  P  V    + + ++W KP  DGG  I++Y++ K++K    +  +  D    + R+     ++  L EG  YQFR+ AVN AG S PS  +    CR  + TP          T K + +  W
Sbjct: 29654 GVKTFSVT---VVVIGRPGPVTGPIE-VSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESG--TTAWQLVNSSVK--RTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKE--RNTILWVK----ENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEAS-RPIMAQNPVD---APGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD------------NFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTK-GDKELDLCEKVSLQ-------YTGKRATAVIKFCDRS-DSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRL-----KVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAW 30289          

HSP 40 Score: 199.904 bits (507), Expect = 5.343e-50
Identity = 162/541 (29.94%), Postives = 247/541 (45.66%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI---KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV-----LAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAEN-PYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            P PP+T+++  +S++   +   PP+DDGG+++  YI+E  +V +  ++W +V     K P ++   +   L     Y  R  A N  G   P   S + I+  DP   P KP  P V D +  S  LAW++PE +GG+ +T Y IE ++     W +    NT+  +I+           T   L +G EY FR+ A N GG   P+E   +V     L    Y     +Q GI+   +++G   R  I   G+P P   W + G  +   S R  I          E +T L + +A+R  D+G Y + L    G +     V V+  P  P   L  D+I+   + +SW  P DDGG  I  Y+++  ++    W       + T   VKGLK    Y F V A N+ G S+P ++ EP+  +     P      P ++D    SV+L W +P DDGG  +T Y I++K+     W    KT       +I      + GL     YQFRIIA N  G S  S  ++P +C+     PS
Sbjct: 30859 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRA--DRWVRV----NKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPS-KPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK---CNTTPTKIR---------EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF---VRQGGVIRLTIPIKGKPFPICKWTKEGQDI---SKRAMI-------ATSETHTELVIKEADRG-DSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKT-------QITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPS 31359          

HSP 41 Score: 197.593 bits (501), Expect = 2.512e-49
Identity = 189/644 (29.35%), Postives = 284/644 (44.10%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS-----VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIAS-TDEVLITREEY-QGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            L+  +    PD P    V  ++ NS +VK + P D+G + I  Y +E  +V+S+   WS+V ++     K+  V+ L+    Y FR  A N  G   P + S       DP    D    P      V D SS + +L W  P  +GG  I  Y ++ +      W +        I+++           T K + EG +Y  R+ AVN  G   P ET    +A+ +          +   I+I  G+T R      G P P+  W +    L  D DR+ I+    K+        L +  A R  D G Y I      G++ A   V V DVP     L P     +   L+W+ P DDGG+ IT ++I+  D     W   +ET+ +K  + GL  G  Y+F VIA NK G   P   + PI A +P  PP+ P+     +    ++TL W++P  +GG PI  YII+K+      F+ +        + + E       L E + Y+FR+ AVN+ GES PS      + +   + P+I  + S    TIKV       I   V G P P+  W KN   I   TD + IT+EE  +  A  +L + K+   D GTY++ A NR G    ++ + V D
Sbjct: 15821 LVAKDPFGPPDAPDKPIVEDVTSNSMLVKWNEPKDNG-SPILGYWLEKREVNST--HWSRVNKSLLNALKA-NVDGLLEGLTYVFRVCAENAAG---PGKFSPPS----DPKTAHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSR---CTEKMIKVR---------QYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVGTKSE-------LIIKDALRK-DHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVE-IGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVE------NLDEHQMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYD 16423          

HSP 42 Score: 197.208 bits (500), Expect = 3.747e-49
Identity = 188/682 (27.57%), Postives = 297/682 (43.55%), Query Frame = 0
Query:  586 YKIIIRNAQG------FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECECDMFKTGDLECNCSNGFR--HG 1258
            +++   NA G       ++ ++  +    P PP  + V  ++K    +K  PP +DGG  I+ Y+IE  +      +W +  +  G    + +V ++I     +F+ RA N  G+  P E + + + I+DP   P  P    V D       +AW  PE +GG+PI  Y +E        W +       D++ K +           +G+V   EYV R++AVN  G S PSE S++V+AK    KP +     ++I + +G      + F   P P+V+W ++G  +   SDR+++     K  +   +  L V K+ R+ D G YTI L    G+  A+  V V+ +P   + +   +I      L+W  P  DGGTPI  YV++  +     ++  M  ++  + TVK L P   Y F V AVNK G  E      P+ A++P +PP  P +  + +   +++T+ W+ P  DGG  I  YII+K  K    +          E  +  L     GL EGK YQFR+ A N AG S PS  T P         P +     +S  +K          + G P P  TW K        DE +I  EE +  A                   +   R G+ + + +  VL L Q    D  K G+ +    +  R  HG
Sbjct: 15082 FRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE--RLGTRWVKAGKTAGPD-CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPT-EILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVE-----------EGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDL-ETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKA-SDRLTM-----KNDHISAH--LEVPKSVRA-DAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCN------EHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI--LRTSLEVKRGDEIALDASISGSPYPTITWIK--------DENVIVPEEIKKRAAP-----------------LVRRRKGEVQEE-EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHG 15704          

HSP 43 Score: 196.052 bits (497), Expect = 6.910e-49
Identity = 171/593 (28.84%), Postives = 259/593 (43.68%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNT---VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI 1148
            R  L V   K      ++I   N  G    L +  I+ +     P PP T   T ISK+S V++   P ++GG+ +  Y +E  +   +S  W++V +      +  K  NL     Y FR  A N +G+    + S +  + +DP D    PG P  +    N   L W  P  DGG+ IT Y +E ++   G W +    N  + +             T  GL E   Y FR+ A N  GA S PS+++  + AK     P +     +   I +  G TFR +    G+P P++ W R G   + +S R  I           KNT    L + K    ID G Y ++     G++     V VLD P  P   +    + +E  +L+W+ P  DGG+ I+ YV++  +     W + A E       V  L  G+ Y F ++AVNK G  EP  +  P+  +NP+  P  PK   + +    S+T+ W +P  DGG  I  YI++K+D+ G  W    K        RI +L  R+ GL+E   Y+FR+ A N AG   PS    P    +K   P    G  ++  I
Sbjct: 24306 RTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKE--RNSILWTKVNKTIIHDTQ-FKAQNLEEGIEYEFRVYAENIVGVGKASKNS-ECYVARDPCD---PPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQF------------TVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR-GDKEIEESARCEI-----------KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESA-PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNK-------RRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPS----PATVYYKACDPVFKPGPPTNAHI 24855          

HSP 44 Score: 191.815 bits (486), Expect = 1.473e-47
Identity = 160/529 (30.25%), Postives = 243/529 (45.94%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQ---ADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKG-GASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL 1128
            P PP T +V H +K++ +V    P +DGG+ +  Y +E  +   SS  WS+  +   AD +    +KV+ L     Y +R  A N  G+    + S + +  +DP D    PG+P V + +  S  L W+ P  DGGA IT Y +E +E   G W +    N  +             +     L E   Y FR+ A N     S PSE++  ++ K     P +     +   I +K G   + +    G P P ++W ++G   +   +R   E+ S      + +T+LTV    R  DTG Y + L    GT+       VLD P  P   L  + + AE  +LSW  P +DGG  I  Y+++  +  +  W +   E + T   V  L  G+ Y F V  VNK G  EP  ++  IKA +P+  PS P    I     +S+TL W +P  DGG  I+ YII++++K    W    K         + +L  +  GL EG  Y++R+ A N AG S PS ET P +
Sbjct: 26514 PGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKE--RSSILWSKANKILIADTQ----MKVSGLDEGLMYEYRVYAENIAGIGKCSK-SCEPVPARDPCD---PPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQE------------TYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDG---IEIEERARTEIIS-----TDNHTLLTVKDCIRR-DTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVA-IKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKP-------VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPS-ETSPLI 27002          

HSP 45 Score: 187.963 bits (476), Expect = 2.557e-46
Identity = 161/565 (28.50%), Postives = 261/565 (46.19%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEK---PRXLN----PDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV--KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            ++  +G YK+ + N  G  + +++V I DKPD P   I +  + KNS V+   PP DDGG+ I +Y++E  +    + +W  V+ A      + ++ NL     Y FR  A N  G+SDP E+S   +IIK P+++P  PG+P++   + +SC +AW  P SDGGA I +Y +E +EK    W     ++ +  EI+  V        + K L+EG EY FR+K  N GG S  SE S+ +  K+       H +  + N+ ++            G P P V W R G  ++ D  +  I+ F  K  Y  +  + +VT  + ++    Y ++    GG+   T  + V +VP K   P+ L        +R E +++    P      P+ ++      IDN      + T+   + V   G++      + V A N+ G  +    L+     +P      P+   + D    SV L W +P+ DGG  IT+YI++K       W           +AR  E    +  L     YQFR+IA NK G S PS  ++P + + 
Sbjct: 31620 RKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGA-EWQLVSSAISV--TTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSV-VIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKW-----ISVTTEEIRETV-------FSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF--KGGY-HQLIIASVTDDDATV----YQVRATNQGGSVSGTASLEV-EVPAKIHLPKTLEGMGAVHALRGEVVSIK--IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP------PRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV-------GQAR--ETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 32143          

HSP 46 Score: 186.422 bits (472), Expect = 6.903e-46
Identity = 147/519 (28.32%), Postives = 232/519 (44.70%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTV----LTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE 1117
            P PP T  VT++++ S  V    P  +GG+ +  Y +E  D   +S  W +  +   +     KV  +     Y FR  A N  G+  P   S   + I    D  + P    + D S NS  L+W  P  DGG+ IT Y +E ++   G W +    N ++ +                GL + ++Y FR+ A N  G  S PSE    +     Y  P +  P  Y   ++ + G + +      G+PAP++ W ++   L  ++            + C +NT     + +  A+R +++G Y +KL    G+  AT  V +LD P  P   +    + AE I L W  P DDGG  IT Y+++  +     W    E  ++   T   +  G+ Y F V AVNK G  EP  + + + A+N +  P  P  P +      S+T+ W +P  DGG  I+ Y ++K+DK   GWF  LK         I +   ++ GL+E   YQ+R+ AVN AG+
Sbjct: 27597 PGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKD--RNSILWQKANKLVIRT-THFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAI----DACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQF------------IISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNA------------LVCVENTTDLASILIKDADR-LNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLES-DSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK-------ETIRDTRQKVTGLTENSDYQYRVCAVNAAGQ 28075          

HSP 47 Score: 185.267 bits (469), Expect = 1.373e-45
Identity = 162/563 (28.77%), Postives = 260/563 (46.18%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDER-LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPG---RPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI--YNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDV--PEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            L +    R  +G Y + I N  G  +   ++V ++D P   + ++V H+S+ +  +   PP  DGG+ I +Y+IE  D  ++   WS V+        S K+ +L  K  + FR  A N IG+ +P E +       +P    + P      S+ D +  S  L+W  P+ DGG+ IT Y +E K K    W    I  T +IE+                L E +   FR+ A N+ G S P  T   +  K   + P +    I    + ++ G     ++ + G+P PS++W ++G L L +S+ +    FSK     E    L++  A +    G YT+ L  D    +    + V+ +  P KP+  +  DEI+A+ + LSW  P D+GG  IT Y I+  +    +W +       T   V  L     YQF V A N+ G S+P  +   I A++ ++ P  P +P I +  +  ++L W  P  DGG  +T + ++KK++    +  + T      + I   E R  GL EG  YQFR+ A N AG SSPS  +K
Sbjct: 28256 LTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRD--ATKRTWSVVSHKCSS--TSFKLIDLSEKTPFFFRVLAENEIGIGEPCETT-------EPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQ--------------LKEQSVLEFRVFAKNEKGLSDPV-TIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDG-LPLKESEFVR---FSK----TENKITLSIKNAKKE-HGGKYTVIL--DNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVS-SIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNT------SPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSK 28774          

HSP 48 Score: 176.407 bits (446), Expect = 6.880e-43
Identity = 161/594 (27.10%), Postives = 262/594 (44.11%), Query Frame = 0
Query:  570 RVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLH-QPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR---HKNLTPSIDKGSSSSKT 1147
            R    V N  ++    +++   N  G  + L++  I+ K     P PP    + +++ +   +    P  DGG+E+  + +E  +   +S  W +V  +   G +  +   L+    Y+FR  A N  GLS P + S   + +       D PG P  +D +  +  L W  P  DGG+ I  Y IE K +    W +    + S+ +             T  GL  G+ Y FRI A N  G  S PS++S  ++ +   + P +   P  ++ + IK G + R      G P P VTW ++G  +     R+++E+          +T L V  A R    G YT++     G+ +A   V V D P K   + P     I  E + L W  P +DG  PIT Y+I+  +     W    +  + ++ T   L  G+ YQF V AVNK G   P  + +P+ A+  Y  P  P  P   +    S+TL W +P  DGG  I  YI+++++K    W   +       +  I E   ++ GL+EG  Y+F ++A N AG    S  ++   CR   +    P++ K + +SKT
Sbjct: 28640 RTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE--RNSILWQKVNTSPISG-REYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAV----SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIE-KRQGNERWVRCNFTDVSECQY------------TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEI---EKRMNMEITD-----VLGSTSLFVRDATRD-HRGVYTVEAKNASGSAKAEIKVKVQDTPGK--VVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDS-DPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVI------SKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKT 29195          

HSP 49 Score: 162.54 bits (410), Expect = 1.246e-38
Identity = 175/695 (25.18%), Postives = 281/695 (40.43%), Query Frame = 0
Query:  563 NINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFD---ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDK--PGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTD---VNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKL-------LCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET----KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQ-IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
             +     +    V N +  KS  +++   N  G     E    V     P P   ++V  +SK+SC +    P  DGG+ I  Y++   D  +  N+W +V ++           +L     Y FR  A N  G   P EI+   ++ +D    PD    G P +   +  + +    +P     AP               W++GE    +D  +  +   VN   +V+   K   +  +Y   +K V     +     S  V+ K          PGI    IK        +     P          + +L   D ++      K V C      T  +  R  +   YT ++       + +G   +     +  DVP+ P   N  ++R + ++L+W  P   GG+PIT Y ++  + ++  W  A +T    +D K T  GL  G  Y+F V+A+N  G  +P    EP+ A +P  PP +P+   +++    SVTL W +P  DGG  +T YI++K+D     W  A   +   C   + +L        EG  Y+FRI A N AG  S+PS  T+  +C+ +   P+I  D       TIK   T +   I + G+P P+ +W K G  I  +D   IT        T K    K    DAG Y++ A N  G     + + VLD+
Sbjct: 20762 TVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVV---DFLTEENKWQRVMKSLSL---QYSAKDLTEGKEYTFRVSAENENGEGTPSEIT---VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVS------------WKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS--DAGKYTITLKNV---AGTKEGTISIKVVGK----------PGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVN-----NKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVT--GLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPE---VINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDL-------VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRK----DAGEYTITATNPFGTKVEHVKVTVLDV 21399          

HSP 50 Score: 157.147 bits (396), Expect = 5.370e-37
Identity = 179/658 (27.20%), Postives = 279/658 (42.40%), Query Frame = 0
Query:  586 YKIIIRNAQGFDER------LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK----GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHIN---LSWATPHDDGGTPITSYVIKMMDIDNG-DW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID--------KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNG 1220
            ++II +N  G  E       ++  +  DKP  P  +E+  ISK+S  ++   P+ DGG EI  Y +E     S  + W +  +   K  K   +  L+    Y FR  A N  GLS P   +   + IK      + PG    +   +     A  L     G P+   +I++      L Q  +   +SD    T          T     + +E V+   A N+ G     ETS  +L +     P  H PG Y ++ K     G T R  + + G P P++TW  +G  LL +S+ I+IE         E  T L +    R    G Y ++L    GT  A   V + D P+KP    P  I A   N   +SW  P DDGG+ IT+YV++  +   G +W L +     T   +  L     Y F V A N  G S+P      +  ++P++ P  P +P I      S  + W+ P+ DGG  I +Y ++K++K    + ++ T++      I E    +  L EG  Y+FR+   N  GES  S  ++P       +TP  D        K    +  ++    A    KV G P P   WY+ G +I + D +    +E++GG   +L ++     DA  Y + A N+ G
Sbjct: 31329 FRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEY--RQSGDSAWKKSNKERIKD-KQFTIGGLLEATEYEFRVFAENETGLSRPRRTA---MSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLP--DIKWYRFGKELIQSRKYKMSSDGRTHT---------LTVMTEEQEDEGVYTCIATNEVGEV---ETSSKLLLQA---TPQFH-PG-YPLKEKYYGAVGSTLRLHVMYIGRPVPAMTW-FHGQKLLQNSENITIE-------NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKP--TGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEE------IRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEP-------ITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGY-HQLIIASVTDDDATVYQVRATNQGG 31936          

HSP 51 Score: 155.606 bits (392), Expect = 1.941e-36
Identity = 156/600 (26.00%), Postives = 259/600 (43.17%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI--WFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGT------QQATGYVNVLDVPEKPRXLNPDEIR---------AEHIN----------LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            KDG+ +K    VN++       L++    +E  G+Y++ + N+ G     I + ++D+P PP  I +  +S +S  +  +PP+ DGG +I +YI+E  + +S++  W  V+QA  +   SIK+  L     Y+FR  A NR G S   E S   ++ + P+  P  PG P V+  + ++  + W +P +DGG+ +  Y +EYKE+S  LW +   +  +D ++K              GL EG  Y +R+ A N  G    S++ + V A+     P   QP + NI  +K  + ++    + GG        ER     L D   +     + +  Y E   V  +T+  R      Y  ++             ++TG + V D  E PR +   + R            IN          +SWA    DG         +++  DN   L   +   +DT   V  LK  ++     +AVN       C+ L     + P  PP+ P E N      +  +L W +P +DGG  I +YI++K++     W          CE  +     ++  L +G  Y FR+  VNK G   P
Sbjct: 26357 KDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT--WHIVSQAVAR--TSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA--VVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVS------------GLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPP--GQPEVTNI-TRKSVSLKWSKPHYDGGAKITGYIVERRE---LPDGRWLKCNYTNIQETYFE---VTELTEDQR------YEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA---KDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLK--NVAGTRSVAVN-------CKVL-----DKP-GPPAGPLEIN--GLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAW--------TICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEP 26895          

HSP 52 Score: 144.436 bits (363), Expect = 4.194e-33
Identity = 85/273 (31.14%), Postives = 138/273 (50.55%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KDG  +K  + + +    +   L + +  R+ SG Y I   N+ G     I + ++DKP PP ++++  +  +  ++   PP +DGG+EI +YI++  +  +S   W+QV+        S  V  LI  H Y+FR  A N+ G+ DP  +  +  I K+P+D P +   P + + + +   ++W  P  DGG+PIT Y +E +E     W              T VN KP++  T K  GL EG EY FR+ A+NK G   PS+ S +  A+
Sbjct: 20258 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRE--TSRPNWAQVSATVPI--TSCSVEKLIEGHEYQFRICAENKYGVGDP--VFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW--------------TKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYAR 20510          

HSP 53 Score: 142.51 bits (358), Expect = 1.807e-32
Identity = 89/278 (32.01%), Postives = 137/278 (49.28%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            KDGKE++    + I       +L   +  R  SG+Y +   N  GF + + NV ++D+P PP+  + VT ++   CV+   PP DDGG +I HYI++  + S  +  W+ VA         +KV  L+  + Y FR  A N+ G+ +P E   + ++  +P+  PD P  P V   + +S  + W  P+SDGG+ I +Y +E ++K+   W +      +D+  K              GL EG+EY FRI A N  G S PS TS    A     KP
Sbjct: 22424 KDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLA--WTNVASEVQV--TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE--SEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVS------------GLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKP 22683          

HSP 54 Score: 141.739 bits (356), Expect = 2.732e-32
Identity = 118/423 (27.90%), Postives = 191/423 (45.15%), Query Frame = 0
Query:  715 DKPGRPS---VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTW----ERNGSLLLGD-SDRISIELFSKKTVYCEKNTVLTVTKANRSI-DTGHYTIKLLCD-----GGTQQATGYVNV---LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGES 1118
            DKPG P+   + D ++ SC L W  P  DGG+ IT+Y +E +     +W +   L+++      D N K         L+   EY+FR+ A N  G   P + S  + AK ++  P              G   R +     + A ++TW    +  GS + G   +R+  +  + K V C K  V   T   + + +   Y  ++L +     G   ++T  + +   +D P  P      ++    + L+W  P  DGG  I SYVI+M+     +W+   E    T+  + GL  G  Y F V AVNK GESEP    +P+       PPS P+   +++    +  L+W  P  DGG PIT+YI++K+D +  GW         + +  + + +  +  L+EG  Y FR+ A N  G+S
Sbjct: 14709 DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHK---LSST----VKDTNFK------ATKLIPNKEYIFRVAAENMYGVGEPVQAS-PITAKYQFDPP--------------GPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPD--TDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW--------QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQS 15093          

HSP 55 Score: 137.887 bits (346), Expect = 4.278e-31
Identity = 98/318 (30.82%), Postives = 149/318 (46.86%), Query Frame = 0
Query:  940 EIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECECDMFKTGDLECNCS 1252
            +I      +SW  P  DGG+PIT Y ++  ++  G W+   +T   D K  V GL  G+ Y+F V A N  G S+P  + +PIKA  P KPP  P  P + D   ++  L W KP  DGG PI  Y+++ +      ++ +  D+      I +   R+PGL EG  Y+FRI A N  GE  P  E    +     L P    +D       T++V +T     +VKG P P+ TW K G  +     V +     Q     +L + ++   D G Y + A+N +G  +    + VLD    C+ ++  T   + NC+
Sbjct: 18641 DITENAATVSWTLPKSDGGSPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDEL-----IRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPR-ELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDL----IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQ-NLKVTNVTKENCT 18946          

HSP 56 Score: 137.117 bits (344), Expect = 8.262e-31
Identity = 86/277 (31.05%), Postives = 136/277 (49.10%), Query Frame = 0
Query:  552 DGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            DG E+K  +   +        L + N  R  +G Y+I + NA G     +++ ++D P PP   I +  ++     +   PP DDGG+ + +YI+E  D  +  + W  V+    K    +K+ +L     Y FR RA N+IG+  P  +     + K  +  P  PG+P V D + N+  ++W LP+SDGG+PIT Y +E +E + G W +      +D++ +              GL EGN Y FR+ A N  G S PS +SD + A  R +KP
Sbjct: 18474 DGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQD--TRKDTWGVVSSGSSK--TKLKIPHLQKGCEYVFRVRAENKIGVGPP--LDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVT-GKWVRVNKTPIADLKFR------------VTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKA-CRPIKP 18730          

HSP 57 Score: 136.732 bits (343), Expect = 1.101e-30
Identity = 105/362 (29.01%), Postives = 158/362 (43.65%), Query Frame = 0
Query:  887 CEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATG------YVNVLD---VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDEL---EARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKV--KGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            CE    +T  K  + +    Y  ++   G  +   G       +  LD   VP  P  L    +  E + L W+ P  DGG+ I+ Y+I+  + ++  W+   +    D +    GL+ G  Y++ V A N  G S P  T   I+AE+P   PS P +P IVD    ++T+ W KP  DGG PIT Y ++ K          K+DD   +  I  L   E  I GL+ G  Y FR+ +VNK G S PS  + P + + +   P  D  S   KT+ V   A + + V  +G P P   W K    + +   V  T       +   L +  +   D+G Y+L  +N        L + VLD
Sbjct: 26860 CEGELQMTSCKVTKLLKGNEYIFRVT--GVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYK----------KSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTT------DSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLD 27203          

