EMLSAG00000000789, EMLSAG00000000789-683555 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR1 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 CTD:2587 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:FP339578 RefSeq:XP_003480474.1 Ensembl:ENSSSCT00000026935 GeneID:100736969 KEGG:ssc:100736969 Uniprot:I3L6C9) HSP 1 Score: 68.5514 bits (166), Expect = 5.516e-13 Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 0 Query: 38 SWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 SWLP H+I L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 259 SWLPHHVIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR "Galanin receptor" species:9031 "Gallus gallus" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 CTD:2587 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 KO:K04230 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:AADN03002059 EMBL:EU647890 RefSeq:NP_001121534.1 UniGene:Gga.47681 ProteinModelPortal:B2ZE94 STRING:9031.ENSGALP00000036155 Ensembl:ENSGALT00000043531 GeneID:428512 KEGG:gga:428512 NextBio:20829477 PRO:PR:B2ZE94 Uniprot:B2ZE94) HSP 1 Score: 67.781 bits (164), Expect = 1.145e-12 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F +SWLP H+I L ++ T + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 264 FGISWLPHHVIHLWAEFGVFPLTQASFLFRIAAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 328
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GPR151 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 OrthoDB:EOG7327PK TreeFam:TF315737 GeneTree:ENSGT00620000087530 EMBL:AADN03006859 Ensembl:ENSGALT00000002898 Uniprot:F1NFK7) HSP 1 Score: 68.1662 bits (165), Expect = 1.177e-12 Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMT---FQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDG 124 V ++F L WLP H+++L LY P N F++++H +AY+NSC+NPI+YA +S+ FR+GF V +C+ HRN + H G Sbjct: 275 VTILFCLCWLPYHVVILRY---LYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKRVFSCLLRKK----HRNKVHVLHAAHTVPG 364
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:LOC415713 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 OrthoDB:EOG7327PK TreeFam:TF315737 GeneTree:ENSGT00620000087530 EMBL:AADN03006164 Ensembl:ENSGALT00000005414 Uniprot:F1NQJ8) HSP 1 Score: 64.3142 bits (155), Expect = 1.662e-11 Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 0 Query: 38 SWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC---IRPSGPHGVHRNGYEMADIKH 120 SWLP HII + + ++ TF+II+H LAY NSC+NPILYAFLSE FR+ C ++P + R E + H Sbjct: 273 SWLPHHIITMWAEFGHFPLNNISFTFRIISHCLAYGNSCINPILYAFLSENFRKACQQAFHCKCFLQPVPTEKLVRIHMENFSVTH 358
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031175 "neuron projection development" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 GO:GO:0031175 OrthoDB:EOG7327PK TreeFam:TF315737 GeneTree:ENSGT00620000087530 EMBL:AADN03007490 Ensembl:ENSGALT00000002899 PRO:PR:F1NFK6 Uniprot:F1NFK6) HSP 1 Score: 63.1586 bits (152), Expect = 4.992e-11 Identity = 32/116 (27.59%), Postives = 60/116 (51.72%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR----------PSGPHGVHRNGYEMADIKHVKD---GRGNSKCGEE 133 V ++F L WLP H+++L + +I++H+++Y+NSCVNPI+YA +S+ FR+GF + C+ G + V E++++ + D G + +C + Sbjct: 232 VAVLFCLCWLPHHLVILCFWFGYFPLNHTTYVLRIVSHLISYANSCVNPIVYALVSKHFRKGFKKIFICLLHKKAANKVHVAQGTNTVSMLEAELSEVTRLSDAGPGCSSVRCKAQ 347
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Sstr4 "somatostatin receptor 4" species:10090 "Mus musculus" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004994 "somatostatin receptor activity" evidence=ISO] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=ISO] [GO:0007268 "synaptic transmission" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016477 "cell migration" evidence=ISO] [GO:0019369 "arachidonic acid metabolic process" evidence=ISO] [GO:0030815 "negative regulation of cAMP metabolic process" evidence=ISO] [GO:0038170 "somatostatin signaling pathway" evidence=ISO] [GO:0043410 "positive regulation of MAPK cascade" evidence=ISO] InterPro:IPR000276 InterPro:IPR000586 InterPro:IPR001512 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00246 PRINTS:PR00590 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:105372 GO:GO:0016021 GO:GO:0005886 GO:GO:0007268 GO:GO:0007218 EMBL:AL935149 TreeFam:TF315737 OrthoDB:EOG7BKCVQ HOVERGEN:HBG106919 GeneTree:ENSGT00630000089736 GO:GO:0004994 GO:GO:0038170 ChEMBL:CHEMBL2111427 GuidetoPHARMACOLOGY:358 CTD:6754 eggNOG:NOG235424 KO:K04220 EMBL:U26176 EMBL:AY902332 EMBL:AK051189 EMBL:BC138487 EMBL:BC138488 PIR:JC4629 RefSeq:NP_033245.2 UniGene:Mm.35324 ProteinModelPortal:P49660 IntAct:P49660 MINT:MINT-6504774 STRING:10090.ENSMUSP00000105588 BindingDB:P49660 PhosphoSite:P49660 PRIDE:P49660 Ensembl:ENSMUST00000047292 Ensembl:ENSMUST00000109962 GeneID:20608 KEGG:mmu:20608 UCSC:uc008mtc.1 InParanoid:P49660 NextBio:298959 PRO:PR:P49660 CleanEx:MM_SSTR4 Genevestigator:P49660 Uniprot:P49660) HSP 1 Score: 61.6178 bits (148), Expect = 1.708e-10 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 261 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 326
