EMLSAG00000000423, EMLSAG00000000423-683189 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000423 vs. C. finmarchicus
Match: gi|592877608|gb|GAXK01080136.1| (TSA: Calanus finmarchicus comp565173_c1_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 8.355e-1 Identity = 14/36 (38.89%), Postives = 19/36 (52.78%), Query Frame = 0 Query: 18 ILYCDLPPRFYEYSLGIGTASIFISATSNIFSDFRD 53 I Y LPP Y Y G+G S +S++FS +D Sbjct: 727 IHYISLPPNPYSYVPGVGYISPAAKPSSHVFSHSQD 834
BLAST of EMLSAG00000000423 vs. C. finmarchicus
Match: gi|592832501|gb|GAXK01125043.1| (TSA: Calanus finmarchicus comp24826_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 2.188e+0 Identity = 9/23 (39.13%), Postives = 13/23 (56.52%), Query Frame = 0 Query: 1 MHWELWSWFWVSTGFYYILYCDL 23 +HW WFW+S F ++ C L Sbjct: 795 VHWTFAGWFWLSFSFRFLFLCCL 863
BLAST of EMLSAG00000000423 vs. L. salmonis peptides
Match: EMLSAP00000000423 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1067:72464:72909:-1 gene:EMLSAG00000000423 transcript:EMLSAT00000000423 description:"snap-LSalAtl2s1067-processed-gene-0.29") HSP 1 Score: 123.25 bits (308), Expect = 2.028e-38 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0 Query: 1 MHWELWSWFWVSTGFYYILYCDLPPRFYEYSLGIGTASIFISATSNIFSDFRDAIPHDA 59 MHWELWSWFWVSTGFYYILYCDLPPRFYEYSLGIGTASIFISATSNIFSDFRDAIPHDA Sbjct: 1 MHWELWSWFWVSTGFYYILYCDLPPRFYEYSLGIGTASIFISATSNIFSDFRDAIPHDA 59
BLAST of EMLSAG00000000423 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold203_size261420-snap-gene-0.15 (protein:Tk10409 transcript:maker-scaffold203_size261420-snap-gene-0.15-mRNA-1 annotation:"hypothetical protein NECAME_08315") HSP 1 Score: 67.781 bits (164), Expect = 5.634e-16 Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 0 Query: 1 MHWELWSWFWVSTGFYYILYCDLPPRFYEYSLGIGTASIFISATSNIFSDFRDAIPH 57 +HWE W+WFW Y+ C +PPR+YEY +G+GT SI + SN+ SD+R +P Sbjct: 81 LHWEAWTWFWCILAGYFSFCCAMPPRYYEYCVGLGTTSIMVCLISNLLSDYRLNLPE 137 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000423 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000423 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000000423 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000423 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000423 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000423 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000423 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1067:72464..72909- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000423-683189 ID=EMLSAG00000000423-683189|Name=EMLSAG00000000423|organism=Lepeophtheirus salmonis|type=gene|length=446bp|location=Sequence derived from alignment at LSalAtl2s1067:72464..72909- (Lepeophtheirus salmonis)back to top Add to Basket
|