EMLSAG00000000789, EMLSAG00000000789-683555 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:AstA-R1 "Allatostatin A receptor 1" species:7227 "Drosophila melanogaster" [GO:0008261 "allatostatin receptor activity" evidence=ISS;NAS;IPI] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0005887 EMBL:AE014298 CTD:44126 KO:K04233 GO:GO:0008188 GeneTree:ENSGT00620000087530 OrthoDB:EOG7673B7 GO:GO:0008261 EMBL:AF163775 EMBL:AF220216 EMBL:BT150204 PIR:JC7209 RefSeq:NP_524700.1 RefSeq:NP_726877.2 UniGene:Dm.1859 SMR:Q9U721 EnsemblMetazoa:FBtr0070575 EnsemblMetazoa:FBtr0333798 GeneID:44126 KEGG:dme:Dmel_CG2872 UCSC:CG2872-RB FlyBase:FBgn0266429 InParanoid:Q9U721 OMA:CAWITIV GenomeRNAi:44126 NextBio:836821 Uniprot:Q9U721) HSP 1 Score: 88.1965 bits (217), Expect = 5.605e-20 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 367
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:AR "Allatostatin-A receptor" species:7091 "Bombyx mori" [GO:0042562 "hormone binding" evidence=IDA] [GO:0042923 "neuropeptide binding" evidence=IDA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0005886 GO:GO:0004930 GO:GO:0042562 EMBL:AF254742 EMBL:AF303370 EMBL:AF303368 EMBL:AF303369 RefSeq:NP_001037035.1 UniGene:Bmo.692 ProteinModelPortal:Q8WPA2 GeneID:692587 KEGG:bmor:692587 CTD:44126 KO:K04233 GO:GO:0042923 Uniprot:Q8WPA2) HSP 1 Score: 82.8037 bits (203), Expect = 3.482e-18 Identity = 45/94 (47.87%), Postives = 58/94 (61.70%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 F + W PI IILL+++LN Y T +T QI++H+LAY NSCVNP+LYAFLSE FR F V+ C P+ +G A K + G GNS Sbjct: 267 FAVCWCPIQIILLVKALNKYHITYFTVTAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYC---PPPYNDGFSGRPQAT-KTTRTGNGNS 356
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:AstA-R2 "Allatostatin A receptor 2" species:7227 "Drosophila melanogaster" [GO:0008261 "allatostatin receptor activity" evidence=ISS;IPI] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] [GO:0004983 "neuropeptide Y receptor activity" evidence=IEA] InterPro:IPR000276 InterPro:IPR000611 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01012 PROSITE:PS00237 PROSITE:PS50262 EMBL:AE014297 GO:GO:0005887 KO:K04233 GO:GO:0008188 GeneTree:ENSGT00620000087530 GO:GO:0004983 OrthoDB:EOG7673B7 GO:GO:0008261 EMBL:AF253526 EMBL:BT003199 PIR:JC7319 RefSeq:NP_001263042.1 RefSeq:NP_524544.1 UniGene:Dm.2335 SMR:Q9NBC8 STRING:7227.FBpp0084685 EnsemblMetazoa:FBtr0085316 GeneID:43393 KEGG:dme:Dmel_CG10001 UCSC:CG10001-RA CTD:43393 FlyBase:FBgn0039595 eggNOG:NOG315693 InParanoid:Q9NBC8 GenomeRNAi:43393 NextBio:833696 Uniprot:Q9NBC8) HSP 1 Score: 73.559 bits (179), Expect = 9.536e-15 Identity = 32/62 (51.61%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYES-TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 WLP+ +ILLL+SL++ E+ T + Q+ A LAYS+SC+NP+LYAFLSE FR+ F+ + C Sbjct: 269 WLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNC 330
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Galr1 "galanin receptor 1" species:10090 "Mus musculus" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004966 "galanin receptor activity" evidence=ISO;TAS] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007189 "adenylate cyclase-activating G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=ISO;TAS] [GO:0007268 "synaptic transmission" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0042923 "neuropeptide binding" evidence=ISO] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:1096364 GO:GO:0016021 GO:GO:0005886 GO:GO:0007204 GO:GO:0007189 GO:GO:0007194 GO:GO:0042923 GuidetoPHARMACOLOGY:243 CTD:2587 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 EMBL:Y15004 EMBL:U90657 EMBL:U90655 EMBL:U90656 RefSeq:NP_032108.1 UniGene:Mm.6219 ProteinModelPortal:P56479 SMR:P56479 STRING:10090.ENSMUSP00000066381 PhosphoSite:P56479 PRIDE:P56479 DNASU:14427 Ensembl:ENSMUST00000065224 GeneID:14427 KEGG:mmu:14427 UCSC:uc008ftq.1 GeneTree:ENSGT00620000087530 InParanoid:P56479 NextBio:286033 PRO:PR:P56479 Bgee:P56479 CleanEx:MM_GALR1 Genevestigator:P56479 Uniprot:P56479) HSP 1 Score: 71.633 bits (174), Expect = 3.838e-14 Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F +SWLP H++ L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C HV D S+ E KS+ D Sbjct: 255 FGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC--------------------HVCDESPRSETKENKSRMDT 339