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Sstr4 "Somatostatin receptor type 4" species:10116 "Rattus norvegicus" [GO:0005515 "protein binding" evidence=IPI] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0038170 "somatostatin signaling pathway" evidence=IDA] InterPro:IPR000276 InterPro:IPR000586 InterPro:IPR001512 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00246 PRINTS:PR00590 PROSITE:PS00237 PROSITE:PS50262 RGD:3764 GO:GO:0016021 GO:GO:0005886 GO:GO:0005737 GO:GO:0030815 GO:GO:0071385 GO:GO:0030900 GO:GO:0016477 GO:GO:0043410 GO:GO:0019369 OrthoDB:EOG7BKCVQ HOVERGEN:HBG106919 GeneTree:ENSGT00630000089736 GO:GO:0004994 ChEMBL:CHEMBL2096977 GuidetoPHARMACOLOGY:358 CTD:6754 KO:K04220 OMA:FYVVQLL EMBL:M96544 EMBL:U04738 PIR:A47249 RefSeq:NP_037168.1 UniGene:Rn.9936 ProteinModelPortal:P30937 IntAct:P30937 MINT:MINT-6504981 BindingDB:P30937 PhosphoSite:P30937 Ensembl:ENSRNOT00000006181 GeneID:25555 KEGG:rno:25555 UCSC:RGD:3764 NextBio:607121 PRO:PR:P30937 Genevestigator:P30937 Uniprot:P30937) HSP 1 Score: 61.6178 bits (148), Expect = 1.801e-10 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 260 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 325
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Sstr4 "somatostatin receptor 4" species:10116 "Rattus norvegicus" [GO:0004994 "somatostatin receptor activity" evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016477 "cell migration" evidence=IMP;IDA] [GO:0019369 "arachidonic acid metabolic process" evidence=IDA] [GO:0030815 "negative regulation of cAMP metabolic process" evidence=IDA] [GO:0030900 "forebrain development" evidence=IEP] [GO:0038170 "somatostatin signaling pathway" evidence=IDA] [GO:0043410 "positive regulation of MAPK cascade" evidence=IDA] [GO:0071385 "cellular response to glucocorticoid stimulus" evidence=IEP] InterPro:IPR000276 InterPro:IPR000586 InterPro:IPR001512 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00246 PRINTS:PR00590 PROSITE:PS00237 PROSITE:PS50262 RGD:3764 GO:GO:0016021 GO:GO:0005886 GO:GO:0005737 GO:GO:0030815 GO:GO:0071385 GO:GO:0030900 GO:GO:0016477 GO:GO:0043410 GO:GO:0019369 OrthoDB:EOG7BKCVQ HOVERGEN:HBG106919 GeneTree:ENSGT00630000089736 GO:GO:0004994 ChEMBL:CHEMBL2096977 GuidetoPHARMACOLOGY:358 CTD:6754 KO:K04220 OMA:FYVVQLL EMBL:M96544 EMBL:U04738 PIR:A47249 RefSeq:NP_037168.1 UniGene:Rn.9936 ProteinModelPortal:P30937 IntAct:P30937 MINT:MINT-6504981 BindingDB:P30937 PhosphoSite:P30937 Ensembl:ENSRNOT00000006181 GeneID:25555 KEGG:rno:25555 UCSC:RGD:3764 NextBio:607121 PRO:PR:P30937 Genevestigator:P30937 Uniprot:P30937) HSP 1 Score: 61.6178 bits (148), Expect = 1.801e-10 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 260 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 325
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:si:ch211-250n8.2 "si:ch211-250n8.2" species:7955 "Danio rerio" [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0004871 "signal transducer activity" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PROSITE:PS00237 PROSITE:PS50262 ZFIN:ZDB-GENE-130603-37 GO:GO:0016021 GO:GO:0004930 OrthoDB:EOG7327PK TreeFam:TF315737 GeneTree:ENSGT00620000087530 KO:K04231 EMBL:AL807798 RefSeq:XP_002664053.2 Ensembl:ENSDART00000023857 GeneID:100334793 KEGG:dre:100334793 OMA:VAYANSC PRO:PR:F1R332 Uniprot:F1R332) HSP 1 Score: 61.2326 bits (147), Expect = 2.230e-10 Identity = 27/69 (39.13%), Postives = 44/69 (63.77%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 V ++F L WLP H+++L + +I++H++AY+NSC+NPI+YA +S+ FR+GF V C Sbjct: 235 VAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:galr1 "galanin receptor 1" species:7955 "Danio rerio" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0004871 "signal transducer activity" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003906 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01418 PROSITE:PS00237 PROSITE:PS50262 ZFIN:ZDB-GENE-060503-290 GO:GO:0016021 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 CTD:2587 KO:K04230 OMA:PVAYHQG OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 EMBL:BX572622 RefSeq:XP_696215.1 ProteinModelPortal:F1QSA8 Ensembl:ENSDART00000138544 GeneID:567820 KEGG:dre:567820 PRO:PR:F1QSA8 Uniprot:F1QSA8) HSP 1 Score: 60.8474 bits (146), Expect = 2.684e-10 Identity = 29/65 (44.62%), Postives = 39/65 (60.00%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F LSWLP H++ L + + ++ AH LAYSNS VNP++YAFLSE FR+ + V C Sbjct: 254 FCLSWLPHHVVHLWVEFGSFPLNQASFVLRVAAHCLAYSNSSVNPVIYAFLSENFRQAYKQVFRC 318
