EMLSAG00000000749, EMLSAG00000000749-683515 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000749 vs. GO
Match: - (symbol:K7GKC0 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR000754 Pfam:PF00380 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:3.30.230.10 InterPro:IPR020568 InterPro:IPR014721 SUPFAM:SSF54211 PANTHER:PTHR21569 GeneTree:ENSGT00390000013067 EMBL:FP236263 Ensembl:ENSSSCT00000034766 Uniprot:K7GKC0) HSP 1 Score: 47.3654 bits (111), Expect = 8.108e-7 Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C G G+IKVNG PLE +EP LQYKL EP++L+ Sbjct: 17 KTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLL 58
BLAST of EMLSAG00000000749 vs. GO
Match: - (symbol:RPS16 "40S ribosomal protein S16" species:9606 "Homo sapiens" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR000754 InterPro:IPR020574 Pfam:PF00380 PROSITE:PS00360 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:3.30.230.10 InterPro:IPR020568 InterPro:IPR014721 SUPFAM:SSF54211 EMBL:AC011500 PANTHER:PTHR21569 HGNC:HGNC:10396 ProteinModelPortal:M0R1M5 Ensembl:ENST00000599705 ArrayExpress:M0R1M5 Uniprot:M0R1M5) HSP 1 Score: 46.9802 bits (110), Expect = 1.175e-6 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G+IKVNG PLE +EP LQYKL EP++L+ Sbjct: 9 KRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLL 41
BLAST of EMLSAG00000000749 vs. GO
Match: - (symbol:CPAR2_105960 species:5480 "Candida parapsilosis" [GO:0000462 "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)" evidence=IEA] [GO:0030686 "90S preribosome" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR000754 InterPro:IPR020574 Pfam:PF00380 PROSITE:PS00360 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:3.30.230.10 InterPro:IPR020568 InterPro:IPR014721 SUPFAM:SSF54211 PANTHER:PTHR21569 OrthoDB:EOG7ZPNXQ EMBL:HE605203 Uniprot:G8B7X5) HSP 1 Score: 45.4394 bits (106), Expect = 6.772e-6 Identity = 18/34 (52.94%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 16 IKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 +K GKG+IK+NGSP+ V+P +L++K+ EP+ LV Sbjct: 21 VKNGKGLIKINGSPITLVQPEILRFKVYEPLTLV 54
BLAST of EMLSAG00000000749 vs. GO
Match: - (symbol:RGD1561137 "Protein RGD1561137" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR000754 InterPro:IPR020574 Pfam:PF00380 PROSITE:PS00360 RGD:1561137 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:3.30.230.10 InterPro:IPR020568 InterPro:IPR014721 SUPFAM:SSF54211 PANTHER:PTHR21569 GeneTree:ENSGT00390000013067 OrthoDB:EOG754HQW EMBL:AABR06022691 Ensembl:ENSRNOT00000043621 Uniprot:M0R4I3) HSP 1 Score: 45.4394 bits (106), Expect = 7.562e-6 Identity = 22/47 (46.81%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 5 IYKIVKIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 ++ K T + C G G+IKVNG PLE +E LQYKL EP++L+ Sbjct: 30 VFGCKKTATAVAHCKRGNGLIKVNGRPLEMIESRTLQYKLLEPVLLL 76
BLAST of EMLSAG00000000749 vs. GO
Match: - (symbol:RGD1561137 "similar to 40S ribosomal protein S16" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR000754 InterPro:IPR020574 Pfam:PF00380 PROSITE:PS00360 RGD:1561137 GO:GO:0006412 GO:GO:0005840 GO:GO:0003735 Gene3D:3.30.230.10 InterPro:IPR020568 InterPro:IPR014721 SUPFAM:SSF54211 PANTHER:PTHR21569 GeneTree:ENSGT00390000013067 OrthoDB:EOG754HQW EMBL:AABR06022691 Ensembl:ENSRNOT00000043621 Uniprot:M0R4I3) HSP 1 Score: 45.4394 bits (106), Expect = 7.562e-6 Identity = 22/47 (46.81%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 5 IYKIVKIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 ++ K T + C G G+IKVNG PLE +E LQYKL EP++L+ Sbjct: 30 VFGCKKTATAVAHCKRGNGLIKVNGRPLEMIESRTLQYKLLEPVLLL 76