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Galr1 "Galanin receptor type 1" species:10116 "Rattus norvegicus" [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=IMP;IDA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 RGD:2656 GO:GO:0016021 GO:GO:0005886 GO:GO:0007204 GO:GO:0007189 GO:GO:0007194 GO:GO:0042923 GuidetoPHARMACOLOGY:243 CTD:2587 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:U30290 RefSeq:NP_037090.2 UniGene:Rn.10213 ProteinModelPortal:Q62805 STRING:10116.ENSRNOP00000022400 BindingDB:Q62805 ChEMBL:CHEMBL5504 PhosphoSite:Q62805 PRIDE:Q62805 Ensembl:ENSRNOT00000022401 GeneID:50577 KEGG:rno:50577 InParanoid:Q62805 NextBio:610426 PRO:PR:Q62805 ArrayExpress:Q62805 Genevestigator:Q62805 Uniprot:Q62805) HSP 1 Score: 71.633 bits (174), Expect = 4.157e-14 Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC-IRPSGPHG 107 F +SWLP H+I L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C + PHG Sbjct: 254 FGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCRVCNESPHG 327
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Galr1 "galanin receptor 1" species:10116 "Rattus norvegicus" [GO:0004966 "galanin receptor activity" evidence=IEA;IDA;IMP] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0007189 "adenylate cyclase-activating G-protein coupled receptor signaling pathway" evidence=IMP] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA;IMP] [GO:0016021 "integral component of membrane" evidence=IEA;TAS] [GO:0042923 "neuropeptide binding" evidence=IDA;IMP] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 RGD:2656 GO:GO:0016021 GO:GO:0005886 GO:GO:0007204 GO:GO:0007189 GO:GO:0007194 GO:GO:0042923 GuidetoPHARMACOLOGY:243 CTD:2587 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:U30290 RefSeq:NP_037090.2 UniGene:Rn.10213 ProteinModelPortal:Q62805 STRING:10116.ENSRNOP00000022400 BindingDB:Q62805 ChEMBL:CHEMBL5504 PhosphoSite:Q62805 PRIDE:Q62805 Ensembl:ENSRNOT00000022401 GeneID:50577 KEGG:rno:50577 InParanoid:Q62805 NextBio:610426 PRO:PR:Q62805 ArrayExpress:Q62805 Genevestigator:Q62805 Uniprot:Q62805) HSP 1 Score: 71.633 bits (174), Expect = 4.157e-14 Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC-IRPSGPHG 107 F +SWLP H+I L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C + PHG Sbjct: 254 FGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCRVCNESPHG 327
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR1 "Galanin receptor type 1" species:9606 "Homo sapiens" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005886 "plasma membrane" evidence=TAS] [GO:0007189 "adenylate cyclase-activating G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=TAS] [GO:0007586 "digestion" evidence=TAS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0042923 "neuropeptide binding" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0005886 Reactome:REACT_111102 GO:GO:0007204 GO:GO:0007586 GO:GO:0007189 GO:GO:0007194 EMBL:CH471117 GO:GO:0042923 EMBL:L34339 EMBL:U53511 EMBL:U90660 EMBL:U90658 EMBL:U90659 EMBL:U23854 EMBL:AY541036 EMBL:AC100863 EMBL:BC095530 PIR:I59336 RefSeq:NP_001471.2 UniGene:Hs.272191 ProteinModelPortal:P47211 SMR:P47211 IntAct:P47211 STRING:9606.ENSP00000299727 BindingDB:P47211 ChEMBL:CHEMBL4894 GuidetoPHARMACOLOGY:243 PhosphoSite:P47211 DMDM:311033447 PaxDb:P47211 PRIDE:P47211 DNASU:2587 Ensembl:ENST00000299727 GeneID:2587 KEGG:hsa:2587 UCSC:uc002lms.4 CTD:2587 GeneCards:GC18P074962 H-InvDB:HIX0039721 HGNC:HGNC:4132 MIM:600377 neXtProt:NX_P47211 PharmGKB:PA28545 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 InParanoid:P47211 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK PhylomeDB:P47211 TreeFam:TF315737 GeneWiki:Galanin_receptor_1 GenomeRNAi:2587 NextBio:10233 PRO:PR:P47211 Bgee:P47211 CleanEx:HS_GALR1 Genevestigator:P47211 GO:GO:0004966 Uniprot:P47211) HSP 1 Score: 71.2478 bits (173), Expect = 6.586e-14 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F +SWLP HII L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 256 FGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031175 "neuron projection development" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003907 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01419 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 GO:GO:0031175 OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 OMA:FRKICAG EMBL:AAEX03006287 ProteinModelPortal:E2RNY2 Ensembl:ENSCAFT00000008084 NextBio:20857736 Uniprot:E2RNY2) HSP 1 Score: 71.2478 bits (173), Expect = 8.715e-14 Identity = 37/112 (33.04%), Postives = 55/112 (49.11%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 V +F L W+P H ++L + TP +I +H+++Y+NSCVNPI+YA +S+ FR+GF + CI GP G E D+ HV + G S Sbjct: 241 VAALFCLCWMPHHALILCVWFGRFPLTPATYALRIFSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCIAAQGPRGSSVLERESTDLTHVSEAAGAS 352