HSP 58 Score: 136.346 bits (342), Expect = 1.138e-30
Identity = 168/647 (25.97%), Postives = 254/647 (39.26%), Query Frame = 0
Query:  607 DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGL-SDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQG--EILNTSDIEIK-TDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT-----VYCEKNTVLTVTKANRSIDTGHYTIKLLCD-----GGTQQATGYV--NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            D  DPP   E   +++NS  ++   P  DGG++I  YI+E  ++     +W + A          +V  L+  HRY FR  A N  G+ S+P E +G  I  +D  D P     P   D        ++ +     G PI   +          W +G  E+ NT+ +EIK TD      V    +  V+   Y+  +KA N  G     E S +V  K       L +PG               +   G  A   T      L  G SD I+  +  ++T        + N      K  + ++   YT +++       G   ++   V  N   VP+ P+      +  + + + W  P  DGG+ I  YV++  D +   W    +    + +  V GL   H Y+F V A N  G SEP       KA +P   P  P  P ++D    SV L W KP  DGG  I  YI++K D   G W         +    I++    +  L E   Y FRI A+NKAG    +    P +   K   P ID      K I +      +  + +KG P PE  W K   +I     + +T       +   L +      D+G Y+L  EN +G     + + VLD
Sbjct: 23364 DPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPE--GRWMK-ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGA-ITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQ----------WIKGDQELSNTARLEIKSTDFATSLSVKDAVR--VDSGNYI--LKAKNVAG-----ERSVTVNVK------VLDRPG----------PPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEW------TMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT------SSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLD 23959          

HSP 59 Score: 135.191 bits (339), Expect = 3.133e-30
Identity = 88/300 (29.33%), Postives = 152/300 (50.67%), Query Frame = 0
Query:  524 VAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVI--NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPD-PPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +A ++ N+ +   ++G     +    +K G++  +  D  ++     V+  +I  + ++  +G Y I ++N  G  E  I++ ++ KP  P   I+   ++  +  +K +PP DDGG+EI +YI+E  D  S +N+W   A A  K   + +V  L     Y FR  A N+ G+ +   +  + I+ + P+D PD P  P+++D   +S  L W  P+  GG+PIT Y +E+KE++  LW++           KT +    M      GL EG EY FR+ A+N  G   PS  S+ V+A
Sbjct: 20920 LAKENSNFRLKIPIKGKPAPSVS---WKKGED-PLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRD--SVNNKWVTCASAVQK--TTFRVTRLHEGMEYTFRVSAENKYGVGE--GLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRAN---------KTPIR---MRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVA 21197          

HSP 60 Score: 134.806 bits (338), Expect = 4.035e-30
Identity = 99/320 (30.94%), Postives = 143/320 (44.69%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRA--EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME---TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            N   +P  P    P+E+    EHI + W  P  DGG  I++Y++   +  +  W    +     DT+  V  L  G  YQF V AVN  G SEP      I    P   P  P  P +VD    S++L W KP  DGG  I  Y+++ ++K    +  + T+     A I   E  +P L  G+ Y FR+ AVN  G S  S          +   P ++      KT+ +   A  +  + V G PPP  TW K GI +AS   ++ T E Y     + L V K    DAG Y++ AEN++G+    + + V D    C
Sbjct: 30162 NSFTIPSPPGI--PEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTN-----ATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS-RAIIDTTESY-----SLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPC 30468          

HSP 61 Score: 133.65 bits (335), Expect = 9.301e-30
Identity = 94/305 (30.82%), Postives = 136/305 (44.59%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQ-KKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKN--------GIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  +H+ +SW  P DDGG+PIT Y+++  +    +W         + T+K  GL+ G  Y+F V A+NK G  +P    +   A +P  PP  P  P + D    SV+L W KP+ DGG PI  Y+++ K+     W         +    + +    + GL E   YQFR+ AVNK G S PS     H  +   + P   +D     +  ++   T    + VKG PPP+ TW K         G+ I STD     R E                 DAG Y L  EN  G+ +  + + VLD
Sbjct: 20426 ITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWV------RCNLPQNLQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCE------------NVNKYDAGKYILTLENSCGKKEYTIVVKVLD 20712          

HSP 62 Score: 131.339 bits (329), Expect = 4.899e-29
Identity = 91/275 (33.09%), Postives = 139/275 (50.55%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +S  KDG  +K  + V  +   +++ L++ N K+E  G Y +I+ NA       I V  +  P  PK  I    I  +S ++    P+D+GG EI  Y IE  + S ++  W  V  +  +   + KV NL+    Y+FR RA NR G+S P  +    I+ K  +  P  PG+P + + +S+   L W  P  DGG+ +T + +E KE++  LWQ+   +NTS I      +G+        GLVEG +Y FR+ A N  G S PS+ S   LA
Sbjct: 28522 ISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTN--WKMVCSSVAR--TTFKVPNLVKDAEYQFRVRAENRYGVSQP--LVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQK---VNTSPI------SGR---EYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLA 28778          

HSP 63 Score: 130.183 bits (326), Expect = 1.046e-28
Identity = 91/300 (30.33%), Postives = 144/300 (48.00%), Query Frame = 0
Query:  940 EIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA--TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDA----SCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP---SFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIV 1230
            ++    ++LSW+ P DDGG+ +T Y I+  +     W+   +T+ T    TV GL P   YQF +IA N  G SE     EP+  ++P+  PS+P E  I+     SVTL+W+KP  DGG+ I           G W +  ++ D+    S + RI + +  I GL E   Y+FR+ A N+ G S P   +   K  L   +   P I K      T K+   A    ++ G P P+  WY+ G ++  + +  ++ +    G T  L V   +  D G Y+ +A N  G+ +T   L++
Sbjct: 31267 DVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI----------LGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGE--APGIRK-EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSD----GRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 31549          

HSP 64 Score: 128.257 bits (321), Expect = 3.494e-28
Identity = 160/657 (24.35%), Postives = 269/657 (40.94%), Query Frame = 0
Query:  600 LINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ----GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG-IYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTV-TKANRSIDTGHYTIKLLCDG--GTQQATGYVNVL-----DVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG------GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNL-TPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++ +N +D+P  P+ + +    K    +K   PD DGG+    Y +E       S+ W +V +   K    + V+  +    Y FR +  N  G SD   +  +++++K+   +P       VLD       L+  L    G        +  K      W +     ++  +  ++I T  +         K   +G +YV  + A N  G+ +   T +            L +PG + N++I    + R  + +           +N  L   ++ R+    +S         TVLT  T   R I+   Y  ++  +   GT   T    V+     D P +P      ++  E + + W  P  DGG  IT Y ++  +  +  W+   ++   + +  V+ L P H YQF V A N+ G  EP     P+ A++P +PP  P    +VD    S+TL W KP  DGG PI  Y+++ + K        GW         +  A++   E  +  L E + Y+FR+ A N+ G   P+ E K  +   + L  P ID  +S  K + V      ++   V+G P P+ TW K GI     D V+   +       A L +  S   D+G YSL   N  G+    +++ VLD
Sbjct: 19019 ILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVER--RLKGSDDWERVHKGSIKETHYM-VDRCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKEDLQKP-------VLD-----LKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAK-RSDGGKYV--VTATNTAGSFVAYATVN-----------VLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSA--------TVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW------KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPA-ELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGI-----DNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD 19624          

HSP 65 Score: 127.872 bits (320), Expect = 5.509e-28
Identity = 100/317 (31.55%), Postives = 144/317 (45.43%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV-------KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHL-CRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
              VP  P       +  + + +SW  P  DGG+PI  Y ++  + +   W        +KA V        GL  G  Y+F VIA N  G+S+P +  EP+ A +P  PP +P   NI      +VTL+W KP   GG  IT YI++K+D   G W  A  ++       I E E  + GL+E   Y+FR+IA N AG  SP  E    + CR     P I  D     +  +K       +  V G PPP   W K+G ++  T ++ I   ++    +  L    S   D+G Y+L A N  G  K   ++ VLD
Sbjct: 22183 FKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTV-----SKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNIT---RHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSN-------ILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF----STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLD 22480          

HSP 66 Score: 125.561 bits (314), Expect = 2.388e-27
Identity = 147/592 (24.83%), Postives = 234/592 (39.53%), Query Frame = 0
Query:  548 SVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKP--MVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQ-PGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLG---DSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLL-CDGG----TQQATGYVNVLDVPEKPRXLNPDEIRAEHI------NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            S F  G +++  + V +  H     L +       +G Y + ++N  G     I V I+DKP PP   I++  I   S  +   PP+ DGG  +  Y++E  D       W  V+++  +   + K   L   + Y FR  A NR G+     +  + I  +     P  P    + D S +   L W  PE DGG+ +T Y +E KE     W +              VN  P  M      GL EG EY  R+ A+N  G+  PS  S  ++A      P   Q P + +      RT     W       SV  +  GS + G   +  ++    ++K      K    T+T   +      Y  ++L C+ G      +  G V V ++ E P     DE   E I       +    P      PI  +  +  DI     +   ET  T+  +K    G    ++++  NK G+      +  I + N    P  P E +  D   +SV + W+ P+DDGG  I  YI+++++     W+        + ++R+      + GL E   Y FR+ A N+ G S P
Sbjct: 30698 SWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPG--WLPVSESVTRS--TFKFTRLTEGNEYVFRVAATNRFGIGS--YLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR--------------VNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTT----RTSVSLAW-------SVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHLPQG---AEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYP-DYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETH-TELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPN---SPEGPLEYD--DIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWY--------TIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKP 31240          

HSP 67 Score: 125.176 bits (313), Expect = 3.461e-27
Identity = 81/294 (27.55%), Postives = 141/294 (47.96%), Query Frame = 0
Query:  530 NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGE--ILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            N  V   + G     + LS  +DG  +K     N     + + +N+       +G Y+I   N+ G  +  IN+ ++D+P PP   + ++ I++ S  +K  PP  DGG+++ +YI+  +   +S+  W++V+    +    +KV  L     Y+FR +A NR G+SD   I    + +K P+  P  P  P V + +  S  + W  P S+GG+ +  Y +E K+++  LWQ+    ++ T+  ++ T             GL+    Y FR+ A N  G   PS  S+ VLA
Sbjct: 27420 NLKVDIPISGKPLPKVTLS--RDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIL--LKRETSTAVWTEVSATVAR--TMMKVMKLTTGEEYQFRIKAENRFGISD--HIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTT----------ISAGLI----YEFRVYAENAAGVGKPSHPSEPVLA 27691          

HSP 68 Score: 125.176 bits (313), Expect = 3.580e-27
Identity = 129/482 (26.76%), Postives = 191/482 (39.63%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKE-KSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPP 1029
            +KD KE++    V +    D   + + +  R  SG Y++ +RNA G     I V I+DKP PP   IE   ++     +   PP DDGG +I HYI+E  +  +S   WS V++   +    I    +I  + Y FR RA N+ G+ +P E     ++ K+ +  P  PG P V   + NS  + W+ P +DGG+ I+ Y +E ++ KS+G ++   +L  +  + +  V           GL E ++Y +R+ AVN  G    SE S+   A      P                         G PA          + + DS + SI L   K VY                           DGG+   TGYV               EIR       W T    G    T YV+                         LKPG  Y F V AVN  G+ EP    EP++A++  + P
Sbjct: 27834 YKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRE--TSRVVWSMVSEHLEEC--IITTTKIIKGNEYIFRVRAVNKYGIGEPLE--SDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFK---VLKETIRDTRQKVT----------GLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPP-------------------------GPPA---------KIRIADSTKSSITLGWSKPVY---------------------------DGGS-AVTGYVV--------------EIRQGE-EEEWTTVSTKGEVRTTEYVV-----------------------SNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAP 28196          

HSP 69 Score: 123.635 bits (309), Expect = 8.747e-27
Identity = 90/283 (31.80%), Postives = 133/283 (47.00%), Query Frame = 0
Query:  546 ELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            ++S FKD  +V      +I      + L  I  KR  SG Y +++ N+ G  +    VN++D+P PP   +    ++K+  V+   PP DDGG++I +YIIE  +V    + W  V  A  K   + KV+ L+    Y FR  A N  G+SDP  +    +  KD +  PD P +P V + + +S  + W  P  DGG PIT+Y +E +E     W +            T     P        L+EG +Y FR+ A N+ G   PS  S  V AK    KP
Sbjct: 17776 KVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEV--GKDVWMPVTSASAK--TTCKVSKLLEGKDYIFRIHAENLYGISDP--LVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPH-DGGKPITNYILEKRETMSKRWAR-----------VTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 18040          

HSP 70 Score: 123.25 bits (308), Expect = 1.175e-26
Identity = 122/507 (24.06%), Postives = 201/507 (39.64%), Query Frame = 0
Query:  314 FNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKH-RYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSV 818
            F+C L+   AN++W RNG  +    +Y+    G    L++    LDD         EY    ED  +  +L VE    EI            +R   D   + E    +        VF  ++      V +  N  ++V G   +M    M +GK H+L +  I   D G+             +    +  +   ++   +    P++ V   D           Y +++ E   FK+ + +       I+   ++    ++  K+   G YKI+++N  G  E  IN+ ++D P P + +EVT        +    P  DGG++I  Y++E  D+   +  W  V   D        V  L      Y FR  A NR+G  +P E +   +  +  +D P  P   ++ D +     L W  PE DGGA IT+Y IE ++K+   W     +   D+              T   +VEG EY FR++A N+ G   PS  +  V
Sbjct: 13769 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDE-------CEYACGVEDRKSRARLFVEEIPVEI------------IRPPQD---ILEAPGAD-------VVFLAELNKDKVEVQWLRNNMVVVQGDKHQM----MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYD----------AYPKAEAEW--FKENEPLSTK---TIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKT--W--VLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVE-TDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDL------------SATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFV 14210          

HSP 71 Score: 122.479 bits (306), Expect = 2.425e-26
Identity = 88/311 (28.30%), Postives = 141/311 (45.34%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMI---DAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VP +P+     ++  + I ++W  P  DGG+PI  Y+I+  + ++  W+ A +T  + T+    GL  G  Y F + A+NK G S P +  E + A  P  PP +P+   ++D    +V+L W +P  DGG  I  Y ++     G  +    T       +I + E    GL E   YQFR IA      S PS  + P     +N+ P ID   +  S  T+K          V G+P P  +W K+G  +   + + +  +         LC  +   +   D+G Y++ AEN +G     + L VLD
Sbjct: 20018 VPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPE---VIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNT----APHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQR-------NLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLD 20314          

HSP 72 Score: 120.939 bits (302), Expect = 5.976e-26
Identity = 99/330 (30.00%), Postives = 149/330 (45.15%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWF-----GGEPAPSVTWERNGS 866
            +S  KDG E++      I    +   L V +  R  +G Y + ++N  G     +N  ++DKP PP   +E+  ++   C +    P +DGG +I +YI+E  + S  +  W+ + + + +   S KV  L+  + Y FR    N+ G+ +P E     + IK  DP+  P  P    +   +  S  L W+ PESDGG+ I+ Y IE +EK+   W +              VN KP+     K  GL EG EY +R+ A N  G SLPSETS  + A+      FL  P      +  G+T     W      GG P    T E   S
Sbjct: 26748 ISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLA--WT-ICEGELQM-TSCKVTKLLKGNEYIFRVTGVNKYGVGEPLE----SVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVR--------------VNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAEDPV---FLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKS 27052          

HSP 73 Score: 120.939 bits (302), Expect = 6.954e-26
Identity = 85/252 (33.73%), Postives = 126/252 (50.00%), Query Frame = 0
Query:  878 ELFSKKTV-YCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVN--VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDT-KATVKGLKPGHI-YQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            E  S KT+    + T   + +A +  D G Y I L    G  +A G++N  V+DVP   R L   E     ++L+W  P  DGG+ I  YV++  DI    W+ A +  ++ + TV GL+ G + Y F V A N+ G  EP  T  P++A + Y  P  P    I D +   V+L W+ P  DGG  IT+Y+I+ +DK    +D   T       R ++L A +  + EG+ Y FR+ A N+ G   PS  T
Sbjct: 13965 EPLSTKTIDTTAEQTSFRILEAKKG-DKGRYKIVLQNKHG--KAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMT------VRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT 14207          

HSP 74 Score: 117.857 bits (294), Expect = 5.166e-25
Identity = 81/276 (29.35%), Postives = 131/276 (47.46%), Query Frame = 0
Query:  547 LSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            +S  KDG+ +K    VN+        L++    ++  G Y +   N+ G     ++V +++KP PP   +    +S +  V+   PP   GG +I +YI+E  D ++++  W  V+    +   +IK+  L     Y+FR  A NR G S P  +  + +I++ P+ EP  PG P V   S +   + W  P +DGG  I  Y +E KEK+  LW +       D + KT             GL EG EY F++ A N  G   PS+ S+  +A+
Sbjct: 25270 ISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTT--WHMVSATVAR--TTIKITKLKTGTEYQFRIFAENRYGKSAP--LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT------------TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 25527          

HSP 75 Score: 117.857 bits (294), Expect = 6.166e-25
Identity = 86/313 (27.48%), Postives = 147/313 (46.96%), Query Frame = 0
Query:  927 LDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYII--QKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLT--PSIDKGSSSSKTIKVNRTAIWQ--IKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            + +P  P  L   ++  + + L+W  P DDGG+ +T Y+++  ++    W+    +    T+    GL  G  Y+  V A+N  G  +P R  +PI A +P  PP +P+ P + D    SV+L W  P D+GG  +T Y+I  QK D+     +  K +    + R    E  +  L +G  Y+FR++A N  G   P+    P   +   +   P  +      + I V +  + +  I +KG+P P   W K G  I S   ++ T E +      +L + ++   D+GTY LV EN+ G+    + + V+
Sbjct: 30856 IRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQ----HEWTKCNTTPTKIR----EYTLTHLPQGAEYRFRVLACNAGGPGEPA--EVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI-SKRAMIATSETH-----TELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI 31152          

HSP 76 Score: 116.316 bits (290), Expect = 1.506e-24
Identity = 88/304 (28.95%), Postives = 139/304 (45.72%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-------LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK--PHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTW---------YKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            +SW  P D+GG+PIT Y ++  +  +  W        TK  +KG       L  G  YQF  +A+N  G   P    +P  A +P  PP  P  P + D    S++L W+ P+ DGG PI  YI++ +++  G  D  + ++   +  I   E  +P L E + Y+FR+ AVN+AGES PS  T   P     +     ID G+      K          +KG P P+ +W          K+G+     D  L T E      ++ + + + +    G YS+ A+N+ GQ   +  + V+D+
Sbjct: 16544 VSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEE--GTTDWKRVNEP--DKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAEN-----SSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDV 16838          

HSP 77 Score: 115.546 bits (288), Expect = 2.518e-24
Identity = 92/298 (30.87%), Postives = 140/298 (46.98%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            I  + + + W  P +DGGT I  Y ++  + ++  W+   +T  +DTK    GL  G  Y+F+V A N  G  +P +  E   A +P  PP  P E  ++  +N  VTL+W+KP+ DGG  IT YI++KKD   G W  A  T+       + E E  + GL E + Y+FR+IA N AG  S PS  +     R +   P  S+D        +    T + +  ++G+P P+  W K+G ++  T   +  +   Q      L V      D G Y L   N  G     + + VLD
Sbjct: 25443 ISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRP-EAIVITRNN--VTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTN-------VLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQ---KTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLD 25727          

HSP 78 Score: 115.161 bits (287), Expect = 3.741e-24
Identity = 84/276 (30.43%), Postives = 126/276 (45.65%), Query Frame = 0
Query:  550 FKDGKEV-KVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLA 820
            +K G ++ K  Q VN         LN+    R  SG Y +  RN  G    +I + + D P PP   I+   +S +       PP++DGG  I +Y++E     S++  W ++A    +   + K   L     Y+FR +A NR G+     I+   I+   P+  P  PG P V   + +S  ++W  P SDGG+PI  Y +E KE++  LWQ                  K +V G      GL +G  Y FR+ A N  G S PS+ S+ +LA
Sbjct: 22026 WKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT--WVELATTVIR--TTYKATRLTTGLEYQFRVKAQNRYGVGP--GITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQ---------------TVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLA 22280          

HSP 79 Score: 114.005 bits (284), Expect = 8.120e-24
Identity = 83/272 (30.51%), Postives = 131/272 (48.16%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KD   +K    VN     +   L + +  RE  G Y + + N+ G     +NV ++DKP PP   +++  ++ +S  +   PP  DGG+ I +YI+E  D S+++  W  V+    +   +IK   L     Y+FR  A NR G S    ++ +  + + P+  P  PG P V   S +S ++ W  P SDGG+ +  Y +E KE++  LW +   LN + I         P       GL EG EY FR+ A N  G   PS+ S+  +A+
Sbjct: 23110 KDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTT--WQIVSATVAR--TTIKACRLKTGCEYQFRIAAENRYGKST--YLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVK---LNKTPI---------PQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVAR 23363          

HSP 80 Score: 113.62 bits (283), Expect = 1.147e-23
Identity = 82/275 (29.82%), Postives = 130/275 (47.27%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGT---CKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAK 821
            KDG  +K    +N+    D   L++    ++  G Y I + N  G     I +  +DKPDPPK  ++   +S  S  +  +PP   GG +I +YI++  D  +++  W  V+    +   ++KV  L     Y+FR  A NR G S    +    I+ + P+ EP  PG P     S +S  + W  P ++GG+P+  Y +E KE++  LW              T VN K ++H T    + L EG EY FR+ A N  G    S+ S+  +A+
Sbjct: 24192 KDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRD--TTTTVWDVVSATVAR--TTLKVTKLKTGTEYQFRIFAENRYGQS--FALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW--------------TKVN-KTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVAR 24445          

HSP 81 Score: 113.235 bits (282), Expect = 1.258e-23
Identity = 82/277 (29.60%), Postives = 130/277 (46.93%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP 827
            K GK+++      I        L +    R+ +G Y I   N  G     + V ++D P PP  +E++++S     +  +PP +DGG+ IK YI+E  +  +S   W+ V++ D +  + +    LI  + Y FR  A N  G  +P  +  + + + D +  P  P +P V + + N+  ++W  P  DGG+ IT Y +E +EK    W +      SD+  K              GL EG+ Y FR+ A N+ G   PSE SDSVL K     P
Sbjct: 21342 KAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRE--TSRLLWTVVSE-DIQSCRHV-ATKLIQGNEYIFRVSAVNHYGKGEP--VQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCK------------VTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPP 21600          

HSP 82 Score: 113.235 bits (282), Expect = 1.452e-23
Identity = 81/290 (27.93%), Postives = 134/290 (46.21%), Query Frame = 0
Query:  947 NLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
             +SW  P DDGG+ IT Y ++  +  +  W+ A++T   D +  V GL+ G  Y+F V A N+ G   P    + +  ++   PP  P  P++ D   +S +L W KP  DGG  IT Y+++ + K G   +A   D      RI +    +P L   + Y FRI A+N AG   P+      +   + + P  +  +   +T+ V      +I   +KG P PE TW K+ I + +   +  T       +   L + +    D G + +  EN  G+    +++ VLD
Sbjct: 21516 TVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQ-KVGD--EAWIKDTTGTALRITQF--VVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV-EREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTE------SFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLD 21793          

HSP 83 Score: 112.464 bits (280), Expect = 2.194e-23
Identity = 84/291 (28.87%), Postives = 134/291 (46.05%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++W  P +DGG+ +  Y ++  +  +  W  A  +   DT+  V GL  G +Y++ V A N  G  +  ++ EP+ A +P  PP +P+  NI     +SV+L+W KP  DGG  IT YI+++++   G W     T+       I E    +  L+E + Y+FR+ A N A   S PS  T P + +     P +         I V    + +I   + G P P  +W K+GI+I       I   +     T K C+ +    D G Y L  +N  G     ++  VLD
Sbjct: 26532 VTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNIT---RKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTN-------IQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRR----DTGQYVLTLKNVAGTRSVAVNCKVLD 26808          

HSP 84 Score: 112.464 bits (280), Expect = 2.469e-23
Identity = 81/298 (27.18%), Postives = 136/298 (45.64%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA--METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +  E I + W  P  +GG+ +  Y ++M D ++  W  A  +  + T   V  +  G IY+F V A N  G  +P    EP+ A +  +PP   +   I D    SV+L WQ+P+ DGG  IT YI++++D   G W  A  T+       + E +  I GL++   Y+FR+ A N  G  S+PS    P  C      P ID     ++ +K       +++  + G+P P   WYK+  ++ +   V +          A + +  +  +++G Y L   N  G     + + +LD
Sbjct: 27608 VTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPP---RNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTN-------VTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVE----NTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILD 27891          