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592784355|gb|GAXK01170213.1| (TSA: Calanus finmarchicus comp310_c1_seq2 transcribed RNA sequence) HSP 1 Score: 51.2174 bits (121), Expect = 2.807e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG+IKVNG PLE VEP L YKL+EPI+L+ Sbjct: 347 KRGKGLIKVNGRPLELVEPRALSYKLQEPILLL 445
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592784356|gb|GAXK01170212.1| (TSA: Calanus finmarchicus comp310_c1_seq1 transcribed RNA sequence) HSP 1 Score: 51.2174 bits (121), Expect = 2.807e-8 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG+IKVNG PLE VEP L YKL+EPI+L+ Sbjct: 347 KRGKGLIKVNGRPLELVEPRALSYKLQEPILLL 445
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592869830|gb|GAXK01087732.1| (TSA: Calanus finmarchicus comp4300994_c0_seq1 transcribed RNA sequence) HSP 1 Score: 46.2098 bits (108), Expect = 1.916e-6 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G+IKVNG PL +EP +LQYKL EPI+L+ Sbjct: 115 KRGHGLIKVNGRPLSIIEPRLLQYKLYEPILLL 213
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592810542|gb|GAXK01144026.1| (TSA: Calanus finmarchicus comp6494520_c0_seq1 transcribed RNA sequence) HSP 1 Score: 40.817 bits (94), Expect = 1.158e-4 Identity = 18/33 (54.55%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G+IKVNG P+E VEP +L+ K EP++L+ Sbjct: 67 KRGSGLIKVNGCPIELVEPEILRVKTFEPVLLL 165
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592758797|gb|GAXK01195616.1| (TSA: Calanus finmarchicus comp3126592_c0_seq1 transcribed RNA sequence) HSP 1 Score: 39.6614 bits (91), Expect = 2.742e-4 Identity = 15/31 (48.39%), Postives = 25/31 (80.65%), Query Frame = 0 Query: 19 GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 G+G+I+VNG PLE + P VL+ K+ EP++++ Sbjct: 70 GQGLIRVNGVPLEQIRPEVLRVKVLEPVLVL 162
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Match: gi|592954720|gb|GAXK01003833.1| (TSA: Calanus finmarchicus comp2093893_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.039 bits (79), Expect = 1.826e-2 Identity = 14/34 (41.18%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 16 IKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 ++ GKG+++VNGSP++ V+P K+ EP++L+ Sbjct: 276 VRTGKGVLRVNGSPIDLVKPESY*IKILEPVLLL 377
BLAST of EMLSAG00000000749 vs. L. salmonis peptides
Match: EMLSAP00000000749 (pep:novel supercontig:LSalAtl2s:LSalAtl2s111:437363:462272:-1 gene:EMLSAG00000000749 transcript:EMLSAT00000000749 description:"snap_masked-LSalAtl2s111-processed-gene-4.3") HSP 1 Score: 221.09 bits (562), Expect = 2.299e-75 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0 Query: 1 MIEFIYKIVKIITKMIKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLVVYKLVTTQVSNIEEDRAYAYCYINDPKIMFLLDLGSNGNILPKQYIARKSMEENTGIYLNA 110 MIEFIYKIVKIITKMIKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLVVYKLVTTQVSNIEEDRAYAYCYINDPKIMFLLDLGSNGNILPKQYIARKSMEENTGIYLNA Sbjct: 1 MIEFIYKIVKIITKMIKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLVVYKLVTTQVSNIEEDRAYAYCYINDPKIMFLLDLGSNGNILPKQYIARKSMEENTGIYLNA 110
BLAST of EMLSAG00000000749 vs. L. salmonis peptides
Match: EMLSAP00000008099 (pep:novel supercontig:LSalAtl2s:LSalAtl2s481:72730:74131:1 gene:EMLSAG00000008099 transcript:EMLSAT00000008099 description:"maker-LSalAtl2s481-augustus-gene-0.35") HSP 1 Score: 53.5286 bits (127), Expect = 2.531e-10 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG++KVNG PLE VEP LQYKL+EPI+L+ Sbjct: 27 KRGKGLVKVNGRPLEQVEPKALQYKLQEPILLL 59
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|54039384|sp|P62251.1|RS16_AEDAE (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 50.8322 bits (120), Expect = 5.182e-8 Identity = 20/33 (60.61%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG+++VNG PL+ +EP VLQYKL+EP++L+ Sbjct: 28 KRGKGLLRVNGRPLDQIEPKVLQYKLQEPLLLL 60