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR1 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 CTD:2587 KO:K04230 OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:AAEX03000040 RefSeq:XP_541048.2 ProteinModelPortal:E2R155 Ensembl:ENSCAFT00000000022 GeneID:483928 KEGG:cfa:483928 OMA:CYAKXTA NextBio:20858226 Uniprot:E2R155) HSP 1 Score: 70.0922 bits (170), Expect = 1.504e-13 Identity = 34/65 (52.31%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F +SWLP H+I L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 258 FGISWLPHHVINLWAEFGVFPLTPASFLFRIAAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 322
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR1 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 CTD:2587 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:DAAA02056049 EMBL:DAAA02056050 RefSeq:NP_001179170.1 UniGene:Bt.106515 ProteinModelPortal:E1BCM7 Ensembl:ENSBTAT00000027969 GeneID:539429 KEGG:bta:539429 NextBio:20877982 Uniprot:E1BCM7) HSP 1 Score: 68.5514 bits (166), Expect = 4.852e-13 Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 0 Query: 38 SWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 SWLP H+I L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 259 SWLPHHVIHLWAEFGVFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592847339|gb|GAXK01110205.1| (TSA: Calanus finmarchicus comp1959081_c0_seq1 transcribed RNA sequence) HSP 1 Score: 79.337 bits (194), Expect = 3.154e-18 Identity = 35/59 (59.32%), Postives = 47/59 (79.66%), Query Frame = 0 Query: 43 HIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 +ILLL+S LYE T +N++ QI +H+LAYSNSC+NPILYAFLS PFR GF ++ C++ Sbjct: 243 QLILLLKSFELYEVTILNISVQIGSHVLAYSNSCINPILYAFLSPPFRAGFVKLLPCMK 419
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592933836|gb|GAXK01024717.1| (TSA: Calanus finmarchicus comp4659006_c0_seq1 transcribed RNA sequence) HSP 1 Score: 72.0182 bits (175), Expect = 3.564e-15 Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNL--YESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 AV+ +FT+ W PIH++ + +SL +E +T QI+AH+LAY+NSC+NP+LYA +S FR GF ++ Sbjct: 74 AVITVFTVCWAPIHVVFVRKSLTAEDWEHHYGKLTLQILAHVLAYTNSCLNPLLYAKMSRNFRLGFRQLV 283
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948123|gb|GAXK01010430.1| (TSA: Calanus finmarchicus comp1780950_c0_seq2 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 2.791e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 559 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 723
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948124|gb|GAXK01010429.1| (TSA: Calanus finmarchicus comp1780950_c0_seq1 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 3.259e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 616 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 780
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592858858|gb|GAXK01098704.1| (TSA: Calanus finmarchicus comp3222639_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.6178 bits (148), Expect = 9.553e-12 Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYE--STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPS 103 F + W PIH + + +SL + ++ QI+AH+LAY+NSC+NP+LYA +S FR GF ++ ++ S Sbjct: 10 FVVCWSPIHYVFVRKSLTHADWSHNSSKLSLQILAHLLAYTNSCLNPLLYAKMSRNFRIGFRQLVPLVQKS 222
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592816587|gb|GAXK01137981.1| (TSA: Calanus finmarchicus comp5844387_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.121e-11 Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 42 IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 + ILL ++L Y + N++ QI +H+LAYSNSC+NPI+YAF S FR+ F Sbjct: 251 LQTILLFKALGSYPFSIRNISIQIGSHVLAYSNSCINPIIYAFFSTQFRKSF 406
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592774524|gb|GAXK01180044.1| (TSA: Calanus finmarchicus comp1832915_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.285e-11 Identity = 27/48 (56.25%), Postives = 39/48 (81.25%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 V ++F+LSWLPI +ILL++S +YE T N++ QI +H+LAYSNSC+N Sbjct: 1 VTVMFSLSWLPIQLILLIKSFEIYEVTIFNISVQIGSHVLAYSNSCIN 144
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592897336|gb|GAXK01061039.1| (TSA: Calanus finmarchicus comp3873770_c0_seq1 transcribed RNA sequence) HSP 1 Score: 58.9214 bits (141), Expect = 8.745e-11 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 +V +IF LSWLPI +IL ++S + E T N++ QI +HILAYSNSC+N Sbjct: 1 SVTIIFALSWLPIQLILFIKSFTVLEVTIFNISLQIGSHILAYSNSCIN 147
