EMLSAG00000000672, EMLSAG00000000672-683438 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592757733|gb|GAXK01196680.1| (TSA: Calanus finmarchicus comp249423_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 2.357e-2 Identity = 16/51 (31.37%), Postives = 25/51 (49.02%), Query Frame = 0 Query: 26 HPDYDSTTHENDIVILTTVFNMGPNIN----SIPVCLPQVSTHDFTDMPAT 72 HPD+D T +ND+ +L+ + G + +P CLP H +P T Sbjct: 543 HPDFDPNTLQNDVAVLSIISTYGQGVRWTDWVLPACLP-APNHPALYLPGT 692
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592757732|gb|GAXK01196681.1| (TSA: Calanus finmarchicus comp249423_c0_seq2 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 2.455e-2 Identity = 16/51 (31.37%), Postives = 25/51 (49.02%), Query Frame = 0 Query: 26 HPDYDSTTHENDIVILTTVFNMGPNIN----SIPVCLPQVSTHDFTDMPAT 72 HPD+D T +ND+ +L+ + G + +P CLP H +P T Sbjct: 525 HPDFDPNTLQNDVAVLSIISTYGQGVRWTDWVLPACLP-APNHPALYLPGT 674
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592937114|gb|GAXK01021439.1| (TSA: Calanus finmarchicus comp3080394_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 3.696e-2 Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 0 Query: 7 DSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINS-IPVCLPQVSTHDFTDMPA 71 D+E+ PR I+ ++ HP YD T +NDI ++ + ++N+ P CL S DFTD A Sbjct: 191 DTESIIPR-IVVQVAKIIKHPAYDKETRDNDIAMIK--LSTPVDLNTYTPACLAN-SGDDFTDKKA 376
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592908772|gb|GAXK01049603.1| (TSA: Calanus finmarchicus comp4752098_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 4.022e-2 Identity = 20/56 (35.71%), Postives = 27/56 (48.21%), Query Frame = 0 Query: 20 ISDKAYHPDYDSTTHENDIVIL----TTVFNMGPNINSIPVCLPQVSTHDFTDMPA 71 IS+ HPDY TH D+ +L + F PNI P+CLP+ D+ A Sbjct: 39 ISNIVNHPDYVRRTHNYDLTLLKLETSIKFAFYPNIR--PICLPENDDKDYAGNSA 200
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Match: gi|592885894|gb|GAXK01072481.1| (TSA: Calanus finmarchicus comp4060346_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 4.216e-2 Identity = 16/55 (29.09%), Postives = 27/55 (49.09%), Query Frame = 0 Query: 18 YSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 +++ K HP Y+S T + D ILT + P+CLP + + ++ AT Sbjct: 172 HTVCGKTEHPQYNSRTQDKDFSILTLCSPLSFRREVQPICLPSLPGPSYDNVAAT 336
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000000672 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11073:836:1279:-1 gene:EMLSAG00000000672 transcript:EMLSAT00000000672 description:"snap_masked-LSalAtl2s11073-processed-gene-0.0") HSP 1 Score: 153.68 bits (387), Expect = 6.649e-50 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0 Query: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK 74 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK Sbjct: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPATCK 74
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000009899 (pep:novel supercontig:LSalAtl2s:LSalAtl2s645:169207:181410:1 gene:EMLSAG00000009899 transcript:EMLSAT00000009899 description:"maker-LSalAtl2s645-snap-gene-1.9") HSP 1 Score: 105.916 bits (263), Expect = 5.916e-29 Identity = 51/60 (85.00%), Postives = 53/60 (88.33%), Query Frame = 0 Query: 1 IKTGSVDSEAFSPRYILYSISDKAYHPDYDSTTHENDIVILTTVFNMGPNINSIPVCLPQ 60 IKTGS+DSEAFS RYILYSISDK YHP YDSTTH+NDIVILT FNM PNIN IPVCLPQ Sbjct: 334 IKTGSLDSEAFSTRYILYSISDKEYHPYYDSTTHQNDIVILTAEFNMVPNINLIPVCLPQ 393
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Match: EMLSAP00000002190 (pep:novel supercontig:LSalAtl2s:LSalAtl2s14046:94:441:1 gene:EMLSAG00000002190 transcript:EMLSAT00000002190 description:"maker-LSalAtl2s14046-snap-gene-0.3") HSP 1 Score: 76.2554 bits (186), Expect = 1.648e-19 Identity = 37/44 (84.09%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 29 YDSTTHENDIVILTTVFNMGPNINSIPVCLPQVSTHDFTDMPAT 72 YDSTTHENDIVILT FN+ PNIN IPVCLPQVSTHDFT+M AT Sbjct: 1 YDSTTHENDIVILTAEFNIVPNINLIPVCLPQVSTHDFTNMLAT 44 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000672 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000672 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000672 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 3
BLAST of EMLSAG00000000672 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000672 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000672 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000672 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s11073:836..1279- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000672-683438 ID=EMLSAG00000000672-683438|Name=EMLSAG00000000672|organism=Lepeophtheirus salmonis|type=gene|length=444bp|location=Sequence derived from alignment at LSalAtl2s11073:836..1279- (Lepeophtheirus salmonis)back to top Add to Basket
|