HSP 85 Score: 112.079 bits (279), Expect = 2.946e-23
Identity = 91/319 (28.53%), Postives = 135/319 (42.32%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME--TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSS--SSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTD-LDLIVLDLMQECE 1238
            N    P  P      +I    + + W+ P  DGG+ I+ Y ++  D  +  W   ++   +DT+  V GL     YQ+ V AVN  G+       E  KA +P  PP  P +  I D    S+TL W KP  DGG  +T Y+++ +    G  +   T     E R  E    +  L  G  Y FR+ AVN AG+  P    +P   +     P ID   +  +S   K        I  KG PPP  TW K+   + S     I   +    +++ L + +    D G Y L  EN  G+ K+  + + VLD    C+
Sbjct: 27988 NAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQ---GEEEEWTTVSTKGEVRTTEY--VVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTD----SSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQ 28297          

HSP 86 Score: 112.079 bits (279), Expect = 2.971e-23
Identity = 91/310 (29.35%), Postives = 148/310 (47.74%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW----LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P KP   N   + ++ ++L+W  P  DGG+ +T + ++  + ++  W       +  ++ +AT  GL  G  YQF V A N  G S P    +   A +P  PP  P   + +D   +++TL+W  P  DGG  I  Y I+K+     W     TD + C+  +        GLS G  Y+FRIIA N  G  S PS  +   + R +N+ P ++ G      + +      +IK  V+G P P  TW+K+G++I     + IT      G+T+ L V  +     G Y++ A+N +G  K ++ + V D
Sbjct: 28687 PGKPVIYN---VTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRAT--GLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTP---DYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVT-------GLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITD---VLGSTS-LFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 28977          

HSP 87 Score: 112.079 bits (279), Expect = 3.205e-23
Identity = 95/318 (29.87%), Postives = 147/318 (46.23%), Query Frame = 0
Query:  941 IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET--KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIK--VKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECECDMFKTGDLECNCS 1252
            I  + + + W  P ++GG+P+  Y ++  + ++  W    +T   DT+   + L+ G  Y+F V A N  G  +  +  E   A +P  PP  P EP +V      +TL+W KP  DGG  IT YI++K+D   G W  A  T+       + E +  + GL+E + Y+FR+IA N AG  S PS  T P   + +   P I        TI VN    ++++  V G+P P   W +   +I  +    I   +++    A L V  +  ID G Y L A N  G     +++ VLD     E  +  TG     CS
Sbjct: 24361 ISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTP-EPIMVK--RNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTN-------VIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFK----ALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCS 24664          

HSP 88 Score: 112.079 bits (279), Expect = 3.315e-23
Identity = 84/310 (27.10%), Postives = 131/310 (42.26%), Query Frame = 0
Query:  929 VPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK---DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQK-KDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKT--IKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VP+ P    P  I    I L+WA P  DGG+ I  Y+++  +  +  W+  +  +   +T+  V GL  G+ Y+F V+A N  G          IK   P  PP  P    + D    +V+L W KP  DGG  I  YII+  K   G W    K +  +C     +    +  L  G+ Y+FR+ A+N AG+      T       +   P +D  ++  +T  ++   +    I  +G P P   W K    ++   ++  T       + + L V      DAG Y+L  EN +G       + VLD
Sbjct: 29078 VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWH---KVNAEACV----KTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTT------DSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLD 29374          

HSP 89 Score: 110.538 bits (275), Expect = 8.805e-23
Identity = 80/278 (28.78%), Postives = 137/278 (49.28%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN----IEIKKGRTF 845
            L+V +  R  SG+Y +  +N  G     +NV ++D+P PP+  + ++ ++   C +   PP  DGG++I +YI+E  +  +S   W+ V  A+ +   S KV  L+  + Y FR  A N+ G+ +P E   + ++ K+P+  PD P  P V   + +S  + W  P SDGG+ I  Y +E ++K    W +       ++ ++              GL+E ++Y FR+ A N  G S PS  S    A  +   P +++PG  N    I+I +   F
Sbjct: 23528 LSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRE--TSRLVWT-VVDANVQT-LSCKVTKLLEGNEYTFRIMAVNKYGVGEPLE--SEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLR------------VTGLIENHDYEFRVSAENAAGLSEPSPPS----AYQKACDP-IYKPGPPNNPKVIDITRSSVF 23782          

HSP 90 Score: 109.383 bits (272), Expect = 1.863e-22
Identity = 76/262 (29.01%), Postives = 129/262 (49.24%), Query Frame = 0
Query:  562 VNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK--SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGG---ASLPSETSDS 817
            VN     D   L +   +R  +G Y I   N  G   + + +N++ +P PP   I+   +S +   +   PP DDGG++I +Y+IE  + +  +  W  V+      PK  +  +  L+  H Y FR  A N+ G+ +P  +  +    ++ +  P  P +P+V   + NS  + W  PE DGG+P+T Y +E K+ +   W++   +N   I+  T       V     GL+EG++Y FR+ A+N  G   ASLPS+ + +
Sbjct: 17097 VNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKT--WVHVSSE----PKECTYTIPKLLEGHEYVFRIMAQNKYGIGEP--LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKR---VNRDPIKAMTL-----GVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATA 17342          

HSP 91 Score: 107.842 bits (268), Expect = 5.906e-22
Identity = 87/295 (29.49%), Postives = 139/295 (47.12%), Query Frame = 0
Query:  944 EHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE-SSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            + + + W  P  DGG+ +  Y ++  + ++  W+   +T    TK    GL+ G  Y+F V A N  G  +P +  E   A +P  PP  P+    +     SVTL+W+KP+ DGG  IT YI++KK+   G W  A  T+       I +    + GL E   Y+FR+IA N AG  S PS  T     R +   P I        TI V+    +++   + G+P P   W K   ++++T  + I   ++       L V  +  +D+G Y L A+N  G+    +++ VLD
Sbjct: 23282 DSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEA---IIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTN-------IIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDF----ATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLD 23562          

HSP 92 Score: 106.686 bits (265), Expect = 1.303e-21
Identity = 77/257 (29.96%), Postives = 119/257 (46.30%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY----NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLL 869
            V  ++K+S  +  S P DDGG+ +  Y IE  +  +S+++W +  +          V  L+    Y+FR  A N +GLS+    S + ++ KDP+D+P +PG   +L  S +S  L W  PE DGG  I  Y +EY++     W++       D +             T  GL+E  EY FR+ A N+ G S P  T+ S+  KT+        PGI     ++  K G   +      G P P + W R G  L+
Sbjct: 31265 VLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKE--TSTDKWVRHNKTQITT-TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPAS-EPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQF------------TIGGLLEATEYEFRVFAENETGLSRPRRTAMSI--KTKLTSG--EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELI 31501          

HSP 93 Score: 105.145 bits (261), Expect = 3.519e-21
Identity = 79/262 (30.15%), Postives = 118/262 (45.04%), Query Frame = 0
Query:  550 FKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP-KTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCK--GLVEGNEYVFRIKAVNKGGA 808
            FKDG E++   ++ I        L V +  R+  G Y +  +NA G  +  I V + D P      I  T+I+     +    P +DG   I HYIIE  + S  +  W+ +   D    +S     LIN + Y+FR  A N+ G+  P  +    ++ +  +  PD PG P   + + NS  L WA PESDGG+ I  Y +E +EK    W +              ++ +P+     K  GL EGNEY F + A N  G 
Sbjct: 28920 FKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLA--WALIE--DKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRP--LDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKV-------------ISKRPISETRFKVTGLTEGNEYEFHVMAENAAGV 29162          

HSP 94 Score: 105.145 bits (261), Expect = 3.829e-21
Identity = 84/318 (26.42%), Postives = 133/318 (41.82%), Query Frame = 0
Query:  930 PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLX--AMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKF----GGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFE-TKPHLCRHKNLTPSID---KGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQEC 1237
            P  P       + A  +++ W  P+ DGG+ I  Y ++  + +   W+    +   +    V GL  G  YQF   A+N  G S+      PI A+NP   P  P+   + D    +V+L W  P+ DGG  +  YII++K       G W     T        + +    +  LSEG  Y+FR++A N AG  S   E T P  CR +   P  +   +      TI+     +    V G+P P+  W K   ++   ++V +     +  A  K C       D+G Y+L  +N +G     + + VLD    C
Sbjct: 29768 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPE---VTDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTI-------VSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFC----DRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC 30071          

HSP 95 Score: 102.064 bits (253), Expect = 3.844e-20
Identity = 87/318 (27.36%), Postives = 139/318 (43.71%), Query Frame = 0
Query:  925 NVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-------LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            N+  VP  P       +    + ++W  P  DGG+P+T Y ++M D  +  W       + AM T      V GL  G  YQF V A+N  G        +P  A +P  PP  P    + D+   S  L W  P  DGG  +T YI++ K++        +  +   +  +   +  + GL EG +Y+FR+ AVN AG   P   T     + + ++P +   +S    I V+   + +I   V G+PPP  TW  N   +     +  T        ++ + +   Q    G YSL+A+N  G+ K  + + VLD+
Sbjct: 17239 NLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM-TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFP-KVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEE------GKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETT------AISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDV 17542          

HSP 96 Score: 90.1225 bits (222), Expect = 1.596e-16
Identity = 82/285 (28.77%), Postives = 137/285 (48.07%), Query Frame = 0
Query:  439 PSAPVDFFLNGK-IIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKV-----GQD-VNINFHGD----RVDLNVINP---KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKD 709
            P   V ++  GK II  G   R  +++   G HQLI+  +T +D    + R  TN G  +VS T S  V   E   K+     + G+           AV   +   + + +   GK   V     GQD ++ N H      R   +++ P   +R+ +G Y +  +N  G D++ + +++ D PDPP+ ++V+ +S++S  +  + P  DGG++I +YI+E    ++++ +W +V QA         V NL  K  Y+FR  A N+ GLS P E S   I  +D
Sbjct: 31882 PKPIVKWYRQGKEIIADGLKYR--IQEFKGGYHQLIIASVTDDDATVYQVRA-TNQGG-SVSGTASLEV---EVPAKIHLPKTLEGMG----------AVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVE--KCATTAERWLRVGQARE---TRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKED 32144          

HSP 97 Score: 86.2705 bits (212), Expect = 2.375e-15
Identity = 97/375 (25.87%), Postives = 152/375 (40.53%), Query Frame = 0
Query:  670 SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVL-DWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFL-HQPGIYNIEIKKGRTFRYDIWFG-GEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGH----YTIKLLCD-----GGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGE-SEPCRTLEPIKAENPYKPP 1029
            +I +   +     R+   AAN  G +     +  +I++    D P  P  P V+ D +  S  L W  P+ DGG+ +T+Y +  +E S  +W           E+   V    M       L  G EY FRIKA N+ G S   + S  V  K  Y  P     P + N+        R  I  G  EP         GS ++G      +E+  + ++  +K   L +   +  + T      Y  ++  +     G     +  V  +D  E PR +   +I    ++LSW  P  DGG+ IT Y+++  D+ +G W  A  T   +T+  + GL     Y+F V A N  G  S P   + PI   + Y  P
Sbjct: 27460 TINLKESVTADAGRYEITAANSSGTTK----AFINIVV---LDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWT----------EVSATVARTMM---KVMKLTTGEEYQFRIKAENRFGISDHID-SACVTVKLPYTTPGPPSTPWVTNVT-------RESITVGWHEPV-----SNGGSAVVG----YHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGP 27797          

HSP 98 Score: 85.1149 bits (209), Expect = 4.463e-15
Identity = 86/309 (27.83%), Postives = 135/309 (43.69%), Query Frame = 0
Query:  732 LAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCD-----GGTQQATGYVNVLDV---PEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPS 1030
            LAW  P +DGG+ I  Y +E ++     W    +L T   E     + +  V G  KG   G EY+FR+ A N+ G   P ET + V A+++Y  P    P + N+ I      R+ +    EP          + ++   D+ SI   +  TV  E +   TVT     ++   Y+ ++        G    AT +V V D    P  P  L   +     + L W  P  DGG+PI  Y+I+  +    +W+        + T  V GL+ G+ Y + V A NK G S+P   L P+ A++ +  P+
Sbjct: 14035 LAWEEPLTDGGSKIIGYVVERRDIKRKTW----VLATDRAE-----SCEFTVTGLQKG---GVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP---GPPL-NVTITD--VNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAE-DLSATVTDV---VEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPT 14321          

HSP 99 Score: 63.929 bits (154), Expect = 1.374e-8
Identity = 74/331 (22.36%), Postives = 128/331 (38.67%), Query Frame = 0
Query:  192 DQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGD----------KTVSCTGSFNVIMGEKA 512
            DQ V+E      VL   +S  N K KW+               G E+ KS+++E +       L++H+ T E+   +T  AK     F T  ++ V+PP  EF    + +T          +F C L+   A ++W ++GA +    +Y+   +G    LV+N+  LD                             D  E +C      +S  L V  +    ++  +  E  E ++     +V  P A V ++   + I+     R E+   G  K  L++    +ED G    R P++  D          + +S   +  ++ GEKA
Sbjct: 13220 DQTVEEGAT--AVLECEVSRENAKVKWF-------------KNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFL---RPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLD-----------------------------DEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETG--RYEILTEGR-KRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKA 13496          

HSP 100 Score: 56.225 bits (134), Expect = 2.516e-6
Identity = 75/297 (25.25%), Postives = 129/297 (43.43%), Query Frame = 0
Query:  948 LSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM--ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPI--KAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDEL-----EARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTD--EVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            ++W  P  DGG  I +Y ++  +     W+     E ++T  +VK L  G  Y+F V   N  GESE     EPI  K++ P + P   +E   ++   QS      K +    +PI  +  Q K+      D LK        RI E      +  I  +++     +++ A N+ G  S +   +  +    +L P   +G  +   ++    +I +I   G+P P  TW K    I +    +V++TR       T+ +  +  +  DAG Y + A+NR G D+  ++L V D+
Sbjct: 31770 VAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP-KPIVKWYRQGKEIIA---DGLK-------YRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHL-PKTLEGMGAVHALRGEVVSI-KIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTR-----SFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV 32048          

HSP 101 Score: 55.8398 bits (133), Expect = 3.348e-6
Identity = 111/493 (22.52%), Postives = 185/493 (37.53%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            ++WFK  +++   P+Y    +G+    IL I  A  +++G+Y             + K  VTVE      A L+K +K    VEV V +     ++                LS P+V G+W L+             G  L  S   E I     + LI+HN  +  +G+ +  A   N        V+ +P      F   L   K        KF C ++      RW +    +    R+E    G K  +V+     +D         +Y+ + ED  TS KLI+EG                 +R+    KF++ +       E+ES VF V++   +  V +F N + +     T   V    +GK H +    ++++D  QI            +S      V+ G+     KL D    +GV   +       +     ++D  +  FKDGKE+K  ++  I   G +  L +    +   G Y
Sbjct: 12619 VKWFKDGEEIVPSPKYSIKADGLRR--ILKIKKADLKDKGEYVCDCGTD------KTKANVTVE------ARLIKVEKPLYGVEVFVGETAHFEIE----------------LSEPDVHGQWKLK-------------GQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAA--NAKSAANLKVKELP----LIFITPLSDVKV-FEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEA-------KYMFEAEDKHTSGKLIIEG-----------------IRL----KFLTPLKDVT-AKEKESAVFTVELSHDNIRVKWFKNDQRL----HTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEA------MGMSSEAKLTVLEGDPYFTGKLQD---YTGVEKDEVILQCEIS-----KADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQY 13014          

HSP 102 Score: 55.0694 bits (131), Expect = 5.543e-6
Identity = 68/300 (22.67%), Postives = 123/300 (41.00%), Query Frame = 0
Query:  192 DQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKL----------IVEGDAGEITCATNKDS-------------SSSTLRVAHDNK----FVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQ 464
            D +V+E ++ +      LS  N K KW+               G E+ K ++++ I +     L+++   +++  +++     E +T  T G + V+  + E  F K L   +   T+ ++K  C +++ GA + W +    +    RYE    G K  LV+    L+DAG     +     DG+  V               I+EG+  E  C+ +K+S             S     V  D K     V + + Q+ G    +YV  V     +A +      +I+VP  DTR++ +Q
Sbjct: 13309 DLQVREKEMAR--FECELSRENAKVKWF-------------KDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSC----EVRTARTSGMLTVL--EEEAVFTKNLANIEVSETD-TIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMG----TYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQ 13582          

HSP 103 Score: 53.5286 bits (127), Expect = 1.782e-5
Identity = 32/101 (31.68%), Postives = 55/101 (54.46%), Query Frame = 0
Query:  603 VNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIG-LSDPHEISG 702
            V  +D  +PP+ + +T ISKNS  +    P  DGG++I  YI+E  D+     +W++ +  +    + I ++ L    +Y FR  A N +G +S+P E+ G
Sbjct: 27689 VLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDL--PDGRWTKASFTNVTETQFI-ISGLTQNSQYEFRVFARNAVGSISNPSEVVG 27786          

HSP 104 Score: 53.1434 bits (126), Expect = 2.312e-5
Identity = 89/389 (22.88%), Postives = 148/389 (38.05%), Query Frame = 0
Query:  235 GLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGA---NIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERE---SYVFNVQVKDPSAP--VDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGE-KAPKLGD--CGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPP 612
            G+ +  S+R      E S  L + + T+E++G++    +  +   +    + ++ P    YF K+L   K  + + S    C L  AG     + W +    L     Y+   R     LV NQ++++D+G       EY+         CK   E   GE+        S+ST     + K     S Q   V+       VF+  +   S P  V ++ +GK   P  D+        D    L +        GQ         G    S + S  +I+ E K P   D    PV  V  +  ++     V G +   I++S  KD +E++ G    I++  +   L V+   +  SG Y     N  G D     +NI ++  PP
Sbjct: 8832 GINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP---YFVKQLEPVKVSVGD-SASLQCQL--AGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSG-------EYI---------CK--AENSVGEV--------SASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISG-SEPISVSWYKDGK---PLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIG----SASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECH--VTGTQP--IKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPP 9176          

HSP 105 Score: 51.6026 bits (122), Expect = 7.951e-5
Identity = 120/508 (23.62%), Postives = 198/508 (38.98%), Query Frame = 0
Query:   83 GYVIFQIE-GDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEK--APKLGDCGPVSGVAHKDCNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY 586
            G  IF  +     P I+WFKG+ ++  EP  KT      N + L I +A  E+  +Y V ++                  G  + A L   ++     EV++   IE     E +    D     A +S  ++ G+W L+    LR   + +   E  K  RF          L +H   ++++G+  ++ +  N   T    V+ I  D  F    K +T       R  +F C+L    AN+ W++    +    +++    G+K  LV+N  + DD GV       Y  + E   TS +L V G                 +R+    KF+S +  Q    E E+  F  ++      V +F N   +     T   V    +GK H+L +  +T++D  QI+A+       K +S T    V+  +     KL D   V     KD    ++   E  K  D+ +  FKDG+E+      +I   G R  L +     +  G Y
Sbjct: 12248 GTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIE------------------GKRYPAKLTLGER-----EVELLKPIEDVTIYEKESASFD-----AEISEADIPGQWKLKGEL-LRPSPTCEIKAEGGK--RF----------LTLHKVKLDQAGE--VLYQALNAITTAILTVKEIELD--FAVPLKDVTVPE---RRQARFECVLTRE-ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGV-------YTAEVEGKKTSARLFVTG-----------------IRL----KFMSPLEDQTVK-EGETATFVCELSHEKMHVVWFKNDAKL----HTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQV------KELSSTAQLKVLEADPYFTVKLHDKTAV----EKD---EITLKCEVSK--DVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY 12658          

HSP 106 Score: 48.9062 bits (115), Expect = 4.640e-4
Identity = 83/405 (20.49%), Postives = 151/405 (37.28%), Query Frame = 0
Query:   79 EGDNGYVIFQIEGDPLPEIQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEY-VKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVAHDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGK-HQLIVHYITMED 481
            EG+    +  I  +  P +QW +  K L    +Y    +G +   +L +  A  ++ G Y V++                  G     A L   +K++  V +K         D  V+E +  +VV    ++    K KW+    A             +  S ++  + ++  YTL + +  +++   +  V+ T ++         +I  + +    + L   +T +  +SV F C +N     ++WT+NG  +P   R    V   K  L +      D G       EY V  G+D   +  LI+E                         +FV  +  Q    E +  VF+ Q+    A V ++ NG+ I  G   + E     DG  H+LI+    ++D
Sbjct: 13492 EGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIADGKKR--VLVVKDATLQDMGTYVVMV------------------GAARAAAHLTVIEKLRIVVPLK---------DTRVKEQQ--EVVFNCEVNTEGAKAKWFRNEEA-------------IFDSSKYIILQKDLVYTLRIRDAHLDDQANYN-VSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIET-MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEG-------EYIVTAGQDKSVAELLIIEA----------------------PTEFVEHLEDQTV-TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFE----KDGSIHRLIIKDCRLDD 13815          

HSP 107 Score: 48.521 bits (114), Expect = 6.332e-4
Identity = 38/123 (30.89%), Postives = 55/123 (44.72%), Query Frame = 0
Query:  586 YKIIIRNAQGFD-----ERLINVN-IMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISG 702
            + ++  NA G        RLI     ++ P PP  ++VT  SK +  ++ S P  DGG EI  YIIE     +    W +V  A+        V +L     Y+FR  A N  G  D  E++G
Sbjct: 29152 FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEM--CKADLGDWHKV-NAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTG 29271          

HSP 108 Score: 48.1358 bits (113), Expect = 8.640e-4
Identity = 71/391 (18.16%), Postives = 157/391 (40.15%), Query Frame = 0
Query:   97 IQWFKGFKDLSVEPRYKTWTNGVENTIILGIHSARQEEEGDYKVLLKNRYGEHEFEFKYFVTVEGGMDFRAMLLKRKKVQRKVEVKVHDWIETPVDQEVQENKVDKVVLTARLSIPNVKGKWYLRNAASLRSIKSTDYGLELHKSERFEWIHREDSYTLIVHNPTIEESGKFTLVAKTENQTFTTGGHVEVIPPDPEFYFEKKLMTKKTGLTNRSVKFNCILNEAGANIRWTRNGAPLPLHPRYERSVRGEKLGLVMNQLELDDAGVIGXEILEYVKDGEDDVTSCKLIVEGDAGEITCATNKDSSSSTLRVA-HDNKFVSEVSSQNEGVERESYVFNVQVKDPSAPVDFFLNGKIIVPGADTRMEVKQMGDGKHQLIVHYITMEDYGQIE 486
             +W KG ++++ + R++   +G +++++  I SA  E+E  Y    ++++              G +    + LK                 TP+ ++V   + +  V T  LS  N++ KW+  +               LH +          ++++   + +I+++ +     + E    ++   + V+  DP  YF  KL    TG+    V   C +++A A ++W ++G          + ++  K  ++                     DG+  +   K  ++ D G+ TC    D +S  L +   + K V  + S  E +E E+  F  ++ +     ++ L G+ ++   D   E+K+ G   H L++H   ++  G ++
Sbjct: 12797 FRWLKGTQEITGDDRFELIKDGTKHSMV--IKSAAFEDEAKYMFEAEDKH------------TSGKLIIEGIRLK---------------FLTPL-KDVTAKEKESAVFTVELSHDNIRVKWFKNDQ-------------RLHTTRSVSMQDEGKTHSITFKDLSIDDTSQI----RVEAMGMSSEAKLTVLEGDP--YFTGKLQ-DYTGVEKDEVILQCEISKADAPVKWFKDG----------KEIKPSKNAVIK-------------------ADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSV-EVMETETARFETEISEDDIHANWKLKGEALLQTPD--CEIKEEGK-IHSLVLHNCRLDQTGGVD 13104          
BLAST of EMLSAG00000000141 vs. GO
Match: - (symbol:ttnb "titin b" species:7955 "Danio rerio" [GO:0004672 "protein kinase activity" evidence=IEA] [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0004713 "protein tyrosine kinase activity" evidence=IEA] [GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0014866 "skeletal myofibril assembly" evidence=IMP] InterPro:IPR000719 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008266 InterPro:IPR011009 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00109 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 ZFIN:ZDB-GENE-030616-413 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0018108 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0004713 GO:GO:0014866 InterPro:IPR013098 Pfam:PF07679 HOVERGEN:HBG080472 EMBL:DQ649453 UniGene:Dr.43125 UniGene:Dr.80676 UniGene:Dr.153645 ProteinModelPortal:A5X6X6 SMR:A5X6X6 Uniprot:A5X6X6)