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804419|gb|GAXK01150149.1| (TSA: Calanus finmarchicus comp1591687_c0_seq2 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 2.975e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804420|gb|GAXK01150148.1| (TSA: Calanus finmarchicus comp1591687_c0_seq1 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 3.198e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000000789 (pep:novel supercontig:LSalAtl2s:LSalAtl2s112:585535:586017:-1 gene:EMLSAG00000000789 transcript:EMLSAT00000000789 description:"maker-LSalAtl2s112-augustus-gene-5.9") HSP 1 Score: 290.041 bits (741), Expect = 1.366e-101 Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 0 Query: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN Sbjct: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000006364 (pep:novel supercontig:LSalAtl2s:LSalAtl2s348:280240:283416:1 gene:EMLSAG00000006364 transcript:EMLSAT00000006364 description:"maker-LSalAtl2s348-augustus-gene-2.10") HSP 1 Score: 72.4034 bits (176), Expect = 3.796e-16 Identity = 31/71 (43.66%), Postives = 53/71 (74.65%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYEST-PMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 V+++F + W PI ++L+L++L+L+ + P + + QI+AH+LAY N C+NPILYAFLS+ FR+ F+ ++ Sbjct: 124 VIVVFAVCWAPIQLVLILKALDLFVTNGPEDYHRIIIQILAHVLAYLNGCINPILYAFLSDNFRKAFYELL 194
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000010948 (pep:novel supercontig:LSalAtl2s:LSalAtl2s733:230784:233291:-1 gene:EMLSAG00000010948 transcript:EMLSAT00000010948 description:"augustus_masked-LSalAtl2s733-processed-gene-2.0") HSP 1 Score: 72.7886 bits (177), Expect = 6.561e-16 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMT-FQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 VV++F L W P+ +++LL+S LYE ++ FQII H LAY NSC+NP LYAFLS FR F Sbjct: 285 VVIVFVLCWSPLQVVMLLKSFKLYEINQTSLVAFQIICHCLAYCNSCLNPFLYAFLSSNFRETF 348
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000003816 (pep:novel supercontig:LSalAtl2s:LSalAtl2s206:593132:594481:1 gene:EMLSAG00000003816 transcript:EMLSAT00000003816 description:"augustus_masked-LSalAtl2s206-processed-gene-6.8") HSP 1 Score: 55.8398 bits (133), Expect = 4.718e-10 Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 0 Query: 30 AVVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSK 136 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC++ G N D R + K G++K+K Sbjct: 265 TVITVYILCWLPYWITQLALIFTPPGHNQDNVVVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTCVK-----GREVNAALHVDNSMFPRRRNHRKTGDKKNK 368
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6") HSP 1 Score: 47.7506 bits (112), Expect = 2.420e-7 Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 0 Query: 21 NALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNM--TFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 A +TL A++L F ++W P ++ +L ++ E+ + + T A+ L Y NS VNP+LYA + FRR + ++TC Sbjct: 554 KAAKTLS--AILLAFIVTWTPYSVLTVLNAVLGKETADVYIPPTLWDFAYYLCYINSTVNPVLYALCNAAFRRTYVRILTC 632
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000012259 (pep:novel supercontig:LSalAtl2s:LSalAtl2s895:238961:260136:1 gene:EMLSAG00000012259 transcript:EMLSAT00000012259 description:"maker-LSalAtl2s895-augustus-gene-1.29") HSP 1 Score: 46.2098 bits (108), Expect = 4.968e-7 Identity = 25/78 (32.05%), Postives = 42/78 (53.85%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM------NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 A+V++F L W P ++ + RS + + N TF + +AY NS +NPI+Y F+S+ FR F + C++ Sbjct: 184 AIVVVFVLCWSPFLVMNIFRSFGVVNISLHGFVKYDNTTFTL----MAYLNSALNPIIYGFMSQNFRDNFRRTVGCLK 257
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|128394|sp|P24053.1|NMBR_RAT (RecName: Full=Neuromedin-B receptor; Short=NMB-R; AltName: Full=Neuromedin-B-preferring bombesin receptor) HSP 1 Score: 57.7658 bits (138), Expect = 1.512e-9 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPM--NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPH 106 F W P HI+ L RS N E P +M ++A +L++SNSCVNP LSE FR+ F + + C + S P Sbjct: 275 FVFCWFPNHILYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGQKSYPE 348
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|122141271|sp|Q49LX6.1|SSR2_CANFA (RecName: Full=Somatostatin receptor type 2; Short=SS-2-R; Short=SS2-R; Short=SS2R) HSP 1 Score: 57.3806 bits (137), Expect = 2.018e-9 Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRN 111 VV +F WLP +I + TP + +L Y+NSC NPILYAFLS+ F++ F V+ ++ SGP R+ Sbjct: 261 VVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDLVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGPDDGERS 341
