EMLSAG00000000156, EMLSAG00000000156-682922 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000156 vs. C. finmarchicus
Match: gi|592930322|gb|GAXK01028223.1| (TSA: Calanus finmarchicus comp7979607_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.860e-1 Identity = 15/39 (38.46%), Postives = 21/39 (53.85%), Query Frame = 0 Query: 46 IRLLSHSSKCPQFFLVQICKLPGQFLNKCIVAILLKYYW 84 I L+S P FF I K P + NKC ++I L ++W Sbjct: 184 IFLVSIMCNGPCFFFFVIIKNPASYSNKCSISIFLSFFW 300
BLAST of EMLSAG00000000156 vs. C. finmarchicus
Match: gi|592889044|gb|GAXK01069331.1| (TSA: Calanus finmarchicus comp2982703_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 7.284e+0 Identity = 13/24 (54.17%), Postives = 16/24 (66.67%), Query Frame = 0 Query: 63 ICKLPGQFLNKCIVAILLKYYWPY 86 IC +PGQ KC AI L +Y+PY Sbjct: 71 ICPIPGQ--TKCHQAISLHFYFPY 136
BLAST of EMLSAG00000000156 vs. L. salmonis peptides
Match: EMLSAP00000000156 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1024:172925:176606:1 gene:EMLSAG00000000156 transcript:EMLSAT00000000156 description:"snap_masked-LSalAtl2s1024-processed-gene-1.11") HSP 1 Score: 200.675 bits (509), Expect = 1.219e-67 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0 Query: 1 MHLKKLKRLLILLFLLIQKKYIYIYTIQHDSFTSRNYNIIRTALIIRLLSHSSKCPQFFLVQICKLPGQFLNKCIVAILLKYYWPYDLNMKCSVFVGINS 100 MHLKKLKRLLILLFLLIQKKYIYIYTIQHDSFTSRNYNIIRTALIIRLLSHSSKCPQFFLVQICKLPGQFLNKCIVAILLKYYWPYDLNMKCSVFVGINS Sbjct: 1 MHLKKLKRLLILLFLLIQKKYIYIYTIQHDSFTSRNYNIIRTALIIRLLSHSSKCPQFFLVQICKLPGQFLNKCIVAILLKYYWPYDLNMKCSVFVGINS 100 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000156 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000156 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000000156 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000156 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000156 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000156 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000156 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1024:172925..176606+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000156-682922 ID=EMLSAG00000000156-682922|Name=EMLSAG00000000156|organism=Lepeophtheirus salmonis|type=gene|length=3682bp|location=Sequence derived from alignment at LSalAtl2s1024:172925..176606+ (Lepeophtheirus salmonis)back to top Add to Basket
|