HSP 1 Score: 258.07 bits (658), Expect = 4.535e-68
Identity = 186/557 (33.39%), Postives = 270/557 (48.47%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIE--YKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRX-LNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            K   SG Y I   N  G     + VN++D P  PK I ++ I++ +C +   PPD DGG  IK Y IE   V   +  W++V  A     +S+ V +LI    Y FR RA NR G   PH  + +    +DP   PD P R  ++D S     L W  P++DGGAP+THY IE  + + S    +     N  DI+  T            + L EG EY FR+KAVN+ GAS PS T+  ++ K +    F+        EI++G          G P P++TW++       +   +  +    K V  +  T+L + +  RS DTG YT+      GT      +NVL  P  P   +  +EIRAE I LSW  P DDGG+ IT+Y I+   ++   W+    E K+   T++ L PGH Y F + A NK G  +P  + EP  A N + PP + ++P I      S+T+ W++P  DGG PIT Y +++K+     +  +  D          +  R+ GL EG  Y FR+ A+N AG   PS  ++P   R 
Sbjct: 11600 KLHHSGRYIITANNQAGTKIVKVRVNVLDLPGAPKDITISDITRGTCRLSWKPPDCDGGDRIKSYFIEKKTVEGKA--WTKVNPACTT--QSLVVPDLIEGQEYLFRIRAENRFGYG-PHTTTIEGTKARDPIHPPDPPTRVKIIDVSKGIVTLTWKPPKNDGGAPVTHYNIERLWWDSSGNQQESWRQCNRRDIDTTT---------FKVEDLHEGAEYEFRVKAVNEVGASRPSSTAGPIIVKDQ--NKFM--------EIEQGTDAHIVAKIKGCPFPTLTWQKAPPHKGENKVDVEYDEHINKLVADDSCTLL-IQQGKRS-DTGLYTLTASNSLGTVSKEMRLNVLGRPGAPSAPIKFEEIRAEQITLSWLPPKDDGGSKITNYTIERRVVNRKTWIPVTSEPKERLYTIENLMPGHEYIFRIRAQNKYGVGDPLDS-EPEVARNVFMPPGQCEKPTISSVTIDSMTVNWEEPESDGGSPITGYWLERKETTSKRWSRVTRDPVRPMPM--GVSHRVTGLIEGSQYLFRVSAINAAGVGPPSEPSEPTFARE 12127          

HSP 2 Score: 246.128 bits (627), Expect = 2.762e-64
Identity = 171/567 (30.16%), Postives = 281/567 (49.56%), Query Frame = 0
Query:  567 HGDRVD----LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHG---TCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            H D +D    L + +  R+ SG Y + + +  G     +NV ++D P P   +EVT ++ +SC +  SPP+ DGG+ + HYI+E  ++   +  W+ V     K   + K++NL+    Y FR  A N  G   P  ++ +  +  DP  +PD P +  VL+ S NS  + W  P  DGGA I  Y I+Y E  M    +        +E++ +     +V G   +  GL EG +Y FR+ A N  G+SLP+ET ++   K +  +P +    +  +  K G   R +    G+PAP+  W+R      G+++ +S    S+  V+  +N  + + K     D+G Y++      G  + T  + + D+P  P       +I ++   LSW  P +DGG+ IT+YV++  D+  GDW+ A+ +        G L PG  Y F V A N+ G S+P  + E + A+ P+  P EP    I   +   + + W KP  DGG P+T Y I++K++    +  +K +D+     +   E    GL EG  Y FR+ A+N+AG+  PS +T
Sbjct: 14364 HVDLIDTMTFLVISDSTRDDSGKYSLNVSSPAGEKAVFVNVKVLDTPGPVDGLEVTDMTMSSCNLTWSPPETDGGSNVTHYIVEKREIDRKT--WATVKANVEK--TTFKISNLVPGTEYYFRVVAVNEYGPGVPR-VTPKSYLASDPVSKPDPPQKVDVLEISKNSATVGWVKPMRDGGAKIDGYVIDYLELPMPKPPK------QPVEVEEEWTPYTVVKGLSISIAGLKEGRKYRFRVAARNSMGSSLPTETREAYEIKEQMFEPKIIMTEL--VTAKAGAKLRVEALVSGKPAPACQWKR------GENNVVS---SSRLAVHKSQNMCVLIIKDVSRQDSGEYSLVAENSSGKIEQTLKIIIRDIPGPPEPPFEISDIDSDACTLSWNKPTEDGGSNITNYVVEKCDVSRGDWVTALSSCGKAGCRIGKLIPGKEYIFRVRAENRFGISDPLAS-ERMVAKFPFDVPGEPLNCRINKVNKDCMFVAWDKPESDGGSPVTGYYIERKERNSLLW--VKANDSV----VRTTEYPCAGLIEGLEYTFRVSAINRAGQGKPSKKT 14901          

HSP 3 Score: 243.432 bits (620), Expect = 2.000e-63
Identity = 171/561 (30.48%), Postives = 269/561 (47.95%), Query Frame = 0
Query:  577 NPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGL-------VEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            N  R  +G Y + + N+ G     + V ++D P  P+ + +  + + +  +   PP +DGG  + HY++E  + S  +  W++ A    +   S++V +L+    Y F+  A N+ G+ + +EI   D +I     EP  P R  ++D +  S  LAW  PE DGG+ +T Y +E K K    W                     +V GT K L       VE +EY FR+KA N  G S+P E   SV+ K   ++P     GI N  +  + G +F  D+   G P P ++W+    + L ++DR+SI+         +  T LTV ++ R  D G Y + L    G++  T  VNV+  P  P   +    I +E   +SW  P DDGGT IT+Y+++  +  +  W L     K+T   V  L     Y F + A N+ G S+P  + E I AE+P+ PP  P  P +      S+++RW++P  DGG  +T Y I+KK++    W    K     C  +++       GL+EG  YQFR+ A+N AG S  S  +K
Sbjct: 24153 NCTRNDTGKYTLTLENSSGNKSISVAVKVLDTPGIPQAVSIKEVMRGALTIVWEPPTNDGGARVHHYVVEKREASRRT--WTEAAPKSTQ--TSLRVADLLEGVPYFFKVMAENQYGIGEAYEIP--DPVIATA--EPAAPKRLDIIDTTDTSVTLAWLKPEHDGGSRVTGYCVEGKAKDTDKW---------------------VVCGTTKNLSLVIEKLVENSEYEFRVKAKNDAGFSVPREAFSSVIIKEPRIEPTADLSGITNQLVTSRIGESFEIDVPISGRPTPKISWKLE-EMKLKNTDRVSIK-------STKNRTTLTVKESMRG-DGGRYFLSLENVAGSKTFTITVNVIGRPSPPEGPIEISSITSESCVISWNPPDDDGGTDITNYIVEKRESGSTAWQLINSSVKNTTFHVSHLTKYMQYTFRICAENRFGVSKPTES-ETIVAEHPFVPPGPPTSPEVFSVTANSMSIRWEEPYHDGGSKVTGYWIEKKERNTILWVRENKIPCFECYYKVE-------GLAEGLEYQFRVYAMNSAGLSKASEASK 24667          

HSP 4 Score: 240.736 bits (613), Expect = 1.244e-62
Identity = 198/654 (30.28%), Postives = 294/654 (44.95%), Query Frame = 0
Query:  517 DCGPVSGVAHKDCNWGVSYAVEGYKQSDIELS---------VFKDG-KEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDS----------------------------DRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGD--WLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPH 1127
            D  P   VA +D        VEG K  DI++          V+K G  E+K    + +    +RV L ++  K E +G Y + + N+ G     +NV ++  P   K I  + ++KNSC +   PP++DGG+ I HY++E       + + + +    G+   S  V +L+    Y FR +A N+IG  +  E+    +II++    PD P   + L+ +SNS  + W  P  DGG PIT Y IE  EK    ++            +   N  P    T  GL EG EY FR++A N  GAS PS ++  ++A      P   L       + IKKG   R D +  G P P+VTW RN   +                                DR+S E   K        T L V  A R+ D G++TI++    G   A+  VNVLD P  P     DEIR   +  +W  P DDGG+ I +Y+++  D  + D  W+    T K     V  L  G  Y F V A NK G   PC + EP+ A+N ++PP  P  P I +  + +V L W +P D+G  PI  Y +++++    ++  + ++  S       L  ++ GL EG  Y FR+ A N AG    S  T P 
Sbjct: 10105 DSAPTIDVATQDI-----VVVEGEKM-DIKIPYRAIPKPSMVWKKGDTELKTEDRLTLTCELNRVHLELLKCKHEDAGVYTVTLENSLGSVTGTVNVTVIGLPGQCKDISPSELTKNSCKISWEPPENDGGSPILHYVLE----RREAQKKTFLPVMSGENVLSFVVKDLMLNSEYHFRVKAVNKIGSGEFLELRNP-VIIEEQKQHPDPPIEVAGLNPTSNSITVTWMAPPYDGGCPITGYIIEKIEKDGDRFE------------RCVPNLVPGFSYTVTGLTEGKEYQFRVRAENIAGASDPSRSTPLIMAADPVDPPQVTLFARIASGLSIKKGEEIRLDAYISGSPYPTVTWLRNDENVRQPPAKKKPEIVKKKKKTVQPEPEEEFHPPLVDRLSYEQTKK------GETALMVRDAIRT-DHGNFTIRVENAHGFATASCDVNVLDKPGPPVNFGFDEIRNTSVVCTWDAPLDDGGSEIINYILEKKDNTSDDIGWVTVTSTHKGYNYPVTKLIEGKEYIFRVTAENKFGCGHPCYS-EPLVAKNQFEPPDAPNVPRIGEVTSSTVALSWHEPKDNGS-PILGYWVERREVNSKYWIRVNSNLLSA------LNVKVEGLMEGLVYVFRVCAENLAGPGEFSVPTDPQ 10720          

HSP 5 Score: 234.958 bits (598), Expect = 7.327e-61
Identity = 177/572 (30.94%), Postives = 272/572 (47.55%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH--QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKN-TVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW----LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP 1136
            L++    R  SG+Y I I+NA G       V  +DKP PP+ + ++ I+  S  +    P+DDGG  I HYI++  DV++ +  W  V  A  K   S+    L+   +Y FR  A N+ G S   E + + I   DP   P  P     +D       L W  P+  GG+ IT + +E++E+    W          +  KT  N  P  H T  GLVEG  Y FR+K+ N  G S P +TS  +  + + L P +      I  + +K G T        G P P+  W+  G+ L  +          K  +  E N T LT+++  R+ D+G Y++ +    G++    +V VLDVP  P   +N  E+  +H+ + W  P DDGG+P+ SYV++  D+    W    + +  +  TKA V  L+ G  Y   V A NK G      +  P  A+  + PP  P +P   D    +VT+ W +P  DGG P++ YI+++++  G W    KT        + ++  R+ GL EG  Y+FRI A N AG S PS+ + P   + + +TP
Sbjct: 12984 LHIKKCTRADSGNYTITIQNAAGSKSATCAVLALDKPGPPRNLAISEITSESAYLTWQKPEDDGGAVISHYIVQKKDVAAEN--WVPVCAASKK--LSLMAQYLMEGTQYLFRVAAENQFGRSAFVE-TNKPIKAVDPLYPPGPPKNLHHVDADKTEVWLQWEWPDRTGGSEITGFIVEHQEEGATDW----------VTFKTVSN--PQCHVT--GLVEGKTYRFRVKSQNAIGISRP-DTSVPITCQEKTLAPTIEVDVKLIEGLVVKAGSTILLPAVMLGIPTPTAKWQSEGNELKTE---------GKFKIVTEGNSTTLTISECART-DSGEYSLTVSNPAGSKSVALHVTVLDVPSAPVGPVNILEVTPDHMIIQWRAPKDDGGSPLMSYVVEKKDVKK-PWEPWSVVSSGSTSTKAKVPRLEKGREYVVRVRAENKIGIGAGLES-PPTIAKQMFDPPGPPGQPTCSDITENAVTVSWAEPETDGGSPVSGYIVERREMTGKWIRVNKTP-------VLDIRYRVCGLFEGNSYEFRIFAENVAGVSQPSYPSDPMKAK-RPITP 13515          

HSP 6 Score: 234.958 bits (598), Expect = 8.556e-61
Identity = 185/630 (29.37%), Postives = 275/630 (43.65%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            P+ P+   V  +  +S +V  + P D GG  I +YI+E  +   S+ +WS+  +         +V  L+    Y FR  A N IG  DP  +  + I+ KDP   P  P  P  +D + +S  L+W +P  DG   I  Y IEY++     W +      S  + K  V   P          EG E+ FRI AVN  G S P+   + V    R  +P   LH     +     G          G P P+V+W++N          +      + T    K   L + K  R+ D+G+YTI +    G++ AT  V  LD P  PR L   EI +E   L+W  P DDGG  I+ Y+++  D+   +W+     +K      + L  G  Y F V A N+ G S    T +PIKA +P  PP  PK  + VD D   V L+W+ P   GG  IT +I++ +++    +   KT        +   +  + GL EGK Y+FR+ + N  G S P     P  C+ K L P+I  D        +K   T +    + G P P   W   G ++ +  +  I  E    G +  L +S+    D+G YSL   N  G     L + VLD+
Sbjct: 12722 PEAPEQPTVKDVYNDSALVIWNRPRD-GGKPITNYILEKKE--PSAKRWSRATRDPIYPATQYRVQELVEGCEYEFRVTAENEIGTGDPS-VPSKPILAKDPIVLPSPPVLPEAVDKTKDSVSLSWRVPRHDGKGKIFGYLIEYQKPGAIEWVKANETPESCPDTKFVVTNLP----------EGEEFQFRIMAVNAAGKSEPAYVKEPVKVHDRLEEPELLLHANMSRDHLAMVGTDITLSATLKGMPIPTVSWKKNDG-------EVPAHCLIEVTATGSK---LHIKKCTRA-DSGNYTITIQNAAGSKSATCAVLALDKPGPPRNLAISEITSESAYLTWQKPEDDGGAVISHYIVQKKDVAAENWVPVCAASKKLSLMAQYLMEGTQYLFRVAAENQFGRSAFVETNKPIKAVDPLYPPGPPKNLHHVDADKTEVWLQWEWPDRTGGSEITGFIVEHQEEGATDWVTFKT--------VSNPQCHVTGLVEGKTYRFRVKSQNAIGISRPDTSV-PITCQEKTLAPTIEVDVKLIEGLVVKAGSTILLPAVMLGIPTPTAKWQSEGNELKTEGKFKIVTE----GNSTTLTISECARTDSGEYSLTVSNPAGSKSVALHVTVLDV 13313          

HSP 7 Score: 230.72 bits (587), Expect = 1.636e-59
Identity = 196/667 (29.39%), Postives = 300/667 (44.98%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIK--DPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDI--EIK------TDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G  E L +  ++ K     PD PK +EV+++ K+S V+    P +DGGT I  YIIE  D      +W++          + KV +L+  H Y FR  A N  G+S   E S   +  K  DP  +P  P  P VLD + +S  LAW  P  DGG  I  Y +E  E      +    +       EI+      T   G  +   T + L E  EY FR+ AVNK G    ++ +  +  + +  +P L     +   + IK G + R  I F G P P + WE++G  +    +   IE  S         T L + K +R +++G YT+      G +  T  V VLD P  P      EI  E + L+W  P  DGG  I +Y+I+  +        A+ T   K +  V+ L+ G  Y F V+A N+ G   P    +P+K     + P  P + ++VD    SV+L W+KP  DGG  I  Y+++ + K    W        + C A +  LEA I  L+ G+ Y FR+IAVN+ G+S P     P   +     P   + + SS ++ V +    +I V G P P+  W K+G  +  T  V I+        +  L + ++   D G Y +   N  GQ    +++I LD
Sbjct: 18428 FRVLAVNKFGVGEPLQSGAVVIKNPFTPPDAPKGLEVSNVKKDSMVLTWEAPTNDGGTTITGYIIEKHD--KEGVRWTRCNMKSVTN-LTFKVTSLMENHLYEFRVSAENAAGVS---EASSATVFYKALDPVFKPGPPHNPKVLDMTKSSVVLAWGKPIYDGGCEIQGYVVEACEARAAPEETKTSVEEGKAAEEIQEQWTMCTPPTGVKLTRFTVENLKEKQEYKFRVCAVNKLGVGEHADVAGPICPEDKTEEPDLDIDAEFRKLVRIKAGGSLRMFIPFKGRPTPQIKWEKDGEQI---KESAQIETSS-------SYTSLVIDKVSR-VNSGKYTVTAENSTGAKSETIMVKVLDTPSAPLNFKVKEITKESVTLTWEPPSLDGGAKIKNYIIEKRE-STRKTFAAVVTNCHKLSWKVEPLQEGCSYYFRVLAENEHGVGLPADIADPLKIS---EVPQCPGKLSVVDVTKTSVSLSWEKPIHDGGSRILQYLVEMQVKGNEKW--------SGC-ANVKTLEAVISNLNPGEEYTFRVIAVNEKGKSDPRTLAVPVQAKDLVFGPDA-RPTFSSYSVLVGKDLQVEIPVFGRPKPKVQWTKDGAALKFTTRVNIS----NTARSTVLSIKEAAREDGGMYGINVSNAVGQKDATIEIITLD 19059          

HSP 8 Score: 226.868 bits (577), Expect = 2.420e-58
Identity = 190/675 (28.15%), Postives = 298/675 (44.15%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGF-------DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP--KSIKVN--NLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDAS---CEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATA----KLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            K E  G+Y+  I+    +        E+++  +    P PP+   +   +++S VV   PP D+GG+ I+ Y +E  +    +  WS+V +A    P  K ++ N  +LI    Y+FR  A N  G+  P E +            P +P  P V D S +S  L+W  P+ DGG+PI  Y +E +++    W++   +NT D  I T+         T  GL E  +  FRI AVN  G S PS  +  ++ +    +P +         +  + G T +      G+P P+VTWE +G+      +              +  +V+T+ ++     +G Y I      GT+     VNVLD+P  P+ +   +I      LSW  P  DGG  I SY I+   ++   W        T++  V  L  G  Y F + A N+ G      T+E  KA +P  PP  P    I+D     VTL W+ P +DGG P+THY I++      W+D+      S   C  R ID    ++  L EG  Y+FR+ AVN+ G S PS    P + + +N    I++G+ +              K+KG P P  TW K        ++V +  +E+     A     L + + +  D G Y+L A N  G    ++ L VL
Sbjct: 11288 KLEAYGTYQFQIKAENKYGISDGCESEKVVLKDPFGLPGPPQRPRIISHTRSSMVVTWEPPKDNGGSTIQGYWLEKRE--RGAVYWSRVNRAPVTKPAVKGLEYNVLHLIEGAEYKFRVMAQNAAGVGPPSEATEYP---------PSQPPAPVVTDKSPSSVSLSWTPPDRDGGSPIKGYIVEVQDEGSHEWKR---INTPDKLILTN-------SYTVPGLKENKKCRFRIVAVNAAGESEPSPRTSDIIVQDILEEPVITIDVTSQELLNCRAGTTLKIPATISGKPLPNVTWEFDGTAPSEKKNERHTLPVDSDISSSDTTSVVTIPESKLH-HSGRYIITANNQAGTKIVKVRVNVLDLPGAPKDITISDITRGTCRLSWKPPDCDGGDRIKSYFIEKKTVEGKAWTKVNPACTTQSLVVPDLIEGQEYLFRIRAENRFGYGPHTTTIEGTKARDPIHPPDPPTRVKIIDVSKGIVTLTWKPPKNDGGAPVTHYNIERL-----WWDSSGNQQESWRQCNRRDIDTTTFKVEDLHEGAEYEFRVKAVNEVGASRPSSTAGPIIVKDQNKFMEIEQGTDAHIV----------AKIKGCPFPTLTWQKAPPH-KGENKVDVEYDEHINKLVADDSCTLLIQQGKRSDTGLYTLTASNSLGTVSKEMRLNVL 11924          

HSP 9 Score: 224.557 bits (571), Expect = 1.450e-57
Identity = 179/657 (27.25%), Postives = 289/657 (43.99%), Query Frame = 0
Query:  586 YKIIIRNAQG------FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI--DKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++  RN  G       DE +   N  D PD P+   V  +++    V   PP  DGG+E+  YIIE  D +S   + + V +A+     +  +++++    Y FR RA N+ G+  P   +   + I DP + P  P   +  + + +S  L+W  P S+GG+ IT Y IE  E     W            ++ +    P ++    GL  G +Y +R+ A N  G S P++    +LA   ++ P +   G  N +E+         +   G P P   W   G   L   DR+S+     K  Y E    L V  + R  D G YT++L  D  +      +NV+  P  P+     E+   H++L W  P  DGG+P++ Y ++  ++    W+  +   +D + TV  +  G  Y F VIA NK G  EP    EP+   +P   P  P+     D   +S+ L W+ P  DGG  +  YI+ K  +    ++A       C   I EL+ ++ GL EG+WY +R+ AVN+ G S P   T   L       P I  D    +  T +          V G+P P   W K  + +   + + I  +   G +T  L ++ +   D  TY + A N +G+    +D+ +LD
Sbjct: 8883 FRVCARNRVGNGETVTTDEAVQAKNKFDVPDAPQKFMVGVVNRFGATVSWEPPLFDGGSEVTSYIIELRDRTSVKWEPAMVVKAEDL---TATLSDVVENKEYIFRVRAENKAGIGQPSAAT-DPVKIMDPIERPSPPLNFNYTNQTRDSVQLSWETPISNGGSMITGYIIEKCEDGTDKW------------LRCNARLCPDLYYRVSGLKFGQKYHYRVCAENAAGVSEPADAIGPLLADDPHVGPTIDLSGFKNGLEVIVPNALIIKVPITGYPVPKPKWTF-GDKELTAGDRVSM---VTKPTYTE----LVVAPSVRP-DKGTYTLQLENDVTSVSGEIEINVIACPSAPKDFKVAEVTRHHVHLMWEAPEHDGGSPVSGYNVEKREVSRKTWVKVISGVQDLEYTVTDVIEGKEYLFSVIACNKCGPGEPAYIDEPVNVSSPATVPDPPELLKWRDKSAKSIFLLWEPPRYDGGAAVKGYIVDKCQRGTDKWEA-------CGDPIPELKFQVTGLIEGQWYAYRVRAVNRLGASRPCKATDEILAVDPKEPPEIQLDAKLLAGLTARAGTKIDLPADVLGKPEPRVKWTKADLVLKPEERITI--DTKPGHST--LSIANTTRSDTATYIIEAVNTSGRATATVDVNILD 9503          

HSP 10 Score: 222.631 bits (566), Expect = 5.464e-57
Identity = 185/662 (27.95%), Postives = 285/662 (43.05%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGL-----WQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGI-YNIEIKKGRTFRYDI------WFGGEPAPSVTWERNGS---LLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDE----------LEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            E +I      +P  P   EVT I+K++ VV    PD+DGG  I  YI+E  +    + +W+ V ++   G + + V +L+  H Y+FR +A N IG+ D  + S +    +DP + P       V D S  S  LAW  P  DGGAP+  Y +E + K  G      W++    N +   I T+         T   L E  EY FR+ A N+ G S P+    +V  K       L  P I  + E+KKG T R            G PAP V W R G    +  G  D I    F            L ++ + R  D+G Y++ +    G +     V VLD P     L   ++     NL+W+ P  DGG+ +T Y+++  +ID   W       + T   +  L PG  Y F V+AVN+ G   P  T +   A +P   P  P++ ++++    S T+ W KP  DGG  I  Y+I        + +            ++E          L   I GL EG+ Y+FR+ A N  G S P+   + +  + +   P I    +   T K       +  V G+P P   W +    + S+  + +    ++      L +      D+G YSLVAEN +G+ +  L +I+ D+
Sbjct: 14096 ESIIARTQFSRPGAPDAPEVTKITKDTMVVMWCSPDNDGGKPITGYILEKKE--EHAIRWAPVVKSPYAGTQ-MTVTSLLPNHEYQFRVKAENEIGVGDASKPS-RTFTARDPVEPPGPVSNLKVTDSSKTSITLAWTKPTYDGGAPLIGYVVEIRVKGTGKKGDEGWKR---CNVAAQLIGTEF--------TVSSLDEKLEYEFRVSAQNQVGMSQPTNLEGAVTPKE-----VLEAPEIDLDAELKKGLTVRAGCPIRLVATIRGRPAPKVLWRRMGKDNVVQKGHVDLIDTMTF------------LVISDSTRD-DSGKYSLNVSSPAGEKAVFVNVKVLDTPGPVDGLEVTDMTMSSCNLTWSPPETDGGSNVTHYIVEKREIDRKTWATVKANVEKTTFKISNLVPGTEYYFRVVAVNEYGPGVPRVTPKSYLASDPVSKPDPPQKVDVLEISKNSATVGWVKPMRDGGAKIDGYVID-------YLELPMPKPPKQPVEVEEEWTPYTVVKGLSISIAGLKEGRKYRFRVAARNSMGSSLPTETREAYEIKEQMFEPKIIM--TELVTAKAGAKLRVEALVSGKPAPACQWKRGENNVVSSSRLAV----HKSQNMCVLIIKDVSRQDSGEYSLVAENSSGKIEQTLKIIIRDI 14711          