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|60390210|sp|Q91V45.1|KISSR_MOUSE (RecName: Full=KiSS-1 receptor; Short=KiSS-1R; AltName: Full=G-protein coupled receptor 54; AltName: Full=G-protein coupled receptor OT7T175; Short=mOT7T175; AltName: Full=Kisspeptins receptor; AltName: Full=Metastin receptor) HSP 1 Score: 57.3806 bits (137), Expect = 2.132e-9 Identity = 31/76 (40.79%), Postives = 44/76 (57.89%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLN----LYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 AVVL+F W PI + L+L++L + + +I AH ++YSNS +NP+LYAFL FR+ F V C R Sbjct: 267 AVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYAAYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCR 342
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|71152909|sp|Q9MYW9.2|OPRM_MACMU (RecName: Full=Mu-type opioid receptor; Short=M-OR-1; Short=MOR-1) HSP 1 Score: 56.9954 bits (136), Expect = 2.830e-9 Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIA-HI---LAYSNSCVNPILYAFLSEPFRRGF 93 VV +F + W PIHI +++++L T TFQ ++ H L Y+NSC+NP+LYAFL E F+R F Sbjct: 286 VVVAVFIICWTPIHIYVIIKALVTIPET----TFQTVSWHFCIALGYTNSCLNPVLYAFLDEDFKRCF 349
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|1705504|sp|P47751.2|BRS4_BOMOR (RecName: Full=[Phe13]-bombesin receptor; AltName: Full=Bombesin receptor subtype-4; Short=BRS-4) HSP 1 Score: 56.6102 bits (135), Expect = 3.722e-9 Identity = 32/105 (30.48%), Postives = 55/105 (52.38%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYE---STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGE 132 +V +F + WLP H++ L RS + S+ +++ I A +LA+SNSCVNP +LS FR+ F + C + + P ++ + I + +GN + E Sbjct: 275 LVALFAVCWLPNHMLYLYRSFTYHSAVNSSAFHLSATIFARVLAFSNSCVNPFALYWLSRSFRQHFKKQVYCCK-TEPPASQQSPTHSSTITGITAVKGNIQMSE 378
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|212286370|sp|P28336.2|NMBR_HUMAN (RecName: Full=Neuromedin-B receptor; Short=NMB-R; AltName: Full=Epididymis tissue protein Li 185a; AltName: Full=Neuromedin-B-preferring bombesin receptor) HSP 1 Score: 56.225 bits (134), Expect = 5.261e-9 Identity = 29/71 (40.85%), Postives = 39/71 (54.93%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPM--NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPS 103 F W P HI+ + RS N E P +M ++A +L++ NSCVNP LSE FRR F + + C R S Sbjct: 275 FIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKS 345
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|6225097|sp|O97967.1|BRS3_SHEEP (RecName: Full=Bombesin receptor subtype-3; Short=BRS-3) HSP 1 Score: 55.8398 bits (133), Expect = 6.489e-9 Identity = 31/84 (36.90%), Postives = 47/84 (55.95%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLN---LYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRN 111 +V +F L WLP H++ L RS +S+ +++ II+ ILA+SNSCVNP +LS F++ F A + C + P N Sbjct: 276 LVALFALCWLPNHLLYLYRSFTSQTYMDSSTVHLFVTIISRILAFSNSCVNPFALYWLSNTFQQHFKAQLFCCKAGRPDPTAAN 359
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|125987836|sp|Q969F8.2|KISSR_HUMAN (RecName: Full=KiSS-1 receptor; Short=KiSS-1R; AltName: Full=G-protein coupled receptor 54; AltName: Full=G-protein coupled receptor OT7T175; Short=hOT7T175; AltName: Full=Hypogonadotropin-1; AltName: Full=Kisspeptins receptor; AltName: Full=Metastin receptor) HSP 1 Score: 55.8398 bits (133), Expect = 6.611e-9 Identity = 42/130 (32.31%), Postives = 59/130 (45.38%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYES----TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR-------------PSGPHG-VHRNGYEMADIKHVKDG------RGNSKCGEEKS 135 AVVL+F W PI + L+L++L S + + AH ++YSNS +NP+LYAFL FR+ F V C P+ PH + R G A + K G RG GE+ + Sbjct: 267 AVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNA 396
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|60389876|sp|Q924U1.2|KISSR_RAT (RecName: Full=KiSS-1 receptor; Short=KiSS-1R; AltName: Full=G-protein coupled receptor 54; AltName: Full=G-protein coupled receptor OT7T175; Short=rOT7T175; AltName: Full=Kisspeptins receptor; AltName: Full=Metastin receptor) HSP 1 Score: 55.8398 bits (133), Expect = 6.665e-9 Identity = 30/74 (40.54%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNL----YESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 AVVL+F W PI + L+L++L + + +I AH ++YSNS +NP+LYAFL FR+ F V C Sbjct: 267 AVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYAAYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPC 340