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|54039449|sp|Q9W237.1|RS16_DROME (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 50.447 bits (119), Expect = 7.645e-8 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G++KVNG PLE +EP VLQYKL+EP++L+ Sbjct: 28 KRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLL 60
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|59800207|sp|Q6FR56.1|RS16_CANGA (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 48.1358 bits (113), Expect = 4.395e-7 Identity = 20/34 (58.82%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 16 IKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 +K GKG+IKVNGSP+ VEP +L++K+ EP++LV Sbjct: 22 VKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLV 55
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|338819318|sp|P0CX51.1|RS16A_YEAST (RecName: Full=40S ribosomal protein S16-A; AltName: Full=RP61R >gi|338819319|sp|P0CX52.1|RS16B_YEAST RecName: Full=40S ribosomal protein S16-B; AltName: Full=RP61R) HSP 1 Score: 48.1358 bits (113), Expect = 4.830e-7 Identity = 20/34 (58.82%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 16 IKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 +K GKG+IKVNGSP+ VEP +L++K+ EP++LV Sbjct: 22 VKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLV 55
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|50403607|sp|P62249.2|RS16_HUMAN (RecName: Full=40S ribosomal protein S16 >gi|54039370|sp|P62250.2|RS16_RAT RecName: Full=40S ribosomal protein S16 >gi|54039372|sp|P14131.4|RS16_MOUSE RecName: Full=40S ribosomal protein S16 >gi|60394813|sp|Q29201.4|RS16_PIG RecName: Full=40S ribosomal protein S16 >gi|108860953|sp|Q3T0X6.3|RS16_BOVIN RecName: Full=40S ribosomal protein S16) HSP 1 Score: 48.1358 bits (113), Expect = 5.670e-7 Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C G G+IKVNG PLE +EP LQYKL EP++L+ Sbjct: 17 KTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLL 58
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|2500429|sp|Q22054.3|RS16_CAEEL (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 47.7506 bits (112), Expect = 6.240e-7 Identity = 22/42 (52.38%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C G+G+IKVNG PLE +EP +L+ KL+EP++LV Sbjct: 15 KTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLV 56
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|54039445|sp|Q90YQ7.1|RS16_ICTPU (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 47.7506 bits (112), Expect = 7.138e-7 Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C G G+IKVNG PLE +EP LQYKL EP++L+ Sbjct: 17 KTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLL 58
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|54039448|sp|Q98TR7.1|RS16_HETFO (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 47.7506 bits (112), Expect = 7.138e-7 Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C G G+IKVNG PLE +EP LQYKL EP++L+ Sbjct: 17 KTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLL 58
BLAST of EMLSAG00000000749 vs. SwissProt
Match: gi|54039446|sp|Q95V31.1|RS16_SPOFR (RecName: Full=40S ribosomal protein S16) HSP 1 Score: 47.7506 bits (112), Expect = 7.914e-7 Identity = 20/33 (60.61%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G+++VNG PL+ VEP +LQYKL+EPI+L+ Sbjct: 31 KRGHGVLRVNGRPLDLVEPRLLQYKLQEPILLL 63
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: AHN56526.1 (ribosomal protein S16, isoform B [Drosophila melanogaster]) HSP 1 Score: 50.447 bits (119), Expect = 3.705e-8 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G++KVNG PLE +EP VLQYKL+EP++L+ Sbjct: 28 KRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLL 60