HSP 11 Score: 220.705 bits (561), Expect = 2.221e-56
Identity = 168/563 (29.84%), Postives = 272/563 (48.31%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDP---PKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            R + G Y I  +N  G  ++ + V ++D P P   P T E  +++  SC +    PDDDGG+ I +YIIE  +    +  W+  +   G+  ++  VNNL+ K  Y FR  A N IG+  P   +  +I+IKD  + PD+P    V   + +   L W  P++DGG+ +T Y +E   +++G  +   +     +E +           T  GL EG  Y FR+ AVN+ G   PS ++  +  K     P +       + ++ G +F     + G+PAPSVTW R+   L  D+    I+  +  T  C     L + KA R   +G Y + +    G ++    V V D P  P   +  DE+  +H+ +SW  P DDGG+ I++Y+I+  D++   W             V  L  G  Y   + A N  G S+P  + E +KA++ ++ P  P++P + D  N S  + W +P  DGG+PIT+YI++KK+       A +   A+ +      + R+  L EG  Y+FR+ A N+ G   PS  +KP L +   + PS
Sbjct: 12297 RAQRGVYTITAKNDGGEVKKSVIVEVLDVPGPVGVPFTAE--NLTSESCKLNWFFPDDDGGSAISNYIIEKREAERKA--WTSCSYTAGR--QNAVVNNLVLKKAYFFRVAAVNAIGVG-PFNQTACEIVIKDRINVPDRPEELEVTAITKDHISLTWKPPKNDGGSEVTSYILE--ARTIGKDKFVRLTKDKLMERRY----------TYDGLREGETYEFRVSAVNEVGPGKPSFSTKPITCKDELEPPTIELDFRDKVVVRVGESFALQGRYTGKPAPSVTWSRDDKELKADNH---IKFKNTLTTMC-----LGIVKAQRG-HSGKYCVTVENCTGARKGICNVIVADRPLPPEGPVVFDEVHRDHMVISWKPPLDDGGSEISNYIIEKRDVNRDMWTTVTSATTKTHCKVPKLVEGREYILRISAENMYGISDPLES-EEMKAKDLFRVPEAPEQPTVKDVYNDSALVIWNRPR-DGGKPITNYILEKKEP-----SAKRWSRATRDPIYPATQYRVQELVEGCEYEFRVTAENEIGTGDPSVPSKPILAKDPIVLPS 12824          

HSP 12 Score: 219.55 bits (558), Expect = 4.632e-56
Identity = 188/685 (27.45%), Postives = 292/685 (42.63%), Query Frame = 0
Query:  586 YKIIIRNAQGFDE------RLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKS-IKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP---SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQI------------------------ASTDEVLITR---EEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            +++   NA G  E       ++  +    P PP  + V  +SK    +K  PP+ DGG  I  Y+IE  +      +W  V      GP+S  +V ++      +F+ RA N  G+  P E +   + I+D    P  P    ++D S    ++ W  PE +GG+PIT Y +E  E     W +       ++  K +           +G++   +YV R++A+N  G S PSE SD V AK     P +      +I + +G      I +   P PS+ W++ G   L   DR+        T+ CE N V       +  D G YT+ L    G+   T  V V+ +P + + ++P E+      +SW  P +DGG+PI  YV++  +     +L  M  ++  +  VK L     Y F V AVNK G  E      P+  E   + P  P E   ++  + S+T+ W  P  DGG PIT YII+K +K G  F+    +       +      + GL+EGK YQFR+ A N AG S PS  T P +     + P   ++    +S  +IK          + G P P  TW +N   +                              L+ R   E+ + G TA L V  +   D G +++  EN +G      D+ VLD
Sbjct: 9876 FRVAAENAVGISEFCELEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLKWEPPNSDGGRPITKYVIEKKE--KVGTRW--VKSGKTSGPESKYRVTDVDEGTEVQFQVRAENEAGVGHPSEPT-VIMTIEDAISPPSPPLEVKIVDASREHINITWKAPEKNGGSPITGYHVELSEAETEKWMRINPRPVKELGFKAE-----------EGIIPEKKYVLRVRAINAIGVSDPSEISDGVFAKDPDSAPTIDV-ATQDIVVVEGEKMDIKIPYRAIPKPSMVWKK-GDTELKTEDRL--------TLTCELNRVHLELLKCKHEDAGVYTVTLENSLGSVTGTVNVTVIGLPGQCKDISPSELTKNSCKISWEPPENDGGSPILHYVLERREAQKKTFLPVMSGENVLSFVVKDLMLNSEYHFRVKAVNKIGSGEFLELRNPVIIEEQKQHPDPPIEVAGLNPTSNSITVTWMAPPYDGGCPITGYIIEKIEKDGDRFERCVPN------LVPGFSYTVTGLTEGKEYQFRVRAENIAGASDPSRST-PLIMAADPVDPPQVTLFARIASGLSIKKGEEIRLDAYISGSPYPTVTWLRNDENVRQPPAKKKPEIVKKKKKTVQPEPEEEFHPPLVDRLSYEQTKKGETA-LMVRDAIRTDHGNFTIRVENAHGFATASCDVNVLD 10526          

HSP 13 Score: 217.238 bits (552), Expect = 2.327e-55
Identity = 186/659 (28.22%), Postives = 295/659 (44.76%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKN---TVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKAT--VKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N+ G  E +   +I+ K     P  P+ IEVT+I+K+S  +  S PD DGG+EI  YIIE  D   S  +W++  +         +V+ LI  H Y FR  A N  G+ +P  +        DP  +P  P   +V+D + NS  +AW  P +DGG  I  Y +E  +     W            + T   G  +       LVE  EY  +I A+NK G   P     +V  + +   P +H        I ++ G + R ++ F G P P + W ++   L            S+KTV  EK    T L++   +R  D+G YT+ L    G+      V VLD P  P  L   +I+ + + L W  P  DGG  I +YV+   +     +   + TK +K T  V+ L  G +Y F V+A N+ G   P  T    KA    + P   ++  + D    S +L W KP DDGG  I  Y+I+ + K         TD       +   E  + GL+ G  Y FR++A N+ G+S P     P +     + PS+ K   ++ ++K  +    +I + G P P+ TW K+G Q+  T  V  +        +  L ++++   D G Y++ A N       D+++++LD
Sbjct: 19529 FRVMAANSYGIGEPIDAPSIIMKDPFIHPGSPQIIEVTNIAKDSMTICWSAPDSDGGSEIIGYIIEKRD--RSGIRWTRCNRQKVTD-VCFRVHGLIEDHEYEFRVSAENASGIGEPS-LPTSYYKACDPKYKPGSPMHANVVDTTKNSITVAWGKPLNDGGCAIQGYIVEICKAEEEEWT-----------MCTPPTGLRVNKFEITKLVEQQEYKIQICAINKLGVGEPVVIPGTVKPEDKLETPEIHLDSELRKGIVVRAGGSVRINVPFRGRPTPDIKWTKDEGEL------------SEKTVL-EKGLNFTHLSIDSCDRR-DSGKYTVTLQNSSGSVSEFVTVKVLDTPGAPLNLVVKDIKKDSVTLVWEPPLIDGGAKIKNYVVDKRESTRKAYAN-VTTKCSKTTYKVENLAEGAMYYFRVMAENEYGVGVPVETKTASKAS---EVPQPVRKVMLTDVTKISASLAWDKPEDDGGSRIAGYLIEMQPK--------GTDKWGVATNVKTCEGTVTGLTSGHEYLFRVLAYNEKGKSEPKPLAAPVIANDLTIEPSL-KLQFNTYSVKSGKDFKLEIPIFGRPKPKITWSKDGQQLKVTSRVTTSNTP----TSTILQITEACKDDLGKYAVTATNSVCAITEDINIVILD 20141          

HSP 14 Score: 213.386 bits (542), Expect = 3.572e-54
Identity = 161/545 (29.54%), Postives = 248/545 (45.50%), Query Frame = 0
Query:  604 NIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFR-------YDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSI 1138
            N+ D P PP+ + + H   +S  +    P   GG+ I  Y +E  +   +S  W +   A  K  +  KV  L     Y FR  A N  G+  P   +   + +    D  D PG+P V+  + ++  L W  P+ DGG  +T Y +E ++    +W +   +N  D               T   L EG +Y FRI+A N  GA S PSE +D+++    Y  P +    I +  +K+G T +             G+P P+  W + G      SD   IE           ++ L +  A+R  D+G YTI      G ++    V +LDVP  P  +    I +E + L+W  PH+DGG+PI SY+++  +     W + A    D       L  G+ Y F V AVN  G  +   +  P+K  + Y PP  P +P + +    SVT+ W++P+DDGG  IT Y+++KK+K G  W  A K         I +L   + GL EG  Y+FR+ A NKAG   PS  + P + +   + P +
Sbjct: 15897 NVPDSPPPPQVMSMRH---DSATLTWFDPRKTGGSPITGYHVEFKE--RNSMLWKRANSAPLKM-RDFKVTGLTEGLEYEFRVMAINLAGVGRPSPPTEPLVAL----DAIDAPGKPDVICITRSTVTLQWTEPQYDGGHRLTGYIVERRDLPAKVWVKANTVNVIDCAY------------TVADLQEGCKYEFRIRAKNAAGAISQPSEQTDTLMCTDEYAAPTI----IIDPTVKEGLTVKSGDTIVITATSILGKPQPTSVWSKGGKYF-KPSDVCQIET-------TPSSSTLFIKYASRK-DSGEYTITASNPFGVKEENVKVTILDVPGPPGPVEASGISSEKVTLTWTAPHEDGGSPIKSYILEKRETSRLLWTILAENVIDCHFVANKLIQGNEYIFRVSAVNNSGAGDASHS-GPVKMVDSYGPPGPPAKPEVENVAGNSVTIAWKRPADDGGSDITGYMVEKKEKKGMRWTRASK-------KTIADLHFEVKGLKEGVEYEFRVAAENKAGFGEPSEPSIPVMTKLVAVNPRV 16398          

HSP 15 Score: 213.001 bits (541), Expect = 4.129e-54
Identity = 188/659 (28.53%), Postives = 290/659 (44.01%), Query Frame = 0
Query:  586 YKIIIRNAQG-----FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAME-TKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKK----DKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G     F E +   N    P  P   E + I+K+S  +  + P+ DGG EI  Y +E  D      +W++  +         KV  L   H Y FR  A N  G+ +  ++S     I +    P  P  P V D+SS+S  L+W  P SDGGA I  Y +E KE S   W            I T   G      T + L E  EY FR+ A+N  G   PS+   SV A  +   P +         + ++ G + R  I   G P PSV WE+    L   ++R  IE  S         T+L +   NR  D+G Y + L    GT+ A   V VLD P  P+     +++ + + L W  P  DGG  IT+YV++  +     +         T   V  L+ G I+ F V AVN+ G      T  PIK     + P  P +  +VD    SVTL W KP+ DGG  I  Y ++ +    DK+G           SC  ++   EA +  L+  + Y FRIIA+N+ G+S P     P + ++  + PS+     ++ ++K       ++ ++G P P  +W K+G+ +  T  + I         ++K+ + ++ +   G Y +   N  G   TD+ ++VLD
Sbjct: 20611 FRVMAVNKYGIGEPLFSEAITARNPYKPPSAPSAPEASEITKDSITLSWNAPESDGGAEITCYHLEKRD--KDGVRWTKCNRQKLTD-LHFKVTGLSEGHFYEFRVSAENETGVGECSDLSLFYRAI-NATTPPGPPHHPKVTDYSSSSVSLSWGKPASDGGAYIKGYIVEMKEVSSEEWI-----------ICTPPAGIQASRLTIENLKENAEYNFRVCAINSEGVGEPSDVHGSVTASEKIEAPEIELDADLRKVVSVRAGGSLRLFITIRGRPEPSVKWEKEDGTL---TERAQIESTS-------SYTMLVIDNVNR-FDSGKYVLTLENKSGTKSAFVNVRVLDTPSSPQKFEVKDVKKDSVTLYWDPPLTDGGAKITNYVVEKRESTRKAYTTVTSNCTQTSFKVDELQEGGIFYFRVCAVNEYGFGVMAETKNPIKVA---QVPMPPGKITLVDVTKSSVTLTWVKPAHDGGSKIICYNVEMQPKSSDKWG----------VSCTVKVP--EATVSNLTPNETYSFRIIAMNEKGKSEPQELGVPVVAKNIEIEPSVHL-LFNTYSVKAGDDLTVEVPLRGRPKPVVSWKKDGLPLRQTTSLSI----INTMVSSKIVIKEAAIEHVGKYEITLANTAGTKSTDIAIVVLD 21223          

HSP 16 Score: 212.616 bits (540), Expect = 5.958e-54
Identity = 186/659 (28.22%), Postives = 284/659 (43.10%), Query Frame = 0
Query:  586 YKIIIRNAQGF-----DERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTC---KGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++++  N  G       E +I  N    P PP+T E+T ++K+S V+    P  +GG+EI +Y IE  D    S +W +  +         K+  L+  H Y FR  A N  G+S+P   S   +   D   +P  PG P +LD +S+S  LAW  P  DGG+ IT Y +E              +  ++ E  T V+ K  V GT      L E  EY   + A+N  G    +    S  A+ R + P           + I+   T R  +   G P P V W R     L   DR +IE  S         T L V   NR  D+G Y + +    GT+  +  V VLD P  P+ L   ++  E ++L W  P +DGGT I +Y+++  +     +         T  TV  L+ G  Y F V+A N+ G   P  T E +K     + P  P +  + D    +VTL W+KP  DGG  +  Y+++ + K    W  A+          +   EA I GLS G+ Y FR+ A N+ G S P     P + +   + PS+ K   S+ T+         I     P    +W K+ + +  T  V  +  + +      L + ++   D G YS+   N  G+   D+ ++VLD
Sbjct: 17344 FRVMAVNKYGVGEPIESEAIIAENPYVPPGPPQTPEITAVTKDSVVICWGAPASNGGSEITNYRIERRD--RISLRWVKCNKKKVTD-LHFKITALVPGHEYEFRVFAENAAGISEPSP-SSPFVKATDALFKPGPPGNPRILDTTSSSITLAWNKPIYDGGSEITGYMVE------------TCIPGTEEEEWTIVSPKDGVKGTSFTITNLKENQEYKINVSALNSEGVGEAAPVPGSPKAEERLIAPEADLDADLRKIVNIRACNTLRLFVPIKGRPTPEVKWSRENDEPL---DRATIETTS-------SFTSLVVGNVNR-FDSGKYNLTVENSSGTKTVSVIVRVLDTPGAPQNLKISQVTKESVSLIWDPPINDGGTKIKNYIVEKREATRKAYATVNSNCHKTNWTVDQLQEGCNYYFRVLAENEYGIGLPIETGESVKVS---EKPLPPGKITLQDVTKTTVTLSWEKPEHDGGSRVVAYVVEMQSKGSEKWSQAVI---------VKVPEAVISGLSPGEEYMFRVSARNEKGTSDPRQIGVPVIAKDLVIAPSV-KMLFSTFTVLAGEDLTIDIPYNARPKATISWIKDAVPLKRTTRVNFSSTDKE----LNLVIKEACRDDVGQYSIKLSNTAGETTVDIGIVVLD 17958          

HSP 17 Score: 210.69 bits (535), Expect = 2.627e-53
Identity = 168/556 (30.22%), Postives = 264/556 (47.48%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSS-----NSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            R  +G Y + + +  G     + V ++D P PP  + +   SK+S  +    P  DGG+EI  YI++  D    +  WS V  +  K   S K+ +L     Y FR  A N+ G+ +P E         D     ++PG   V+D+ +     +SC L+W  P SDGG+ I  Y +E             +LN  D + K  +  K M + + K LVEG EY +R+ A N  G     E S  VLAK   + P      + N+    K+G   R  I   G+P P+V+W++     L D+ R+ +E  +        NT L +    R+ D   YTI L    GT+++T +V V+  P  P   +   E+ A+   L W+ P DDGG+ + +Y+++  D     W+    +  T +  V GL  G  Y F V A NK G  E  ++ EP+ A++P+  P  P  P ++   + S TL W  P   GG PIT Y ++ K++    +   + + A  + R    + ++ GL+EG  Y+FR++A+N AG   PS  T+P
Sbjct: 15480 RYDAGKYILNLDSVSGMKMYTVIVKVLDTPGPPLNLMIKETSKDSASILWDEPLIDGGSEITGYIVDKRDAERKA--WSNVTTSCTK--TSFKIEDLEPGRSYCFRVLAQNQYGIGEPCETV-------DAVRASEQPG--PVMDFKTLLVTKDSCTLSWKKPISDGGSRIIAYVLE-------------VLNGED-KWKELLRSKNMQY-SAKDLVEGREYKYRVFATNDSGDGPVKELS--VLAKDINVLPSCDLRDLPNLNYIAKEGSNVRLKIPIIGKPTPAVSWKKGEDENLTDTGRVCVESTAV-------NTTLLIRDCQRT-DASKYTITLRNSAGTKESTIFVRVVGKPGIPNGPIKFKEVTADGATLKWSAPKDDGGSEVINYILEKRDSITNMWVTVSSSVVTNSFRVTGLHEGTEYIFRVSAENKYGIGEGLKS-EPMVAKHPFNVPDSPPPPQVMSMRHDSATLTWFDPRKTGGSPITGYHVEFKERNSMLWK--RANSAPLKMR----DFKVTGLTEGLEYEFRVMAINLAGVGRPSPPTEP 15990          

HSP 18 Score: 209.92 bits (533), Expect = 4.571e-53
Identity = 166/581 (28.57%), Postives = 256/581 (44.06%), Query Frame = 0
Query:  554 KEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPG--IYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            KE+  G  V++       +L V    R   G+Y + + N        I +N++  P  PK  +V  ++++   +    P+ DGG+ +  Y +E  +VS  +  W +V    G       V ++I    Y F   A N+ G  +P  I  + + +  P   PD P      D S+ S  L W  P  DGGA +  Y ++  ++    W   E       E+K  V G          L+EG  Y +R++AVN+ GAS P + +D +LA      P +      +  +  + G          G+P P V W +   L+L   +RI+I+           ++ L++    RS DT  Y I+ +   G   AT  VN+LD P  P   +  EI  E   L+W  P DDGG+P+ +Y+++M   D  +W     T K T      L P   Y F V A N+ G   P   + PI A+  +  P  P      D    +VTL W +P +DGG PIT Y +++ D +   W  + K         I +   R+ GL   K Y+FR++A N AG+  PS ET P L +
Sbjct: 9154 KELTAGDRVSMVTKPTYTELVVAPSVRPDKGTYTLQLENDVTSVSGEIEINVIACPSAPKDFKVAEVTRHHVHLMWEAPEHDGGSPVSGYNVEKREVSRKT--WVKVIS--GVQDLEYTVTDVIEGKEYLFSVIACNKCGPGEPAYID-EPVNVSSPATVPDPPELLKWRDKSAKSIFLLWEPPRYDGGAAVKGYIVDKCQRGTDKW---EACGDPIPELKFQVTG----------LIEGQWYAYRVRAVNRLGASRPCKATDEILAVDPKEPPEIQLDAKLLAGLTARAGTKIDLPADVLGKPEPRVKWTK-ADLVLKPEERITIDTKPG-------HSTLSIANTTRS-DTATYIIEAVNTSGRATATVDVNILDKPGPPAAFDISEITNESCCLAWNAPRDDGGSPVANYIVEMRPTDKEEWQKLSATIKQTAFKATKLVPLKEYVFRVSAENQYGIGTPAEHV-PIVAKYSFDTPGAPTRVQPSDITRDAVTLTWYEPDEDGGSPITGYWVERFDPETDKWIKSNKLP-------IKDTTFRVKGLPTKKKYKFRVLAENLAGQGKPSVETDPVLIK 9699          

HSP 19 Score: 209.534 bits (532), Expect = 5.283e-53
Identity = 159/530 (30.00%), Postives = 243/530 (45.85%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW--LXAMETKD-TKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            ER++     D P  P    +  ++K+   V    P+ DGG+ +  Y IE  +   +S  W +   +  +  +      LI    Y FR  A NR G   P + +   I  + P D    PG+P VLD + N+  L W  P++DGG+ I  Y +E        W          +   T     P    T  GL EG  Y FR+ A      S PSE +D +L     + P +         + +K G     +    G+P P VTW +NG  L  D +    ++  K+ ++    ++  VTK    +  G+Y I      G   A   + +LD+P  P  +  DEI ++ + LSW  P  DGG+PIT+YV+   +    +W  + A  ++D T+ +V+ L  GH YQF V A N  G  +   + EP+ A NP+  P     P + +   + +T+ W++PSDDG  PI  Y+++K++ K   W    K +      R  E    + GLSEG  Y+FR+IAVNKAG   PS
Sbjct: 14801 ERMVAKFPFDVPGEPLNCRINKVNKDCMFVAWDKPESDGGSPVTGYYIERKE--RNSLLWVKANDSVVRTTE-YPCAGLIEGLEYTFRVSAINRAGQGKPSKKT-DFITARTPVD---APGKPEVLDVTKNAVSLVWTKPKNDGGSKIIGYYVEAMRLPGDTW----------VRCNTSSQNVPREEYTATGLEEGANYQFRVIAKTAVNISRPSEITDPILVSAENVPPRIELSVQMKKMLPVKAGSDVCLEAEVFGKPMPKVTWSKNGETLKADKE---FKMSQKRHLFSL--SLDAVTK----LHAGNYGIHAANASGNTTAEIQLKILDIPGPPASVKLDEILSDRVKLSWEAPLVDGGSPITNYVVDKRETSRAEWAQVSAKISRDTTECSVERLIEGHEYQFRVRAENHYGTGDAIIS-EPVVARNPFTVPGACDPPVLTNITKEHMTVSWKEPSDDGKSPILGYLVEKRETKEVNW---TKINRKPLLERTLE----VGGLSEGAQYEFRVIAVNKAGLGKPS 15296          

HSP 20 Score: 209.149 bits (531), Expect = 6.650e-53
Identity = 160/530 (30.19%), Postives = 241/530 (45.47%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            E ++       P PP T +V   +K++  +  + P  DGG+E+  Y +E  +   +S  W ++++    G    K   L +   Y FR  A N  G+  P + S + ++  DP D    PG+P  +  S N+  + W  PE DGG  IT Y +E ++   G W +    N  +               T  GL +   Y FR+ A N  GA S PSE SD ++ K   ++P +     +   + +K G  F+ +    G+P PS+ W ++G           +E  SK  +   + T   + K +   D G + +     GG  +    V VLD P  P+  L   +I AE   L+W  P DDGG  I  YVI+  +     W   A E +  +  V  L  G+ Y F V+AVNK G  EP  + E I AENPY PP  P+ P I      SV + W  P+ +GG  IT+Y I+++D+    W    K        ++ +L  +I  L  G  Y+FR+ A N AG S PS
Sbjct: 16965 EAVVAAYPFKAPGPPGTPKVVAFTKDTMTIGWNEPVSDGGSEVIGYYVERKE--RNSIVWHRISKTMVVG-NLFKSTGLEDGVAYEFRVFAENIAGIGKPSKAS-EPLLALDPVD---PPGQPVPVLVSKNAITIQWTKPEYDGGFKITGYTVEKRDLPAGRWMKANFTNIIETTF------------TISGLTQEASYEFRVLARNSAGAVSNPSEPSDPIICKDDVVEPRIMVDAKFKDVVLVKAGELFKLEADVAGQPLPSMVWTKDGK---------DVENTSKLQIKMTELTAALINKDSIRKDGGEFILTATNVGGFAKHVFNVKVLDRPGPPQGPLAVSDITAEKCVLTWKPPTDDGGANIEQYVIEKRESSRLAWTNVASELQVNQYQVTKLLKGNEYIFRVMAVNKYGVGEPIES-EAIIAENPYVPPGPPQTPEITAVTKDSVVICWGAPASNGGSEITNYRIERRDRISLRWVKCNK-------KKVTDLHFKITALVPGHEYEFRVFAENAAGISEPS 17458          