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|62510830|sp|Q95M54.1|OPRM_MACFA (RecName: Full=Mu-type opioid receptor; Short=M-OR-1; Short=MOR-1) HSP 1 Score: 55.8398 bits (133), Expect = 6.684e-9 Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 VV +F + W PIHI +++++L T + L Y+NSC+NP+LYAFL E F+R F Sbjct: 286 VVVAVFIICWTPIHIYVIIKALVTIPETTLQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCF 349
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_016771724.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_006560263.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_006560262.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EGK97485.1 (AGAP001773-PC [Anopheles gambiae str. PEST]) HSP 1 Score: 76.6406 bits (187), Expect = 1.612e-16 Identity = 37/85 (43.53%), Postives = 58/85 (68.24%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYE 114 VV F W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C GP G R G + Sbjct: 261 VVAAFASLWFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYC----GP-GSRRQGSQ 340
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EEB15019.1 (class A rhodopsin-like G-protein coupled receptor GPRals, putative [Pediculus humanus corporis]) HSP 1 Score: 76.2554 bits (186), Expect = 2.071e-16 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0 Query: 34 IFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAV 96 IF W PI +ILL++SL Y++T + QI++H+L Y NSCVNPILYAFLS+ FR+ F V Sbjct: 282 IFAFCWCPIQVILLVKSLKYYQTTYATVLIQILSHLLGYMNSCVNPILYAFLSDNFRKAFRKV 344
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EGK97484.1 (AGAP001773-PB [Anopheles gambiae str. PEST]) HSP 1 Score: 75.8702 bits (185), Expect = 2.551e-16 Identity = 35/82 (42.68%), Postives = 56/82 (68.29%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRN 111 VV F W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C S G R+ Sbjct: 261 VVAAFASLWFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYCGPRSRRQGSQRH 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EAL38533.3 (AGAP001773-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 74.7146 bits (182), Expect = 6.053e-16 Identity = 34/77 (44.16%), Postives = 55/77 (71.43%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYE 114 W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C GP G R G + Sbjct: 259 WFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYC----GP-GSRRQGSQ 330
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|EEC01085.1| (allatostatin receptor, putative [Ixodes scapularis]) HSP 1 Score: 75.0998 bits (183), Expect = 7.706e-16 Identity = 45/111 (40.54%), Postives = 61/111 (54.95%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSG---PHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F + W P+ I+L+L+S+ LY PMN + QI + ILAY+NSCVNP LYAFLSE FR+ F +I C + + G R K ++ GN C + SK N Sbjct: 318 FAVCWCPVQIVLVLKSVELY-GLPMNPPRIVIQIASQILAYTNSCVNPFLYAFLSENFRKSFRKIIFCYQRNASSSSSGPSRTRIGEEGEKTERETMGN--CTTKTSKISN 425
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EFX71121.1 (putative allatostatin A receptor, partial [Daphnia pulex]) HSP 1 Score: 73.1738 bits (178), Expect = 1.509e-15 Identity = 32/65 (49.23%), Postives = 44/65 (67.69%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F + W PI + L+L+SL L+E T + + QI +HILAY NSCVNP LYAF+S+ F + F + C Sbjct: 230 FAVCWFPIQLFLVLKSLALFEMTALTVMIQITSHILAYMNSCVNPFLYAFISDNFLKAFRKFVYC 294
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: AGB96422.1 (allatostatin A receptor 2, isoform C [Drosophila melanogaster]) HSP 1 Score: 73.559 bits (179), Expect = 1.947e-15 Identity = 32/62 (51.61%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYES-TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 WLP+ +ILLL+SL++ E+ T + Q+ A LAYS+SC+NP+LYAFLSE FR+ F+ + C Sbjct: 269 WLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNC 330
BLAST of EMLSAG00000000789 vs. nr
Match: gi|734704274|gb|AJA32745.1| (FGLa/AST receptor [Rhodnius prolixus]) HSP 1 Score: 96.2857 bits (238), Expect = 7.795e-21 Identity = 45/86 (52.33%), Postives = 59/86 (68.60%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEM 115 VV IF + W PI +IL+++S+ YE TP ++ QI++H+LAY NSCVNPILYAFLSE FR+ F VI C G H H NG ++ Sbjct: 302 VVVAIFAICWCPIQVILVMKSIGQYEITPTSVMVQIVSHVLAYMNSCVNPILYAFLSENFRKAFRKVIYCGPEGGSHPPHLNGRQI 387
BLAST of EMLSAG00000000789 vs. nr