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: AAF46862.1 (ribosomal protein S16, isoform A [Drosophila melanogaster]) HSP 1 Score: 50.447 bits (119), Expect = 3.705e-8 Identity = 21/33 (63.64%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G G++KVNG PLE +EP VLQYKL+EP++L+ Sbjct: 28 KRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLL 60
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: XP_001122174.1 (PREDICTED: 40S ribosomal protein S16 [Apis mellifera]) HSP 1 Score: 48.9062 bits (115), Expect = 1.187e-7 Identity = 22/33 (66.67%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K G+G ++VNG PLE VEP VLQYKL+EPI+L+ Sbjct: 28 KRGRGNLRVNGRPLELVEPRVLQYKLQEPILLL 60
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: EAA43797.2 (AGAP011424-PA, partial [Anopheles gambiae str. PEST]) HSP 1 Score: 48.521 bits (114), Expect = 1.677e-7 Identity = 19/42 (45.24%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 10 KIITKMIKC--GKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K T + C GKG++++NG PL+ +EP +L+YKL+EP++L+ Sbjct: 19 KTATAVAHCKRGKGLLRINGRPLDQIEPKILRYKLQEPLLLL 60
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: EEB11520.1 (40S ribosomal protein S16, putative [Pediculus humanus corporis]) HSP 1 Score: 47.3654 bits (111), Expect = 4.891e-7 Identity = 20/33 (60.61%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG I+VNG PL+ +EP +LQYKL+EP +L+ Sbjct: 29 KRGKGNIRVNGRPLDMIEPRILQYKLQEPFLLL 61
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Match: gb|EEZ98753.1| (40S ribosomal protein S16-like Protein [Tribolium castaneum]) HSP 1 Score: 47.3654 bits (111), Expect = 5.901e-7 Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKGI++VNG PL VEP +LQ KL+EPI+L+ Sbjct: 32 KRGKGILRVNGRPLSQVEPKMLQDKLQEPILLL 64
BLAST of EMLSAG00000000749 vs. nr
Match: gi|1108477083|emb|CRK95108.1| (CLUMA_CG008586, isoform A [Clunio marinus]) HSP 1 Score: 53.9138 bits (128), Expect = 9.291e-7 Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 0 Query: 4 FIYKIVKIITKMIKCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 F K I T K G+G+++VNG PLE +EP +LQYKL+EP++L+ Sbjct: 22 FGRKKTAIATAYCKRGRGLLRVNGRPLEQIEPKILQYKLQEPLLLL 67
BLAST of EMLSAG00000000749 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold272_size230267-snap-gene-0.18 (protein:Tk00250 transcript:maker-scaffold272_size230267-snap-gene-0.18-mRNA-1 annotation:"40s ribosomal protein s16-like") HSP 1 Score: 54.299 bits (129), Expect = 8.278e-11 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 17 KCGKGIIKVNGSPLEHVEPNVLQYKLKEPIVLV 49 K GKG++KVNG PLE VEP LQYKL+EPI+L+ Sbjct: 27 KRGKGLVKVNGRPLEQVEPKALQYKLQEPILLL 59 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000749 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000749 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000000749 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000000749 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 9
BLAST of EMLSAG00000000749 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 6
BLAST of EMLSAG00000000749 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000000749 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s111:437363..462272- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000749-683515 ID=EMLSAG00000000749-683515|Name=EMLSAG00000000749|organism=Lepeophtheirus salmonis|type=gene|length=24910bp|location=Sequence derived from alignment at LSalAtl2s111:437363..462272- (Lepeophtheirus salmonis)back to top Add to Basket
|