HSP 21 Score: 208.764 bits (530), Expect = 8.443e-53
Identity = 177/664 (26.66%), Postives = 285/664 (42.92%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI----KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK------GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRX-LNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            ++I  +N  G  + L     +  N+   P   +   ++ ++ +S  V    P+ DGG+ I  Y +E  +  ++S +WS+V + D   P  +    +V  LI   +Y FR  A N  G+  P E S      +          +  V DW+  + DL W  P  DGG+ I  Y +EYKE+    W + +           +V G   V     GL E   + FR+ A+N  G   P E +D++  K R + P L      ++ +K+      G   R   +  G+P P +TW R       D   +  E   + T       +   T+A R    G YTI    DGG  + +  V VLDVP         + + +E   L+W  P DDGG+ I++Y+I+  + +   W     T   + A V  L     Y F V AVN  G     +T   I  ++    P  P+E  +       ++L W+ P +DGG  +T YI++ +      F  L  D      ++ E      GL EG+ Y+FR+ AVN+ G   PSF TKP  C+ +   P+I+        ++V  +   Q +  G+P P  TW ++  ++ + + +           T  L + K+Q   +G Y +  EN  G  K   ++IV D
Sbjct: 11999 FRIRAQNKYGVGDPLDSEPEVARNVFMPPGQCEKPTISSVTIDSMTVNWEEPESDGGSPITGYWLERKE--TTSKRWSRVTR-DPVRPMPMGVSHRVTGLIEGSQYLFRVSAINAAGVGPPSEPSEPTFAREPIAPPSPPTPK--VTDWTKTTADLEWIPPLKDGGSKIIGYFVEYKEEGTEAWVKAK---------DKEVRGTKFV---ITGLKENALFKFRVIALNAAGLGEPGEVADALEMKDRTILPVLE----LDVSVKEKMVIHAGGVIRILAYVSGQPPPVITWSR-------DEYPVPSEAVIETTSISCSMVIKDCTRAQR----GVYTITAKNDGGEVKKSVIVEVLDVPGPVGVPFTAENLTSESCKLNWFFPDDDGGSAISNYIIEKREAERKAWTSCSYTAGRQNAVVNNLVLKKAYFFRVAAVNAIGVGPFNQTACEIVIKDRINVPDRPEELEVTAITKDHISLTWKPPKNDGGSEVTSYILEARTIGKDKFVRLTKD------KLMERRYTYDGLREGETYEFRVSAVNEVGPGKPSFSTKPITCKDELEPPTIELDFRDKVVVRVGESFALQGRYTGKPAPSVTWSRDDKELKADNHIKFK----NTLTTMCLGIVKAQRGHSGKYCVTVENCTGARKGICNVIVAD 12620          

HSP 22 Score: 208.764 bits (530), Expect = 9.272e-53
Identity = 164/579 (28.32%), Postives = 256/579 (44.21%), Query Frame = 0
Query:  556 VKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT---VYCEKNTVLTVTKANRSIDTGHYT--IKLLCDGGTQQATGYVN------VLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMET-KDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGG-WFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            +K  + + I+       L++ N  R  + +Y I   N  G     ++VNI+DKP PP   +++ I+  SC +  + P DDGG+ + +YI+E     +   +W +++    +   + K   L+    Y FR  A N+ G+  P E     I+ K  +D P  P R    D + ++  L W  P+ DGG+PIT Y +E  +     W +   L   D   +             KGL    +Y FR+ A N  G   PS  +D VL K     P+             G+ F  DI    + +  + W R         +   IEL    T   V   ++   T       ++   Y+  +K +   G  + +   +       L VP  PR L    I   + +L W  P  DGG+PIT+YV++  D+    W     T KDTK TV  L  G +Y F V A N  G SE C   + + A++ +  P  P    +V+   + V L+W+ P+ DGGRPIT Y+I+KK+K G  W  + KT     + R+ +++       EG   QF++ A N+AG   PS
Sbjct: 9452 LKPEERITIDTKPGHSTLSIANTTRSDTATYIIEAVNTSGRATATVDVNILDKPGPPAAFDISEITNESCCLAWNAPRDDGGSPVANYIVEM--RPTDKEEWQKLSATIKQ--TAFKATKLVPLKEYVFRVSAENQYGIGTPAE--HVPIVAKYSFDTPGAPTRVQPSDITRDAVTLTWYEPDEDGGSPITGYWVERFDPETDKWIKSNKLPIKDTTFRV------------KGLPTKKKYKFRVLAENLAGQGKPSVETDPVLIKDPIDPPW-----------APGKPFVKDI---AKTSADLQWTRPEHDGGAKIESYIIELQKTGTEEWVRVAEDVPTTEHSLKGLMEKQEYSFRVKAINVAGESEPSDPSDPVVCKERLYVPNPPRWLEVVNITKINCDLKWTEPDSDGGSPITNYVVEKRDVRRRTWQAVDTTVKDTKYTVTPLSEGSLYVFRVAAENAVGISEFCELEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLKWEPPNSDGGRPITKYVIEKKEKVGTRWVKSGKTSGPESKYRVTDVD-------EGTEVQFQVRAENEAGVGHPS 9991          

HSP 23 Score: 204.912 bits (520), Expect = 1.322e-51
Identity = 171/594 (28.79%), Postives = 262/594 (44.11%), Query Frame = 0
Query:  544 DIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQ---GEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKA--NRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            D E++  KD + +   +   +N +   V+L + +  R   G Y I  +N+ G  +  I VN++D P   + ++V +++K+SC+V    P+D+GGTEI +Y IE      S   W+ V+       K +    L+    Y FR  A N+IG   P E S   ++  DP ++P +P    + +       L W  PE DGG+    Y +E K K    W++   G I  T               +      +E   Y FR++  N+GG S    T++ VL K   ++P L    +  + +K G     +    G+P P V W +      GD+  IS  L     V  E  T  T  +   +R  DTG Y I      GT  A   VNVLD P   R L   +I  +   L+W  P DDGG  I +Y+I+  +   G W + +       A V  L  G+ Y F V A NK G + P    E I A   +  P  P  P +      ++ + W  P +DGG+PIT YI++KK++    W   +K+  A  +  +  L   +P       YQFR+ A N+ G    S  ++    R
Sbjct: 13648 DPEITWTKDARVLGRDKRTEMNNNFPLVELVIQDAVRADYGKYAIQAKNSSGQAQATIIVNVLDIPGACQNLKVAYVTKDSCMVSWENPEDNGGTEITNYKIEC--RQPSQRGWTVVS---SDCTKRLVKAPLVQNCEYFFRVSAENKIGAGPPTE-SKTPVLAVDPVEKPGEPENFQITEVGKTFVFLKWKKPEYDGGSRNLAYHVEKKPKEADEWERLHKGAIKET---------------YFMADRCIENQIYQFRVQTKNEGGESNWVTTAE-VLVKEELVQPELKVKMVGTLVVKAGDAVSIEAELLGKPQPEVKWSKE-----GDTRDISKGL----RVQVETGTNFTKLQLSNSRRGDTGKYIITATNAAGTCSAEAKVNVLDRPGPIRDLKVSDISIDRCKLAWEIPEDDGGCEIYNYIIEKCEAKRGVWSIHSAAIITNSAKVTRLIEGNEYIFRVRAENKMG-AGPAVESESIIARTQFSRPGAPDAPEVTKITKDTMVVMWCSPDNDGGKPITGYILEKKEEHAIRWAPVVKSPYAGTQMTVTSL---LPNHE----YQFRVKAENEIGVGDASKPSRTFTAR 14202          

HSP 24 Score: 204.912 bits (520), Expect = 1.452e-51
Identity = 157/564 (27.84%), Postives = 251/564 (44.50%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNI-EIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISI--ELFSKKTVYCEKNTVLTVTKANRSID-TGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCR 1130
            L + N  R  SG Y + + N  G     +NV ++D P  P+  EV  + K+S  +   PP  DGG +I +Y++E  +  S+   ++ V     +   S KV+ L     + FR  A N  G     E      + + P      PG+ +++D + +S  L W  P  DGG+ I  Y +E + KS   W     +   +               T   L     Y FRI A+N+ G S P E    V+AK   ++P +H   ++N   +K G     ++   G P P V+W+++G L L  +  +SI   + S K V  E            +I+  G Y I L    GT+     + VLD P  P  +  D + ++ I LSWA P  DGG  I++Y+++  D +  +W + +     T   V  L  G  YQF + AVN+ G+ +   +   I AE  +K P  P  P +       + + W +P +DGG  +  Y +++K++    W    +T        I + E ++ G+ EG  Y+FRI A N AG    S  ++P   R
Sbjct: 20900 LVIDNVNRFDSGKYVLTLENKSGTKSAFVNVRVLDTPSSPQKFEVKDVKKDSVTLYWDPPLTDGGAKITNYVVEKRE--STRKAYTTVTSNCTQ--TSFKVDELQEGGIFYFRVCAVNEYGFGVMAETKNPIKVAQVPM----PPGKITLVDVTKSSVTLTWVKPAHDGGSKIICYNVEMQPKSSDKWGVSCTVKVPE--------------ATVSNLTPNETYSFRIIAMNEKGKSEPQELGVPVVAKNIEIEPSVHL--LFNTYSVKAGDDLTVEVPLRGRPKPVVSWKKDG-LPLRQTTSLSIINTMVSSKIVIKEA-----------AIEHVGKYEITLANTAGTKSTDIAIVVLDKPSPPASVKVDAVTSDSITLSWAPPEYDGGCSISNYIVEKRDTNTTEWQIVSTNVARTSIKVPRLTQGSEYQFRIYAVNRYGKGKQIDS-PGITAEYTFKQPGPPSTPRVAHATKAFMLVTWNEPVNDGGSTVIGYHLERKERTSILWTKVNRT-------LIKDTEFKVTGIEEGMMYEFRIYAENIAGIGKASKASEPIAAR 21419          

HSP 25 Score: 203.371 bits (516), Expect = 3.801e-51
Identity = 180/636 (28.30%), Postives = 278/636 (43.71%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK------GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTI--KVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAK-LCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDL 1233
            P PP   EV +++ NS  +    P DDGG++I  Y++E  +      +W++ A          +V  L     Y FR  A N+ G  +P E S        P         P V D +  + +L W  P SDGG  +T Y +E+K++    W     +  + + ++       +       L  G +Y FRI A+N  G   P++T+D+V    R   P L      ++E+++      G + R  I   G P P+VTW +  S L     R  I+         E  T+L +   NR  D G Y + L    G +  +  V VLD P  P  L    I  E I L+W  P  DGG  IT+Y+I+  +     +  A+ TK  K +V+   L  G  Y F V A N+ G  E   T +PI+     + P+ P+   I D    +V L W KP  DGG  +T Y+I+ + K         TD  S    I  L+  +  L+E + Y FR++AVN +G S P   +K  + R +N  P  D      KT+  K       ++ V G P P  +W K+   +  T   +I     +  AT+  L +++    D+G YS+  +N  G    ++ + V D+
Sbjct: 16295 PGPPAKPEVENVAGNSVTIAWKRPADDGGSDITGYMVEKKE--KKGMRWTR-ASKKTIADLHFEVKGLKEGVEYEFRVAAENKAGFGEPSEPS-------IPVMTKLVAVNPRVTDTTKTTAELHWGKPLSDGGMEVTGYFVEHKKEGEEEW-----IKDTSVPLR-------ITEFVVPNLEAGLKYHFRISAMNAMGVGEPAQTADAVQIVEREEIPDLE----LDVELRRTLVVRAGASIRIFIPIKGRPTPTVTWTKEDSPL---KTRAIID-------NTESYTLLVIPDCNRR-DAGKYDLTLENAAGKKTTSVVVRVLDSPGPPLNLKTTAIDKESITLAWEMPLIDGGAKITNYIIEKRESTRKAY-AAVITKCEKCSVRVSDLGEGLEYYFRVSAENEYGIGEAVETPDPIRVS---QAPTPPENVTITDVTKHTVGLTWTKPKHDGGSRVTGYVIEAQKK--------GTDQWSHVTTIKNLDLTVKNLNENEEYVFRVMAVNSSGRSHPRV-SKHVVIREQNSEPEFDLRGVCQKTVIAKAGENIKVEVPVSGRPKPTVSWQKDNQALKLTQRTMI-----ENTATSNILIINECLRSDSGIYSMTGKNIVGSVTENITVKVHDV 16875          

HSP 26 Score: 203.371 bits (516), Expect = 4.392e-51
Identity = 163/549 (29.69%), Postives = 247/549 (44.99%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKT--VYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPS 1121
            +++   N  G  E L++ N++ K     P PP    V +++ +   ++   P  DGG  +  + +E  +   +S  W +V     K     ++N LI    Y FR  A N  G S   + S + +    P D    PG P  +D +S S  L W  P+ DGG+ I  Y +E K +  G W +    N +D E             T  GL  G  Y FR+ A N  G  S PS++S  V+ +     P +     Y   + IK G   R  +   G PAP VTW R      GD     +EL  K         ++ L +  A+RS   G Y+++     GT++ +  V V D P +P   +   +I    + LSW  P +DG + +T Y+++  +     W L   E  ++  T   L   + YQF V AVN+ G S P  +  P+ A+  Y  P  P  P+  D D +S+T+ W  P+ DGG PI +YI+++++ K G W   L          I E   RI  L+E   Y+FR+ AVN AG  +PS
Sbjct: 23466 FRVCAENRYGVSEPLVSQNVIAKHEFRPPGPPGMPFVYNVTNDGMTIQWDAPIFDGGCPVLGFHVEKKE--KNSIMWQKVNTILIK-EMEYRINGLIEGLAYEFRVYAQNDAGYSRMSDAS-KPVTAVSPVD---PPGTPDYVDVTSESVKLKWEAPKRDGGSKIVAYNVE-KRQGKGRWLKSNFSNVTDTEF------------TVTGLACGERYEFRVIARNAIGTVSPPSQSSGYVVIRDESFAPNIEFGKEYFEGVSIKAGENIRLKVSISGRPAPKVTWYR------GD-----VELTKKMVDITTISGSSTLFIRDADRS-HRGLYSVEAKNPSGTKKESIKVEVFDSPGEPVGPITFSDISEGKVTLSWNPPENDGCSEVTHYILEKRETSKISWALVTDECLESSYTATKLIKTNEYQFRVSAVNRFGVSRPLDSA-PVIAQMQYTVPDSPGTPDATDVDGESITINWAPPTHDGGNPIKYYIVERREKKTGRWLKVL------TRKPITEAAHRITHLTENVEYEFRVYAVNDAGIGAPS 23975          

HSP 27 Score: 202.601 bits (514), Expect = 6.838e-51
Identity = 175/646 (27.09%), Postives = 282/646 (43.65%), Query Frame = 0
Query:  606 MDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDI-WF-----GGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKAN----RSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK--DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLDLMQECE 1238
             D P  P  ++ + I++++  +    PD+DGG+ I  Y +E  D    +++W +  +   K   + +V  L  K +Y+FR  A N  G   P  +    ++IKDP D P  PG+P V D +  S DL W  PE DGGA I  Y IE ++     W          + +  DV   P    + KGL+E  EY FR+KA+N  G S PS+ SD V+ K R   P    P  + +E+        D+ W      GG P  +   E+       D  R + +     TV   K TV  +++ +    R        I   C+   + +    +    P  P  L   E+   H++L W  P+ DGG PIT YVI+  +     W+ + +T   ++K  V  +  G   QF+V A N+ G   P      +  E+   PPS P E  IVD   + + + W+ P  +GG PIT Y ++  + +   W             + +E      G+   K Y  R+ A+N  G S PS  +     +  +  P+ID  +     ++  +  I +I  +  P P   W K   ++ + D + +T E  +      L + K +  DAG Y++  EN  G     +++ V+ L  +C+
Sbjct: 9601 FDTPGAPTRVQPSDITRDAVTLTWYEPDEDGGSPITGYWVERFD--PETDKWIKSNKLPIKD-TTFRVKGLPTKKKYKFRVLAENLAGQGKPS-VETDPVLIKDPIDPPWAPGKPFVKDIAKTSADLQWTRPEHDGGAKIESYIIELQKTGTEEW----------VRVAEDV---PTTEHSLKGLMEKQEYSFRVKAINVAGESEPSDPSDPVVCKERLYVP---NPPRW-LEVVNITKINCDLKWTEPDSDGGSPITNYVVEKR------DVRRRTWQAVDT-TVKDTKYTVTPLSEGSLYVFRVAAENAVGISEFCE--LEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLKWEPPNSDGGRPITKYVIEKKEKVGTRWVKSGKTSGPESKYRVTDVDEGTEVQFQVRAENEAGVGHPSEPTVIMTIEDAISPPSPPLEVKIVDASREHINITWKAPEKNGGSPITGYHVELSEAETEKWMRINPRPVKELGFKAEE------GIIPEKKYVLRVRAINAIGVSDPSEISDGVFAKDPDSAPTIDVATQDIVVVEGEKMDI-KIPYRAIPKPSMVWKKGDTELKTEDRLTLTCELNR----VHLELLKCKHEDAGVYTVTLENSLGSVTGTVNVTVIGLPGQCK 10205          

HSP 28 Score: 202.216 bits (513), Expect = 9.449e-51
Identity = 153/523 (29.25%), Postives = 235/523 (44.93%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPK---SIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSM---GLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKP---FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSP 1120
            P PP + EV  ++ NS  ++   P  DGG+++  Y IE  +   ++  W +    + K P      KV  L     Y+FR  A N  GLS   E S +  + ++P D    PG+P V + S ++  + W++P +DGG+PIT Y +E K  ++   G W +    N +D               T   L EG EY FR+ A N     SLPS ++  V  K  Y  P      +  +  + ++ G     D   GG+P P V+W +    L         EL  K  +       + + K     DTG Y + +    GT+ A   V VLD P   + +    +  E   +SW  P +DGG PIT Y+++  D +  +W +   E K     ++ L   + Y F V  VNK G     ++  PI A N +  PS P  P I+       T+ W KP +DGG  IT+Y+I+ +++    +  +  D       + +   ++ GL EG  YQFRI A+N AG   P
Sbjct: 24577 PGPPTSPEVFSVTANSMSIRWEEPYHDGGSKVTGYWIEKKE--RNTILWVR----ENKIPCFECYYKVEGLAEGLEYQFRVYAMNSAGLSKASEASKR-AVAQNPVD---PPGKPEVTNVSRSTVSIKWSVPLNDGGSPITGYIVERKPYTVTGEGRWLKCNYTNVTDTNF------------TITALGEGEEYEFRVIAKNANCVLSLPSVSTGPVTCKAEYTPPKAELDSKLLVDTVTVRAGSDLVLDAAVGGKPEPKVSWAKGTKEL---------ELCEKYALQYSSTRAMAIIKFCDRDDTGKYVLTVKNASGTKTAEVNVKVLDTPGPCQEITVSNVSEEKCTVSWKVPQEDGGDPITHYIVERRDTNRLNWVIMEAECKALTCEIRRLFKNNEYIFRVRGVNKYGPGVLVQS-NPIFARNTFTVPSPPGAPEILAVGKDFATIEWLKPENDGGSEITNYLIEFRERKSVRWIKVNRDSI-----LKDTSFKVTGLHEGNIYQFRITAMNAAGAPDP 25062          

HSP 29 Score: 202.216 bits (513), Expect = 9.776e-51
Identity = 163/587 (27.77%), Postives = 270/587 (46.00%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNR-TAIW 1156
            L V N  R  SG Y + + N+ G     + V ++D P  P+ ++++ ++K S  +   PP +DGGT+IK+YI+E  + +  +  ++ V     K   +  V+ L     Y FR  A N  G+  P E +G+ + +    ++P  PG+ ++ D +  +  L+W  PE DGG+ +  Y +E + K    W Q  I+   +  I               GL  G EY+FR+ A N+ G S P +    V+AK   + P +         +  G     DI +   P  +++W ++ ++ L  + R++   FS      +K   L + +A R  D G Y+IKL    G       + VLD P  P   +N DE+ ++ I +SW  P  DGG  I +Y+++  D    +W + A     T+     LK G  YQF + A N+ G+S P    E I A+ PYK P  P  P +      S+ + W +P  DGG  I  Y +++K++    +  L       ++ I +   +  GL EG  Y++R+ A N  G    S  ++  + R     P    G+  + TI  N  T +W
Sbjct: 17635 LVVGNVNRFDSGKYNLTVENSSGTKTVSVIVRVLDTPGAPQNLKISQVTKESVSLIWDPPINDGGTKIKNYIVEKREATRKA--YATVNSNCHK--TNWTVDQLQEGCNYYFRVLAENEYGIGLPIE-TGESVKVS---EKPLPPGKITLQDVTKTTVTLSWEKPEHDGGSRVVAYVVEMQSKGSEKWSQAVIVKVPEAVI--------------SGLSPGEEYMFRVSARNEKGTSDPRQIGVPVIAKDLVIAPSVKM-LFSTFTVLAGEDLTIDIPYNARPKATISWIKD-AVPLKRTTRVN---FSS----TDKELNLVIKEACRD-DVGQYSIKLSNTAGETTVDIGIVVLDKPGPPTGPVNVDEVTSDSITVSWKPPEYDGGCTINNYIVEKRDTSTTNWQIVAGNLARTQIKAGRLKTGSEYQFRISAENRYGKS-PILVSECIVAQYPYKLPGPPGTPFLQSSTKDSMIIVWNEPVIDGGCTILGYHLERKERNSILWMKLN------KSLIQDTTYKTTGLEEGMEYEYRVYAENIVGTGKASKLSEGFVARD----PCDPPGTPEALTITKNSITIVW 18178          

HSP 30 Score: 201.83 bits (512), Expect = 1.241e-50
Identity = 163/560 (29.11%), Postives = 256/560 (45.71%), Query Frame = 0
Query:  580 REKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW---DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEI--KKGRTFRYDIWFGGEPAPSVTWER-NGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG--LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLC 1129
            R  +G Y + + NA G     + V ++D P PP  ++ T I K S  +    P  DGG +I +YIIE  +  S+   ++ V     K   S++V++L     Y FR  A N  G+       G+ +   DP      P  P   ++ D + ++  L W  P+ DGG+ +T Y IE ++K    W     +   D+              T K L E  EYVFR+ AVN  G S P   S  V+ + +  +P     G+    +  K G   + ++   G P P+V+W++ N +L L  + R  IE           + +L + +  RS D+G Y++      G+      V V DVP  P+  +  D+I    I  SW TP +DGG PI +YV+++ +  +  W+  + +   + T K   L  G  YQF V A N+ G   P  T E + A  P+K P  P  P +V F   ++T+ W +P  DGG  +  Y +++K++    W    KT        +  L  +  GL +G  Y+FR+ A N AG   PS  ++P L 
Sbjct: 16556 RRDAGKYDLTLENAAGKKTTSVVVRVLDSPGPPLNLKTTAIDKESITLAWEMPLIDGGAKITNYIIEKRE--STRKAYAAVITKCEKC--SVRVSDLGEGLEYYFRVSAENEYGI-------GEAVETPDPIRVSQAPTPPENVTITDVTKHTVGLTWTKPKHDGGSRVTGYVIEAQKKGTDQWSHVTTIKNLDL--------------TVKNLNENEEYVFRVMAVNSSGRSHP-RVSKHVVIREQNSEPEFDLRGVCQKTVIAKAGENIKVEVPVSGRPKPTVSWQKDNQALKL--TQRTMIE-------NTATSNILIINECLRS-DSGIYSMTGKNIVGSVTENITVKVHDVPGPPKGPIKLDKITRTFIEFSWETPENDGGVPINNYVVEIRETTSQSWVE-LSSLIIRTTFKATRLTTGVEYQFRVRAKNRYGTGPPI-TSEAVVAAYPFKAPGPPGTPKVVAFTKDTMTIGWNEPVSDGGSEVIGYYVERKERNSIVWHRISKT------MVVGNL-FKSTGLEDGVAYEFRVFAENIAGIGKPSKASEPLLA 17070          