Match: gi|646642281|gb|KDQ71582.1| (Galanin receptor type 2 [Zootermopsis nevadensis]) HSP 1 Score: 88.9669 bits (219), Expect = 7.410e-20 Identity = 44/95 (46.32%), Postives = 61/95 (64.21%), Query Frame = 0 Query: 34 IFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMAD---IKHVKDGR 125 IF + W PI IIL+L+S+++YE T ++ QI++ ++AY NSCVNPILYAFLS+ FR+ F V+ C GP G Y+ A I H +GR Sbjct: 36 IFAICWFPIQIILVLKSIDMYEITNASVMIQIVSQVMAYMNSCVNPILYAFLSDHFRKAFRKVVNC----GPWGSGGTRYQRASTTIIPHQANGR 126
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1037028684|ref|XP_017033969.1| (PREDICTED: allatostatin-A receptor, partial [Drosophila kikkawai]) HSP 1 Score: 87.8113 bits (216), Expect = 2.119e-19 Identity = 37/70 (52.86%), Postives = 56/70 (80.00%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++L+LY ++ +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 55 LAFAICWLPIHVILVLKALDLYGASHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCCSP 124
BLAST of EMLSAG00000000789 vs. nr
Match: gi|924564512|gb|ALC49137.1| (maker320 [Drosophila busckii]) HSP 1 Score: 86.6557 bits (213), Expect = 2.654e-19 Identity = 42/96 (43.75%), Postives = 62/96 (64.58%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F + WLPIH+IL++++L++Y + +++ QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P V +M G G S Sbjct: 36 LAFAICWLPIHVILVMKALDMYGGSHLSVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP--PPIV--TNQQMTKTTRTATGNGTS 127
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1036728462|ref|XP_017086382.1| (PREDICTED: allatostatin-A receptor isoform X2 [Drosophila eugracilis] >gi|1036728481|ref|XP_017086383.1| PREDICTED: allatostatin-A receptor isoform X2 [Drosophila eugracilis]) HSP 1 Score: 88.1965 bits (217), Expect = 4.441e-19 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 103 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 172
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1134490889|gb|JAV34980.1| (putative allatostatin-a receptor [Culex tarsalis]) HSP 1 Score: 89.7373 bits (221), Expect = 7.615e-19 Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F W PI +IL+L+SL +YE T +++ QI+AH+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P + G + K + G G S Sbjct: 224 LAFAFCWCPIQVILVLKSLEMYEVTHVSIITQIVAHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGAP--PSLLIPQGPRTGETKTTRTGNGTS 317
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1060276924|ref|XP_017850147.1| (PREDICTED: allatostatin-A receptor-like [Drosophila busckii]) HSP 1 Score: 86.2705 bits (212), Expect = 8.528e-19 Identity = 42/96 (43.75%), Postives = 62/96 (64.58%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F + WLPIH+IL++++L++Y + +++ QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P V +M G G S Sbjct: 66 LAFAICWLPIHVILVMKALDMYGGSHLSVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP--PPIVTNQ--QMTKTTRTATGNGTS 157
BLAST of EMLSAG00000000789 vs. nr
Match: gi|907637410|ref|XP_013099793.1| (PREDICTED: allatostatin-A receptor [Stomoxys calcitrans]) HSP 1 Score: 90.5077 bits (223), Expect = 1.083e-18 Identity = 39/70 (55.71%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY ++ + + QIIAH+LAY+NSC+NPILYAFLS+ FR+ F ++ C P Sbjct: 315 LAFAICWLPIHVILVLKALNLYGTSNVTVIIQIIAHVLAYTNSCINPILYAFLSDNFRKAFRKIVWCCSP 384
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1134490881|gb|JAV34976.1| (putative allatostatin-a receptor [Culex tarsalis]) HSP 1 Score: 89.7373 bits (221), Expect = 1.125e-18 Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F W PI +IL+L+SL +YE T +++ QI+AH+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P + G + K + G G S Sbjct: 256 LAFAFCWCPIQVILVLKSLEMYEVTHVSIITQIVAHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGAP--PSLLIPQGPRTGETKTTRTGNGTS 349
BLAST of EMLSAG00000000789 vs. nr
Match: gi|668448947|gb|KFB38427.1| (AGAP003658-PB-like protein [Anopheles sinensis]) HSP 1 Score: 83.5741 bits (205), Expect = 1.209e-18 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAV 96 F W PI +ILLL+SL LYE T ++ FQI++H+LAY+NSC+NP+LYAFLS+ FR+ F V Sbjct: 9 FAFCWCPIQVILLLKSLKLYELTHASIIFQIVSHVLAYTNSCINPVLYAFLSDNFRKAFRKV 70
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold338_size202645-snap-gene-1.15 (protein:Tk00724 transcript:maker-scaffold338_size202645-snap-gene-1.15-mRNA-1 annotation:"allatostatin a receptor") HSP 1 Score: 155.992 bits (393), Expect = 6.313e-47 Identity = 73/110 (66.36%), Postives = 89/110 (80.91%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADI-KHVKDGRGNSKCGEEKSKGDN 139 VV+IF LSWLPIHIIL++R + LY +TP+ +T QII+HILAYSNSCVNPILYA+LSEPFRRGFWAVITCI+PSGPHGV +NGYEM D+ H + KC ++ G+N Sbjct: 271 VVIIFALSWLPIHIILIMRGMKLYPNTPLTVTTQIISHILAYSNSCVNPILYAWLSEPFRRGFWAVITCIKPSGPHGVLQNGYEMGDVMPHGRQAGHAKKCAQK--NGNN 378