HSP 31 Score: 201.83 bits (512), Expect = 1.434e-50
Identity = 171/629 (27.19%), Postives = 265/629 (42.13%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWER-NGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSK--TIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            PD P T + T +   S  +  +PP  DGG  IK+YI+E  +    + +W +V         + ++ +L     Y FR  A N  G+  P  IS   I   +P +EPD P   +V D ++ S  L W  P  DGG  +  Y IE  + S   W +          +  D+    +   T  GL    EY FRI AVN  G     E  + V A  R L P +     +     +K G +    I F G+P P+ +W + +G L +      +    +     C +N            DTG YT+ L    G +  +  V VLD P  P+ ++  E+    + + W  P +DGG  +  YV++  +     W  A  ++  T   V  L  G  Y F+V+A N+ G  E     +P+ A      P+ PK  +I+D  + SVTL W KP  DGG  +T Y ++ K K         TD          L   I  L E   Y+FR+ A N AG S P       + +   + P+ D    +++  T ++  +    + + G P P+ +W    +++ +TD V I   + +      L V +S   D G Y L  EN  G     + + V+
Sbjct: 23888 PDSPGTPDATDVDGESITINWAPPTHDGGNPIKYYIVERRE--KKTGRWLKVLTRKPITEAAHRITHLTENVEYEFRVYAVNDAGIGAPSNIS-MAIKCAEPTEEPDPPSIINVTDTTNTSVSLEWTRPAYDGGMEVHGYIIEMCKGSEEEWHR----------VNEDLCA--VTKYTVTGLKTSEEYKFRICAVNSVGKGEAKEIPEPVQAVDRLLAPEIDIDASFKQTHVVKSGESVCIRIGFKGKPIPTASWTKVDGELGVMADITTTDTFTALTLENCTRN------------DTGKYTLTLENSSGNKSISVAVKVLDTPGIPQAVSIKEVMRGALTIVWEPPTNDGGARVHHYVVEKREASRRTWTEAAPKSTQTSLRVADLLEGVPYFFKVMAENQYGIGEAYEIPDPVIAT---AEPAAPKRLDIIDTTDTSVTLAWLKPEHDGGSRVTGYCVEGKAK--------DTDKWVVCGTTKNLSLVIEKLVENSEYEFRVKAKNDAGFSVPREAFSSVIIKEPRIEPTADLSGITNQLVTSRIGESFEIDVPISGRPTPKISWKLEEMKLKNTDRVSIKSTKNR----TTLTVKESMRGDGGRYFLSLENVAGSKTFTITVNVI 24474          

HSP 32 Score: 201.445 bits (511), Expect = 1.471e-50
Identity = 188/667 (28.19%), Postives = 283/667 (42.43%), Query Frame = 0
Query:  578 PKREKSGSYKIIIR--NAQGFDERL-----INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTV--LTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKG-LKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            P+ EK   Y + +R  N  G    L     I   + D P PP     + I++N+  V  + P+ DGG+ +  YI+E  +++    +W +V +      +  +V  L   + Y FR  A N  G+S P   S   +  K P   P  P    + DWS +  DL W  P  DGG+PI  Y +E +      W +   +N   I+                GL EG EY FRIKA NK G   P E +++VLAK   + P +         + ++ G+         G P P +TW ++  +L  D          K+T       +  L +  A R+ D G Y I+     G  QAT  VNVLD+P   + L    +  +   +SW  P D+GGT IT+Y I+        W   + +  TK  VK  L     Y F V A NK G   P  +  P+ A +P + P EP+   I +     V L+W+KP  DGG     Y ++KK K    ++ L       +  I E         E + YQFR+   N+ GES+    T   L + + + P +      +  +K       + ++ G+P PE  W K G     +  + +  E   G    KL +S S+  D G Y + A N  G    +  + VLD
Sbjct: 13378 PRLEKGREYVVRVRAENKIGIGAGLESPPTIAKQMFDPPGPPGQPTCSDITENAVTVSWAEPETDGGSPVSGYIVERREMT---GKWIRVNKTPVLDIR-YRVCGLFEGNSYEFRIFAENVAGVSQPSYPS-DPMKAKRPITPPGPPSNIKLKDWSKSYADLVWTKPSRDGGSPILGYVVEIQRSGSAQWDK---INKDLIK---------FCAFRVPGLNEGIEYRFRIKASNKVGDGEPRELTETVLAKDILVPPEVTVDVACRDLLTVRAGQIINLVTRVKGRPDPEITWTKDARVLGRD----------KRTEMNNNFPLVELVIQDAVRA-DYGKYAIQAKNSSGQAQATIIVNVLDIPGACQNLKVAYVTKDSCMVSWENPEDNGGTEITNYKIECRQPSQRGW-TVVSSDCTKRLVKAPLVQNCEYFFRVSAENKIGAGPPTESKTPVLAVDPVEKPGEPENFQITEVGKTFVFLKWKKPEYDGGSRNLAYHVEKKPKEADEWERLH------KGAIKETYFMADRCIENQIYQFRVQTKNEGGESN-WVTTAEVLVKEELVQPELKVKMVGTLVVKAGDAVSIEAELLGKPQPEVKWSKEGDTRDISKGLRVQVE--TGTNFTKLQLSNSRRGDTGKYIITATNAAGTCSAEAKVNVLD 14006          

HSP 33 Score: 197.208 bits (500), Expect = 2.989e-49
Identity = 154/565 (27.26%), Postives = 258/565 (45.66%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSS-SNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSET------SDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIEL--FSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDID--NGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETK 1125
            L++    R   G Y+I   N  G     + V++MD P P   ++  ++SK    +  S P D+GG++I  Y++E  D       Q  +VA           +  L++   Y FR  A N+ GL  P E+    ++  DP   P  P +    + + N+  L W  P SDGG+PI  Y IE   +    +         D+ I            T + L E   + FR+KAVN+ G   PS+        D      +++K F        I ++KG          G P P+  W +NG ++   ++ +++E    +++T+    NT + + ++ R  DTG Y +      G  Q T  V++LD P  PR +   +I+AE   L+W  P D+GG+ +T+Y+++  D      DW        D +  V  L+    YQF++ A NK G S+ C + E +  ++P+  P  P+ P I+     S+ + W+ P D+GG  I  Y ++K+++   ++  +     +  A +  LE  +  L EG  Y+FR++A N AG   PS  T+
Sbjct: 10887 LSIKKALRTDHGMYQITGTNPSGTKSVSVKVDVMDVPGPVVDLKTVNVSKKMISLTWSDPLDNGGSDIMGYVVERKDAKMHIYRQPLEVAAC------KCDIVGLLDGEEYMFRVVARNKFGLGAPVELG--PVLAVDPKGVPSAPEKLRYTERTKNTITLTWEAPRSDGGSPIIGYYIEKMRQDSNEYDVANRNLCKDLTI------------TLENLTENMMFDFRVKAVNEVGNGEPSKAISVNIQEDENSPTVKWMKFFKSD----AIVVRKGAAIEIPAEIVGLPLPTFEWTKNGVVIDQPTEAMTLESEEINRQTI----NTKIGIPESVRQ-DTGMYKLTATNTRGVGQRTMRVDILDRPLPPRNIVVSDIKAESCYLTWDAPEDNGGSDLTNYIVEKRDASKKKSDWDQLTCCIMDRRYGVYKLEAYGTYQFQIKAENKYGISDGCES-EKVVLKDPFGLPGPPQRPRIISHTRSSMVVTWEPPKDNGGSTIQGYWLEKRERGAVYWSRVNRAPVTKPA-VKGLEYNVLHLIEGAEYKFRVMAQNAAGVGPPSEATE 11420          

HSP 34 Score: 196.823 bits (499), Expect = 4.771e-49
Identity = 166/572 (29.02%), Postives = 249/572 (43.53%), Query Frame = 0
Query:  551 KDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPW---DEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            KDG+++K  +   I        L +    R  SG Y +   N+ G     I V ++D P  P   +V  I+K S  +   PP  DGG +IK+YIIE  +  S+   ++ V     K   S KV  L     Y FR  A N  G+  P +I+       DP    + P  PG+ SV+D +  S  L+W  P  DGG+ I  Y +E + K    W     + T              +      L  G EY FR+ AVN+ G S P   +  V AK     P   +P   +  +  G+  + +I   G P P V W ++G+  L  + R++I           ++TVL++ +A R  D G Y I +    G + AT  +  LD P  P   +  DE+    + LSW  P   GG PI++Y+++  D     W   A+    T   V  LK G  YQF +IA N+ G+S    +   +  + PY+ P  P  P +       + + W +P  DGG  I  Y +++K++    W    KT        I E + +   L EG  Y+FR+ A N  G
Sbjct: 18716 KDGEQIK--ESAQIETSSSYTSLVIDKVSRVNSGKYTVTAENSTGAKSETIMVKVLDTPSAPLNFKVKEITKESVTLTWEPPSLDGGAKIKNYIIEKRE--STRKTFAAVVTNCHK--LSWKVEPLQEGCSYYFRVLAENEHGVGLPADIA-------DPLKISEVPQCPGKLSVVDVTKTSVSLSWEKPIHDGGSRILQYLVEMQVKGNEKWSGCANVKT--------------LEAVISNLNPGEEYTFRVIAVNEKGKSDPRTLAVPVQAKDLVFGPD-ARPTFSSYSVLVGKDLQVEIPVFGRPKPKVQWTKDGA-ALKFTTRVNIS-------NTARSTVLSIKEAARE-DGGMYGINVSNAVGQKDATIEIITLDKPGPPTGPVRFDEVTVTSVTLSWDPPKFTGGCPISNYIVQKRDTTTTTWENVAISLARTTLKVLRLKTGAEYQFRIIAQNRYGKSYALDS-SAVVIQYPYREPGPPGTPFVSCLSKDHMIVEWHEPVSDGGSSIIGYHLERKERNSILWTKINKT-------LIQETQFKTGPLEEGIEYEFRVYAENIVG 19242          

HSP 35 Score: 193.741 bits (491), Expect = 4.169e-48
Identity = 202/750 (26.93%), Postives = 315/750 (42.00%), Query Frame = 0
Query:  506 VIMGEKAPKLGDCGPVSGVAHKDC--NWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSY--KIIIRNAQGFDERLIN--VNIMDK---PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLS---DPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIEIKK------GRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWL-XAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTA--IWQIKVKGEPPPEFTWYKNG--IQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            VI+ +  P  G    V+G+  ++C  +WG    + G   ++I   V +  +  ++   +    HG+     +   K  K   Y  +++  N  G  E L +  V + D    P  P  +E+T ++     +  + P  DGG+EI  YIIE  +   S   W +V +   K   + +++ +     Y FR  A N  GLS   DP   +  +    D    P  P +P +LD++ NS  +AW  P SDGGA I  Y +EYK+     W     +  S+  I               GL    EYVF +KA+NK G S  S  S+   A  R  +P        +IE++K      G +F     F G+P PSVTW +    L     R SIE         E  T +T+  A R+ D+G Y + L    GT      V VLD P  P  +   E+  +   ++W  P +DGG  + +Y ++  +     W+  +         V+ L+ G IY F V   N+ G   P  T +  K     + PS P    +      S+T+ W KP  DGG  IT Y+I   +K  G    +K         I      I  L E   Y FR+ A N AG S P     P + + +   P  D  +    T+ V   +   +++ + G+P P+ T  +    ++        +T E      +  + + +S   DAG Y +VA N +G  K  + ++VLD
Sbjct: 21615 VILDKPGPSAGPLS-VTGLTAEECTLSWGPPQEIGG---AEITHYVVEKRETSRLAWTL---VHGEVKTRTLKVTKLLKGNEYIFRVLAVNKFGLGEALESEIVRVTDPYTIPTAPTNVEITSVTSEEMTLSWAKPTSDGGSEILGYIIERRE--KSGLHWVRVNRELVKD-TTAEISKVRRGCEYEFRVYAENAAGLSLASDPSPSARAE----DALLAPSPPTKPKILDYNKNSITIAWKKPLSDGGAQILGYSVEYKKSEDEEWIVAIQMTKSNEFI-------------VSGLTTDVEYVFAVKAINKVGVSEQSPASEPQSATERKEEPEFD----VDIEMRKTLIVKHGSSFTLMAPFKGKPVPSVTWNKEEVDLKA---RASIE-------STETYTSITIENATRN-DSGQYIVTLDNGVGTASLPMVVKVLDTPGPPTNVKITEVTKDSATVTWQPPENDGGDAVKAYHVEKREASKKAWVCVSSNCHSLTYKVEDLQEGAIYYFRVSGENEFGTGVPADTKDGTKIA---EKPSPPARLGVTAVTKNSITIAWSKPEFDGGSRITSYLIDALEK--GQQKWVKCATVKTNMHI------IKSLRENGEYFFRVRAENHAGLSEPKEMIIPVVVKEQLDPPEFDMKNFPHNTVYVRAGSNLSFELPLSGKPMPKVTMTRGNAPVKCGKRFSFEVTPE------SLNINLKESIASDAGRYDIVASNTSGTTKMFVIILVLD 22305          

HSP 36 Score: 192.971 bits (489), Expect = 6.111e-48
Identity = 168/565 (29.73%), Postives = 260/565 (46.02%), Query Frame = 0
Query:  576 INPKREKSGS---YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEAR-IDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFET 1124
            I   R K+GS   ++I   N  G    L++  I+ +     P PP T  +   +K+S ++  + P  DGG  I  Y +E  +   +S  W ++ ++  +   + K   L     Y +R  A N +G     ++S +  + +DP D    PG P  L  + NS  + W  PE DGG+ +T Y +E KE   G W +    N  + E             T  GL E  +Y FR+ A N  G  S PS ++  ++AK     P +     Y   I +  G  F+ D    G+P P+++W++ G   LG++  I  E+ S  +  C     LTV +A  + D G YT+ L   GG +     + VLD P  P   ++   +  E   L+W  P  DGG+ IT Y+++  +     W   +E K    ++K   L  G+ Y F V+AVNK G  EP ++   +  +NP+ PP  PK   + +    S+ L W+ P++DGG  IT YII+K DK G  W          C  + +  L  ++  L E   Y+FR+ A N AG S  S  T
Sbjct: 18019 IKAGRLKTGSEYQFRISAENRYGKSPILVSECIVAQYPYKLPGPPGTPFLQSSTKDSMIIVWNEPVIDGGCTILGYHLERKE--RNSILWMKLNKSLIQD-TTYKTTGLEEGMEYEYRVYAENIVGTGKASKLS-EGFVARDPCD---PPGTPEALTITKNSITIVWTKPEYDGGSKVTGYIVEKKELPAGRWMKANFTNVIETEY------------TATGLTENEKYEFRVIARNAAGVFSDPSYSTGPIMAKDEIEPPRISINPEYTQTIVVNAGDNFKIDADVHGKPIPTISWQK-GEQELGNT--IYREIKSTDSYTC-----LTVKEAKLA-DGGQYTLLLQNPGGEKAVQVNICVLDKPGAPEGPISITGVTNEQCCLAWKPPKQDGGSKITHYIVERRETSRLLW-TVVEPKVQAVSLKITKLLEGNEYIFRVLAVNKFGVGEPLQS-GAVVIKNPFTPPDAPKGLEVSNVKKDSMVLTWEAPTNDGGTTITGYIIEKHDKEGVRW--------TRCNMKSVTNLTFKVTSLMENHLYEFRVSAENAAGVSEASSAT 18545          

HSP 37 Score: 192.2 bits (487), Expect = 1.098e-47
Identity = 158/584 (27.05%), Postives = 248/584 (42.47%), Query Frame = 0
Query:  586 YKIIIRNAQGFDERLINVNIMDK-----PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSI---KVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXA-METKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPY-KPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS----IDKGSSSSKTIKVN 1151
            +++   N  G  E L +  +M K     P PP    V  +S++   V   PPD+DGG E+  YIIE  +V +  ++W +      K P ++   +  +LI    Y  R  A N  G+  P  +S +  +  DP D P  P  P V + + +S  LAW+ P+ +GG+ +T Y IE ++     W            +K +     +   T   + +G E+ FR+ A N GG   P+E   +V        P       Y   + ++ G   +  +   G+P P+  W ++GS           E+ S+  +   ++    V K     D+G Y + L    G +     V V+  P  P   L  D+I+A  + +SW  P +DGG+ I  Y+++  +     W        DT   VKGL+    Y F+V A N+ G S   ++   I  + P   P +    P I+D    S  L W KP DDGG  IT Y I+ K+     W           E +I      +  L+    YQFR+I VN  GES P   +   +C+     PS    ID  + +   I +N
Sbjct: 25527 FRVAAANRYGTGEYLQSEVVMCKSSKSIPGPPGRPIVFDVSRDGMTVAWEPPDEDGGLEVSGYIIERKEVRA--DRWIRA----NKNPVTMTRYRSTDLIEGLEYEHRVTAINARGVGKPSLLS-KPAVATDPVDPPGSPQNPRVTETTKSSVSLAWSPPDEEGGSKVTGYLIEMQKAGSVTW------------MKCNTTPSLICEYTLTQMPQGEEFKFRVMACNAGGPGEPAEVPAAVTITEMLDPPSYDLEAKYKDVLVVRSGGVIKLSVPIKGKPTPTSKWTKDGS-----------EVTSRAMIASNEDVSELVIKQAERSDSGVYYLHLENKCGKKMLPIKVKVIGRPSAPEGPLRFDDIQAHSVRVSWKQPLEDGGSEIVGYIVERRESTKAAWYTVDSRVVDTSLVVKGLEENIEYHFKVTAENQFGISSSLKSEGTIAPKTPICVPEASGTPPEIMDVTKSSAALAWTKPKDDGGSRITGYFIEYKEVSSDKWIRH--------ETKIISTMYTLSQLTADAEYQFRVIVVNDIGESEPGPASDSVICKDPFDKPSQPGEIDTMTVTRDYITIN 26072          

HSP 38 Score: 189.504 bits (480), Expect = 7.303e-47
Identity = 174/637 (27.32%), Postives = 277/637 (43.49%), Query Frame = 0
Query:  610 DPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGP---KSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEI-LNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKP--FLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDN-----QSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGS--SSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            DPP    +T+I+K    V    P DDG + I  Y++E  +  +    W+++     + P   ++++V  L    +Y FR  A N+ GL  P + S     + DP   P  P  P  +D ++++  L W  P +DGG+ I  Y +E K  +   W +  +  N  D             +    GL+E +EY  R+ AVNK G S P E  +  +AK  ++ P   L       + +  G   +      G P P VTW +  + +    DR  I + +  T     +T++ V K NR  D G Y + L    G +  T  V VLD P  P  L   E   +  ++ W  P  DGG+ IT Y++   D +   W   + T  TK + K   L+PG  Y F V+A N+ G  EPC T++ ++A     P        ++DF        S TL W+KP  DGG  I  Y+++  +    W + L++ +    A+          L EG+ Y++R+ A N +G+  P  E    L +  N+ PS D     + +   K       +I + G+P P  +W K G     TD   +  E      T  L +   Q  DA  Y++   N  G  ++ + + V+
Sbjct: 15214 DPPV---LTNITKEHMTVSWKEPSDDGKSPILGYLVEKRE--TKEVNWTKI----NRKPLLERTLEVGGLSEGAQYEFRVIAVNKAGLGKPSDPSNAASAL-DPLYPPGPPISPKAIDTTNSTIKLTWTKPANDGGSDILGYLVECKRINTTDWIRCNVPKNLQD------------TNYVVTGLLENSEYQLRVSAVNKIGFSQPCEVPEKHIAKDVFVTPEAELDAELKDTLVLTAGSKMKLHAKIKGRPIPRVTWAKMNTNI---KDRQGIIIKTTDT-----DTLVCVEKVNR-YDAGKYILNLDSVSGMKMYTVIVKVLDTPGPPLNLMIKETSKDSASILWDEPLIDGGSEITGYIVDKRDAERKAW-SNVTTSCTKTSFKIEDLEPGRSYCFRVLAQNQYGIGEPCETVDAVRASEQPGP--------VMDFKTLLVTKDSCTLSWKKPISDGGSRIIAYVLEVLNGEDKWKELLRSKNMQYSAK---------DLVEGREYKYRVFATNDSGD-GPVKELS-VLAKDINVLPSCDLRDLPNLNYIAKEGSNVRLKIPIIGKPTPAVSW-KKGEDENLTDTGRVCVESTAVNTT--LLIRDCQRTDASKYTITLRNSAGTKESTIFVRVV 15796          

HSP 39 Score: 188.348 bits (477), Expect = 1.781e-46
Identity = 147/505 (29.11%), Postives = 227/505 (44.95%), Query Frame = 0
Query:  617 VTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            V   +K+   ++ + P  DGG+ +  Y +E+ +   +S  W+++ +         K+ NL     Y FR  A N +G+    ++S +  + +DP D    PG P  +  S +   + W  P+ DGG+ +T Y +E ++   G W +    N  + E             T  G+   N+Y FR+ A N  G  S PS+++  + A      P +     Y   I +  G     D    G+P P + W + G  +      + IE  S      +K   +T+    R +D GHY + L   GGT+     V VLD P  P   L    I ++  +LSW+ P  +GG  I+ Y+++  D     W        T    V  L  G  Y F V+AVNK G  EP  + E I A NPYKPPS P  P   +    S+TL W  P  DGG  IT Y ++K+DK G  +            ++ +L  ++ GLSEG +Y+FR+ A N+ G
Sbjct: 20251 VKSATKDQMTIEWNEPVIDGGSSVIGYHLESKE--RTSILWTKLNKTLITD-TVFKICNLEEGIGYEFRVYAENIVGIGRASKVS-ESFVARDPCD---PPGTPEAVAISKDHIKIQWTKPQYDGGSKVTGYIVERRDLPEGRWMRANFTNVIETEF------------TVTGITVNNQYEFRVIARNAVGVFSEPSDSTGPITATDEIEPPSVSMDPKYKDVIVVNAGDNLVLDADIHGKPTPDIQWLKEGKEM---DKTLRIERRS-----TQKYASITIKDCTR-LDGGHYDLILSNSGGTKTVPIAVKVLDRPGPPTGPLRVAGIMSDKCHLSWSEPSQNGGANISHYILEKKDTSRLSWTVVDSNIPTVTYKVTKLLSGDEYIFRVMAVNKYGIGEPLFS-EAITARNPYKPPSAPSAPEASEITKDSITLSWNAPESDGGAEITCYHLEKRDKDGVRWTKCN------RQKLTDLHFKVTGLSEGHFYEFRVSAENETG 20720          

HSP 40 Score: 188.348 bits (477), Expect = 1.827e-46
Identity = 208/798 (26.07%), Postives = 328/798 (41.10%), Query Frame = 0
Query:  459 RMEVKQMGDGKHQLIVHYITMEDYGQIEARTPTNHGDKTVSCTGSFNVIMGEKAPKLGDCGPVSGVAHKD-------CNWGVSYAVEGYKQSDIELSVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQG-----FDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPS-----VLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYN-IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSID-KGSSSSKTIKVNRTAIWQI--KVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGAT--AKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVLD 1232
            R+  +Q   G+  L+V      D+G    R    HG  T SC    NV        L   GP       +       C W       G +  +  L   KD     +G  V +       +  V      K   +++   N  G     + E L+  N  + PD P    +  ++ ++  +    P D+G + I  Y +E  +V+S    W +V  ++     ++KV  L+    Y FR  A N   L+ P E S    +  DP    D    P      ++D ++ + D++W  P  +GG  I  Y +E        W +       D +             T  GL EG +Y  R+ AVN+GG   P  T + V AK     P +     + N + I+ G T R      G P P V W ++G+    D + + IE   K       ++ L++ KA R+ D G Y I      GT+  +  V+V+DVP     L    +  + I+L+W+ P D+GG+ I  YV++  D     +   +E    K  + GL  G  Y F V+A NK G   P   L P+ A +P   PS P++    +    ++TL W+ P  DGG PI  Y I+K  +    +D    +   C+    +L   +  L+E   + FR+ AVN+ G   PS     ++   +N +P++       S  I V + A  +I  ++ G P P F W KNG+ I    E +    E     T   K+ + +S   D G Y L A N  G  +  + + +LD
Sbjct: 10479 RLSYEQTKKGETALMVRDAIRTDHGNFTIRVENAHGFATASC--DVNV--------LDKPGPPVNFGFDEIRNTSVVCTWDAPLDDGGSEIINYILEK-KDNTSDDIGW-VTVTSTHKGYNYPVTKLIEGKEYIFRVTAENKFGCGHPCYSEPLVAKNQFEPPDAPNVPRIGEVTSSTVALSWHEPKDNG-SPILGYWVERREVNS--KYWIRV-NSNLLSALNVKVEGLMEGLVYVFRVCAEN---LAGPGEFS----VPTDPQAAMDPILPPGPPVPKIVDVTNTTIDISWQPPLYNGGGEILGYHVERCLVGEKDWVRCTEFRCKDRKY------------TVTGLTEGADYNLRVYAVNEGGHGAPGMT-EPVQAKEPEEAPGVEFDISVRNGVIIRAGETLRLPAVVTGRPVPEVKWTKDGAE--PDKEHVVIEAEIK-------SSTLSIKKALRT-DHGMYQITGTNPSGTKSVSVKVDVMDVPGPVVDLKTVNVSKKMISLTWSDPLDNGGSDIMGYVVERKDAKMHIYRQPLEVAACKCDIVGLLDGEEYMFRVVARNKFGLGAPVE-LGPVLAVDPKGVPSAPEKLRYTERTKNTITLTWEAPRSDGGSPIIGYYIEKMRQDSNEYDVANRN--LCK----DLTITLENLTENMMFDFRVKAVNEVGNGEPSKAISVNIQEDEN-SPTVKWMKFFKSDAIVVRKGAAIEIPAEIVGLPLPTFEWTKNGVVIDQPTEAMTLESEEINRQTINTKIGIPESVRQDTGMYKLTATNTRGVGQRTMRVDILD 11222          

HSP 41 Score: 187.963 bits (476), Expect = 2.318e-46
Identity = 179/646 (27.71%), Postives = 287/646 (44.43%), Query Frame = 0
Query:  598 ERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLW----QQGEILNTSDI--EIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYNIE--IKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQA-TGYVNVLDVPEKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAM-ETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTP--SIDKGSSSSKTIKVNRTAIWQIKVKGEPPPEFTWYKNGIQIASTDEVLITREEYQGGATAKLCVSKSQMIDAGTYSLVAENRNGQDKTDLDLIVL 1231
            E +I  N    P  P T E T I++ S  V  + P  DGG+ +  Y +E  D    S +W +V + D       KV++L   + Y++R  A N+ G   P+  +       DP D P +P +  V+D +  S  L W+ PE DGG+ IT Y +E +    G W    Q+GE+  T  +  ++K DV+                 Y FR+ AVN  G   P E  + V AK    +  +           +K G+     +   G PAPSVTW++    +  D       + S  T  C     L +T+  R  DTG YTI +    G  ++ T  V V D P   R L   E+    + L W  P  DGG  IT+YV++  D     +     + K+T   ++ L     + F V+A N+ G  +PC T EP+KA    + P   K+ ++ D    SVT++W KP  DGG  IT YII KK + G    A    +  CE  + +L+     L+E     FR+ + N+ G +S   E  P   +   + P  +++   +   ++++      ++  KG+P P   W K+ + +  +++V   + E +    A L +   +  + G Y+L  +N   +    + +I L
Sbjct: 22792 EPVIAKNAFVTPGQPSTPEATDITRTSMQVIWNKPGVDGGSMVTGYYLERRD--KKSLRWVKVYK-DPISDTKAKVHHLTEGNEYQYRVCAINKAG-EGPYTDASDFYKAADPVDPPYEPTKMKVVDSTKTSITLGWSKPEYDGGSEITSYVVEKRVGEDGEWTVISQKGEVRTTEYVASDLKPDVD-----------------YYFRVSAVNCAGRGDPMEMEEPVQAKDILEEAQVDTDVAMRTHYIVKAGKDVEIMVPLKGRPAPSVTWKKEDQNIDNDPQ---YNIHSTDTSSC-----LIITQVTRK-DTGKYTINISNGVGEPKSLTLSVKVQDTPAACRNLILKEVTRGKVTLCWEPPLQDGGAEITNYVVEKRDSSKRTYACVTNKCKETTCAIEELSEKSSFFFRVLAENENGVGDPCETAEPVKAT---ETPGPVKDLSMKDSTKTSVTIQWNKPDYDGGSIITDYIIDKKLQ-GQEEWAPAGTNKHCEHEVTKLKE----LTE---MFFRVCSKNEKG-TSDFVEIGPIKVKDFIIPPEANLEDYPNGQISVRLGHNVHLELPYKGKPRPTLLWLKDNLPLKESEKVRFKKTENK----ATLMIKNVEKENEGKYTLTLDNTFFRKSFHVQVITL 23391          

HSP 42 Score: 186.808 bits (473), Expect = 4.571e-46
Identity = 156/581 (26.85%), Postives = 247/581 (42.51%), Query Frame = 0
Query:  548 SVFKDGKEVKVGQDVNINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRY------LKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIR---AEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKA-TVKGLKPGHIYQFEVIAVNKEGESE--PCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            SV  + +EV +    +I        + + N  R  SG Y + + N  G     + V ++D P PP  +++T ++K+S  V   PP++DGG  +K Y +E  + S  +  W  V  +      + KV +L     Y FR    N  G   P +      I     ++P  P R  V   + NS  +AW+ PE DGG+ IT Y I+  EK    W +   + T+             +H   K L E  EY FR++A N  G S P E    V+ K +       +K F H      + ++ G    +++   G+P P VT  R G+  +    R S E+  +      K ++ +        D G Y I      GT +    + VLD P  P  + P E+       + L W  P  DGG+P+T+YV+   +     W+         A  V  L  G  YQF + A N+ G S+   C++   +  + PY  P  P  P +     +S+T+ W  P  DGG P+  Y +Q K++    +  L       +  I   + R+  +  G  Y+F++ A N AG
Sbjct: 21954 SVTWNKEEVDLKARASIESTETYTSITIENATRNDSGQYIVTLDNGVGTASLPMVVKVLDTPGPPTNVKITEVTKDSATVTWQPPENDGGDAVKAYHVEKREASKKA--W--VCVSSNCHSLTYKVEDLQEGAIYYFRVSGENEFGTGVPADTKDGTKIA----EKPSPPARLGVTAVTKNSITIAWSKPEFDGGSRITSYLIDALEKGQQKWVKCATVKTN-------------MH-IIKSLRENGEYFFRVRAENHAGLSEPKEMIIPVVVKEQLDPPEFDMKNFPHN----TVYVRAGSNLSFELPLSGKPMPKVTMTR-GNAPVKCGKRFSFEVTPESLNINLKESIAS--------DAGRYDIVASNTSGTTKMFVIILVLDRPGPP--VGPVEVSDVGETSLCLKWLPPLYDGGSPVTNYVVLKRETSTPAWIEVSSLVTRNAFKVTKLTKGEEYQFRIKAENRFGISDHLDCQS---VTVKLPYTVPGPPSTPWVGFVSRESLTVCWNDPVVDGGNPVFGYHVQMKERSSILWQTLN------KTAISATQIRVTNICPGMIYEFKVAAENAAG 22488          

HSP 43 Score: 186.808 bits (473), Expect = 5.105e-46
Identity = 172/610 (28.20%), Postives = 262/610 (42.95%), Query Frame = 0
Query:  563 NINFHGDRVDLNVINPKREKSGSYKIIIRNAQGFDERLINVNIM-----DKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCE-KNT---VLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASC-EARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            N+     R  L V+  K      ++II +N  G    L +  ++      +P PP T  V+ +SK+  +V+   P  DGG+ I  Y +E  +   +S  W+++ +   +  +  K   L     Y FR  A N +G+    +IS +  + +DP D    PG P  +  S N+  + W  PE DGG+ IT Y +E ++   G W +    N     I+TD         T  GL EG +Y FR+ A N  G  S PS  S  + A      P       Y   + +  G TF+ D    G+P P++ W +N   L             + T+ C+ KNT    L + K     D G+Y ++L    G+Q     V VLD P  P   L    + ++   L W  P DDGG  IT Y+I+  +     W +   + K T   V  L  G+ Y F V+A N  G  EP      I  ++P+  P  P+   + +    S+T+ W  P  DGG  I  YII+K+D+ G  W          C   ++ ++  R+ GL E   Y+FR+ A N +G   PS  T  +        P     ++   T K + T  W
Sbjct: 19110 NVAISLARTTLKVLRLKTGAEYQFRIIAQNRYGKSYALDSSAVVIQYPYREPGPPGTPFVSCLSKDHMIVEWHEPVSDGGSSIIGYHLERKE--RNSILWTKINKTLIQETQ-FKTGPLEEGIEYEFRVYAENIVGIGRCSKIS-EGFVARDPCD---PPGTPEAVCVSKNAITIQWTKPEYDGGSVITGYTVEKRDLPEGRWMKASFTNV----IETDF--------TVTGLTEGAKYDFRVIAKNAVGTISKPSYNSGPIAALDEVEPPKFSIDPEYTQALVVNAGDTFKLDADVHGKPVPTIQWFKNDKEL-------------ENTIRCDIKNTDNRALIIVKDAVRQDGGNYILQLNNIAGSQTVQFSVKVLDKPGPPEGPLRVTGVSSDKCTLIWRPPLDDGGNTITHYIIERRETSRLAWAVVCNDCKTTTYKVTKLLEGNEYIFRVMAANSYGIGEPIDA-PSIIMKDPFIHPGSPQIIEVTNIAKDSMTICWSAPDSDGGSEIIGYIIEKRDRSGIRW--------TRCNRQKVTDVCFRVHGLIEDHEYEFRVSAENASGIGEPSLPTSYYKACDPKYKPGSPMHANVVDTTKNSITVAW 19678          

HSP 44 Score: 184.111 bits (466), Expect = 3.657e-45
Identity = 167/586 (28.50%), Postives = 259/586 (44.20%), Query Frame = 0
Query:  558 VGQDVNINFHGDRVD--LNVINPKREKSGSYKIIIRNAQGFDERL-INVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRP---SVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIY-------NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNP---DEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETK-DTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKP 1126
            +  D   N H       L +    R+ +G Y I I N  G  + L ++V + D P   + + +  +++    +   PP  DGG EI +Y++E  D  SS   ++ V     +   +  +  L  K  + FR  A N  G+ DP E +       +P    + PG     S+ D +  S  + W  P+ DGG+ IT Y I+ K +    W                   K   H   K L E  E  FR+ + N+ G      TSD V      +K F+  P           I ++ G     ++ + G+P P++ W ++ +L L +S+++  +    K     KN    V K N     G YT+ L  D    + + +V V+ +    + + P   DE+RAE I +SW  P+DDGG  IT Y ++  D    DW  A  +   T   V  L  G  YQF V A N+ G SEP  +   I A++ ++PP  P  P + +  N  +T++W  P  DGG P+  + ++KK+K    +  + T        I E+E RI GL EG  Y+FR+ A N AG S  S  +KP
Sbjct: 23049 IDNDPQYNIHSTDTSSCLIITQVTRKDTGKYTINISNGVGEPKSLTLSVKVQDTPAACRNLILKEVTRGKVTLCWEPPLQDGGAEITNYVVEKRD--SSKRTYACVTNKCKE--TTCAIEELSEKSSFFFRVLAENENGVGDPCETA-------EPVKATETPGPVKDLSMKDSTKTSVTIQWNKPDYDGGSIITDYIIDKKLQGQEEWAPAG-------------TNKHCEHEVTK-LKELTEMFFRVCSKNEKG------TSDFVEIGPIKVKDFIIPPEANLEDYPNGQISVRLGHNVHLELPYKGKPRPTLLWLKD-NLPLKESEKVRFKKTENKATLMIKN----VEKENE----GKYTLTL--DNTFFRKSFHVQVITLGPPSKPIGPIRLDEVRAESITISWDEPNDDGGGEITCYTVEKHDTSQTDWKMACSSVIGTSFKVPNLIKGTQYQFRVCAENRYGVSEPLVSQNVI-AKHEFRPPGPPGMPFVYNVTNDGMTIQWDAPIFDGGCPVLGFHVEKKEKNSIMWQKVNT------ILIKEMEYRINGLIEGLAYEFRVYAQNDAGYSRMSDASKP 23585          

HSP 45 Score: 181.03 bits (458), Expect = 3.320e-44
Identity = 144/515 (27.96%), Postives = 226/515 (43.88%), Query Frame = 0
Query:  609 PDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNK-GGASLPSETSDSVLAKTRYLKPFLHQPGIY--NIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTK-ATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGE 1117
            P PP T  V  +S+ S  V  + P  DGG  +  Y ++  +   SS  W Q           I+V N+     Y F+  A N  G+    + S + + I    D  D P    + + + NS  L W  P  DGG+ IT Y +E ++   G W +    N  D               T  GL +   Y FRI A N  G  S PS  +  V        P +  P  Y   ++ K G +F+  +    +P P   W ++   L+  S  +S+E  +  +    K++          ++TG Y +K+    GT  A+  V +LD P  P   +    + A+ I ++W    DDGG  +T Y+++  +     W    E  +++  TV+ L  G+ Y F V  VNK G  +P  + EP+ A+N +  P +P  P   D    S+ + W KP  DGG  +T Y ++++DK    W    K         I + +A++  L+EG  YQ+R+ A+NKAGE
Sbjct: 22407 PGPPSTPWVGFVSRESLTVCWNDPVVDGGNPVFGYHVQMKE--RSSILW-QTLNKTAISATQIRVTNICPGMIYEFKVAAENAAGIGKFSKTSEEVLAI----DACDPPANVRISEVTKNSVSLVWQKPPFDGGSKITGYMVERRDAPNGRWTKANFTNVIDTNF------------TVSGLTQDQSYEFRIFAKNVVGSVSNPSLIAGPVTCVDISGAPVIDLPPEYLDVVQYKAGESFKIRLGISAKPLPMFEWLKDEKELV-TSSIVSVENTTDSSAILIKDST--------RLNTGTYELKIKNSFGTASASIRVQILDKPGPPAGHIEFKSVSADKITIAWEPVTDDGGAKVTHYIVEKRETSRVVWSVISEAMESRMVTVQKLIRGNEYVFRVRGVNKFGVGDPLES-EPVIAKNAFVTPGQPSTPEATDITRTSMQVIWNKPGVDGGSMVTGYYLERRDKKSLRWVKVYKDP-------ISDTKAKVHHLTEGNEYQYRVCAINKAGE 22885          

HSP 46 Score: 179.104 bits (453), Expect = 1.155e-43
Identity = 154/560 (27.50%), Postives = 248/560 (44.29%), Query Frame = 0
Query:  603 VNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATVK--GLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKD-KFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPSIDKGSSSSKTIKVNRTAIW 1156
            V  +D P PP  I++  ++K+S  +    P+ DGG  + +YIIE  +  +S   +  V     K   S K+  L     Y FR    N  G+ +P E +G  +++    + P  P +  V+D + ++  LAW  P  DGG+ IT Y IE  +     W +   L  +D E             T   L E  +Y+FR++AVN  G   P E   +V  + + + P +    I    I +  G+    D+   G P P  +W  N + L    +R+ I    K T    K T+L  T      D+G YT+++    G       V +L  P++P+  +  DEI A  + +SW  P  DGG PI++YV++  D     W+   E+  ++ T K   L  G  Y F V A N+ G  E  ++ E +  ++    P  P  P + D     +T+ W+ P +DGG  ++ YII++K+ +   W  A K         +     R   L EG  Y+ R+ A+N  G   PS  +KP +       P   +    ++T K + +  W
Sbjct: 25155 VERIDTPGPPGPIKMKELTKDSAHITWDAPEVDGGAPVNNYIIERRE--ASMRAYKTVTSKCSK--TSYKITGLTEGMLYYFRVLPENIYGIGEPCE-TGDVVLV---CEVPLPPAKLEVVDVTKSTVSLAWEKPLHDGGSRITGYIIEACKAGTDKWMKVATLKLTDFEF------------TVVSLNETEQYLFRVRAVNSRGPGEPKEIVTAVTVQEQRVMPKVDFSAIPQKMISVLAGKPLDLDLPIIGRPPPVCSWFFNDNRL-KIVERVKI----KSTGKFSKLTILDTTID----DSGVYTLEVKNVTGVITENIKVIILSKPDEPQGPIRFDEIDATSVTISWDPPARDGGAPISNYVVEQRDAHRPGWVPVSESV-SRPTFKFNRLTEGDEYVFRVAAANRYGTGEYLQS-EVVMCKSSKSIPGPPGRPIVFDVSRDGMTVAWEPPDEDGGLEVSGYIIERKEVRADRWIRANKNP-------VTMTRYRSTDLIEGLEYEHRVTAINARGVGKPSLLSKPAVATDPVDPPGSPQNPRVTETTKSSVSLAW 25676          

HSP 47 Score: 177.563 bits (449), Expect = 3.506e-43
Identity = 155/548 (28.28%), Postives = 245/548 (44.71%), Query Frame = 0
Query:  573 LNVINPKREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVL-DWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRYLKPFLH-QPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPR-XLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAG 1116
            L++ +  R  SG Y + ++N+ G     + V ++D P  P  + V  I K+S  +   PP  DGG +IK+Y+++  +  S+   ++ V     K   + KV NL     Y FR  A N  G+  P E        + P     +P R  +L D +  S  LAW  PE DGG+ I  Y IE + K    W  G   N    E            GT  GL  G+EY+FR+ A N+ G S P   +  V+A    ++P L  Q   Y+  +K G+ F+ +I   G P P +TW ++G  L     +++  + +  T     +T+L +T+A +  D G Y +              + +LD P  P   +  +E+    +++SW  P   GG  +  Y+++  D     W   A     T   V  LK G  YQF V+A N+ G+  P  + + I  + PYKPP  P  P +       +T+ W +P  DGG  +  Y ++ K++    +  L       +  I +   +I  L EG  Y+FR+ A N  G
Sbjct: 19818 LSIDSCDRRDSGKYTVTLQNSSGSVSEFVTVKVLDTPGAPLNLVVKDIKKDSVTLVWEPPLIDGGAKIKNYVVDKRE--STRKAYANVTTKCSK--TTYKVENLAEGAMYYFRVMAENEYGVGVPVETKTASKASEVP-----QPVRKVMLTDVTKISASLAWDKPEDDGGSRIAGYLIEMQPKGTDKW--GVATNVKTCE------------GTVTGLTSGHEYLFRVLAYNEKGKSEPKPLAAPVIANDLTIEPSLKLQFNTYS--VKSGKDFKLEIPIFGRPKPKITWSKDGQQL-----KVTSRVTTSNT---PTSTILQITEACKD-DLGKYAVTATNSVCAITEDINIVILDKPGPPTGPIKVNEVSNNSVSISWEPPEYTGGCQVKHYIVEKRDTTESTWQTVAGSVARTSLKVTKLKTGAEYQFRVVAENRYGKGAPLDS-KSIVVQYPYKPPGPPGTPYVKSATKDQMTIEWNEPVIDGGSSVIGYHLESKERTSILWTKLN------KTLITDTVFKICNLEEGIGYEFRVYAENIVG 20324          

HSP 48 Score: 172.94 bits (437), Expect = 9.881e-42
Identity = 153/535 (28.60%), Postives = 235/535 (43.93%), Query Frame = 0
Query:  608 KPDPPKTIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTCKGLVEGNEYVFRIKAVNKGGA-SLPSETSDSVLAKTRYLKPFLHQPGIYN--IEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVP-EKPRXLNPDEIRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDW-LXAMETKDTKATVKGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFGGWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRHKNLTPS 1137
            +P PP T  V H +K   +V  + P +DGG+ +  Y +E  +   +S  W++V +   K  +  KV  +     Y FR  A N  G+    + S + I  +DP D    PG+P +   + +S  L+W  PE DGGA +T Y IE ++   G W +    N   +E   DV           GL    +Y FR+ A N  G  S PS+ +  +  K     P +     +   + IK G   + +    G P P  +W ++G  +   + RI I          + +TV+ +    RS D+G Y + L    G+        +LD P      L+   + AE   LSW  P + GG  IT YV++  +     W L   E K     V  L  G+ Y F V+AVNK G  E   + E ++  +PY  P+ P    I    ++ +TL W KP+ DGG  I  YII++++K G  +  +  +       + +  A I  +  G  Y+FR+ A N AG S  S  +         L PS
Sbjct: 21323 QPGPPSTPRVAHATKAFMLVTWNEPVNDGGSTVIGYHLERKE--RTSILWTKVNRTLIKDTE-FKVTGIEEGMMYEFRIYAENIAGIGKASKAS-EPIAARDPCD---PPGQPVITSITKSSVSLSWTKPEYDGGAKVTGYIIERRDLPEGRWIRCNFTNV--VETYFDVT----------GLTVDEKYDFRVTAKNAAGLFSEPSDNTGPITVKDNVDPPRIMMDVKFRDVVLIKSGEILKINADIAGRPLPVASWTKDGHEIERKA-RIQI-------TGTDTSTVIVIKDCKRS-DSGLYALTLQNVVGSVTTPVNCVILDKPGPSAGPLSVTGLTAEECTLSWGPPQEIGGAEITHYVVEKRETSRLAWTLVHGEVKTRTLKVTKLLKGNEYIFRVLAVNKFGLGEALES-EIVRVTDPYTIPTAPTNVEITSVTSEEMTLSWAKPTSDGGSEILGYIIERREKSGLHWVRVNRE------LVKDTTAEISKVRRGCEYEFRVYAENAAGLSLASDPSPSARAEDALLAPS 21822          

HSP 49 Score: 168.318 bits (425), Expect = 2.119e-40
Identity = 158/568 (27.82%), Postives = 252/568 (44.37%), Query Frame = 0
Query:  579 KREKSGSYKIIIRNAQGFDERLINVNIMDKPDPPK-TIEVTHISKNSCVVKLSPPDDDGGTEIKHYIIEAIDVSSSSNQWSQVAQADGKGPKSIKVNNLINKHRYRFRARAANRIGLSDPHEISGQDIIIKDPWDEPDKPGRPSVLDWSSNSCDLAWALPESDGGAPITHYEIEYKEKSMGLWQQGEILNTSDIEIKTDVNGKPMVHGTC---KGLVEGNEYVFRIKAVNKGGASLPSETSDSVLAKTRY-LKPFLHQPGIYNIEIKKGRTFRYDIWFGGEPAPSVTWERNGSLLLGDSDRISIELFSKKTVYCEKNTVLTVTKANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEK---PRXLNPDE----IRAEHINLSWATPHDDGGTPITSYVIKMMDIDNGDWLXAMETKDTKATV--KGLKPGHIYQFEVIAVNKEGESEPCRTLEPIKAENPYKPPSEPKEPNIVDFDNQSVTLRWQKPSDDGGRPITHYIIQKKDKFG-GWFDALKTDDASCEARIDELEARIPGLSEGKWYQFRIIAVNKAGESSPSFETKPHLCRH 1131
            +R   G Y+I I N  G  + +  V I+DKP  P+  + +  + KNS ++    P DDGG+ I +YI+E  +      +W  V+ +      S ++ NL+    Y FR  A NR G S+  E +   I+IK   + P  P +P V   + NS  ++W  P SDGG+ I +Y +E +++  G W          + + TD      +H T    KGL EG EY FR+K  N GG S  SE SD  + KT   ++    +  + N+ +K      +     G+P P + W + G  +  D  +I I+ F  K  Y +