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-5.8 (protein:Tk03859 transcript:maker-scaffold20_size707684-snap-gene-5.8-mRNA-1 annotation:"af336364_1allatostatin receptor") HSP 1 Score: 66.6254 bits (161), Expect = 4.758e-14 Identity = 42/107 (39.25%), Postives = 56/107 (52.34%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLY-----ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI-TCIRP--SGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKG 137 W PI +LL+++L +Y E P + FQI AH LAY NSCVNPILYAFLS+ FR+ F + C G G YE+ ++ D R +S +G Sbjct: 313 WAPIQFVLLMKALKVYNTKGPEDFP-RIIFQIFAHCLAYVNSCVNPILYAFLSDNFRKAFHQFLPDCCHKVMGGARGRPALQYELTTLR--ADRRNSSNLKRYGKRG 416
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-2.11 (protein:Tk03842 transcript:maker-scaffold20_size707684-snap-gene-2.11-mRNA-1 annotation:"neuropeptide gpcr a23") HSP 1 Score: 50.447 bits (119), Expect = 1.981e-8 Identity = 31/76 (40.79%), Postives = 41/76 (53.95%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 VV IF W+P I +L + +N Y +N+ F + H LA SNSC NP +Y SE FRR F + C+RP Sbjct: 411 VVSIFAFCWMPWQIYATTMLFIPQVNSYRY--INIIF-FVCHWLAMSNSCYNPFIYGVYSEKFRREFSIRLPCLRP 483
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold152_size304267-processed-gene-0.11 (protein:Tk10103 transcript:snap_masked-scaffold152_size304267-processed-gene-0.11-mRNA-1 annotation:"somatostatin receptor type 2") HSP 1 Score: 49.6766 bits (117), Expect = 3.662e-8 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 31 VVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC Sbjct: 303 VITVYILCWLPYWITQLALIFTEPGHTQDNVMVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTC 373
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold763_size101323-snap-gene-0.15 (protein:Tk04717 transcript:maker-scaffold763_size101323-snap-gene-0.15-mRNA-1 annotation:"lymnokinin receptor") HSP 1 Score: 48.1358 bits (113), Expect = 1.582e-7 Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 VV IF + WLP H+ +LL+ +N Y +N+ F +H LA NSC NP +YA SE F+R F C Sbjct: 376 VVVAIFGVCWLPWHLYQISVLLVPEINEYHY--INIIF-FFSHWLAMFNSCCNPFIYAIYSEKFKREFQQFAHC 446
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold272_size230267-processed-gene-1.9 (protein:Tk00260 transcript:snap_masked-scaffold272_size230267-processed-gene-1.9-mRNA-1 annotation:"retinal rod rhodopsin-sensitive cgmp 3 -cyclic phosphodiesterase subunit delta isoform x2") HSP 1 Score: 47.7506 bits (112), Expect = 1.756e-7 Identity = 27/85 (31.76%), Postives = 46/85 (54.12%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM-----NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCI---RPSGPH 106 +V ++F LSWLP++ LL + P+ +TF I+ ++L +N+CVNP+LY + +E FR + + + RPS Sbjct: 319 SVTVVFFLSWLPLNTFRLLSEFGPAQLHPLLGGREELTFGIL-NLLGATNACVNPLLYGYFNENFRNEYKYIYRAMPWQRPSAAQ 402
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold567_size135338-snap-gene-0.22 (protein:Tk01951 transcript:maker-scaffold567_size135338-snap-gene-0.22-mRNA-1 annotation:"GK13031") HSP 1 Score: 46.9802 bits (110), Expect = 3.815e-7 Identity = 29/118 (24.58%), Postives = 59/118 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHII-LLLRSLNLY-ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNG---YEMADIKHVKDGRG----NSKCGEEKSKGDN 139 + L+F + W P++++ +++ S +L+ E+ + + + H++ S++C+NPILY + +E R +I I P R+ E+ D+ HV R + CG+ D+ Sbjct: 298 ISLVFCVCWFPLNLLGVIIDSTDLFRENHQLMLCIFVACHLVGMSSACINPILYGYRNEGVRSEISHMIKRISFRTPTSRKRSQSKLLELQDLNHVAIKRNVSYFDEDCGQNADGRDS 415
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold941_size78300-snap-gene-0.19 (protein:Tk00817 transcript:maker-scaffold941_size78300-snap-gene-0.19-mRNA-1 annotation:"prolactin-releasing peptide receptor") HSP 1 Score: 45.8246 bits (107), Expect = 8.439e-7 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYES---TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 ++V+IF W P+++I L ++L+ + TF + HILA S++C NP LY +L+E FR F +I Sbjct: 264 SMVVIFGTCWFPLNVINFLADIDLFPIFCWEYYHFTF-FLCHILAMSSNCYNPFLYGWLNESFRGEFLKMI 333 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000789 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 6
BLAST of EMLSAG00000000789 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 8
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s112:585535..586017- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000789-683555 ID=EMLSAG00000000789-683555|Name=EMLSAG00000000789|organism=Lepeophtheirus salmonis|type=gene|length=483bp|location=Sequence derived from alignment at LSalAtl2s112:585535..586017- (Lepeophtheirus salmonis)back to top Add to Basket
|