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592847339|gb|GAXK01110205.1| (TSA: Calanus finmarchicus comp1959081_c0_seq1 transcribed RNA sequence) HSP 1 Score: 79.337 bits (194), Expect = 3.154e-18 Identity = 35/59 (59.32%), Postives = 47/59 (79.66%), Query Frame = 0 Query: 43 HIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 +ILLL+S LYE T +N++ QI +H+LAYSNSC+NPILYAFLS PFR GF ++ C++ Sbjct: 243 QLILLLKSFELYEVTILNISVQIGSHVLAYSNSCINPILYAFLSPPFRAGFVKLLPCMK 419
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592933836|gb|GAXK01024717.1| (TSA: Calanus finmarchicus comp4659006_c0_seq1 transcribed RNA sequence) HSP 1 Score: 72.0182 bits (175), Expect = 3.564e-15 Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNL--YESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 AV+ +FT+ W PIH++ + +SL +E +T QI+AH+LAY+NSC+NP+LYA +S FR GF ++ Sbjct: 74 AVITVFTVCWAPIHVVFVRKSLTAEDWEHHYGKLTLQILAHVLAYTNSCLNPLLYAKMSRNFRLGFRQLV 283
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948123|gb|GAXK01010430.1| (TSA: Calanus finmarchicus comp1780950_c0_seq2 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 2.791e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 559 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 723
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948124|gb|GAXK01010429.1| (TSA: Calanus finmarchicus comp1780950_c0_seq1 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 3.259e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 616 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 780
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592858858|gb|GAXK01098704.1| (TSA: Calanus finmarchicus comp3222639_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.6178 bits (148), Expect = 9.553e-12 Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYE--STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPS 103 F + W PIH + + +SL + ++ QI+AH+LAY+NSC+NP+LYA +S FR GF ++ ++ S Sbjct: 10 FVVCWSPIHYVFVRKSLTHADWSHNSSKLSLQILAHLLAYTNSCLNPLLYAKMSRNFRIGFRQLVPLVQKS 222
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592816587|gb|GAXK01137981.1| (TSA: Calanus finmarchicus comp5844387_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.121e-11 Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 42 IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 + ILL ++L Y + N++ QI +H+LAYSNSC+NPI+YAF S FR+ F Sbjct: 251 LQTILLFKALGSYPFSIRNISIQIGSHVLAYSNSCINPIIYAFFSTQFRKSF 406
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592774524|gb|GAXK01180044.1| (TSA: Calanus finmarchicus comp1832915_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.285e-11 Identity = 27/48 (56.25%), Postives = 39/48 (81.25%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 V ++F+LSWLPI +ILL++S +YE T N++ QI +H+LAYSNSC+N Sbjct: 1 VTVMFSLSWLPIQLILLIKSFEIYEVTIFNISVQIGSHVLAYSNSCIN 144
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592897336|gb|GAXK01061039.1| (TSA: Calanus finmarchicus comp3873770_c0_seq1 transcribed RNA sequence) HSP 1 Score: 58.9214 bits (141), Expect = 8.745e-11 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 +V +IF LSWLPI +IL ++S + E T N++ QI +HILAYSNSC+N Sbjct: 1 SVTIIFALSWLPIQLILFIKSFTVLEVTIFNISLQIGSHILAYSNSCIN 147
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804419|gb|GAXK01150149.1| (TSA: Calanus finmarchicus comp1591687_c0_seq2 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 2.975e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804420|gb|GAXK01150148.1| (TSA: Calanus finmarchicus comp1591687_c0_seq1 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 3.198e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000000789 (pep:novel supercontig:LSalAtl2s:LSalAtl2s112:585535:586017:-1 gene:EMLSAG00000000789 transcript:EMLSAT00000000789 description:"maker-LSalAtl2s112-augustus-gene-5.9") HSP 1 Score: 290.041 bits (741), Expect = 1.366e-101 Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 0 Query: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN Sbjct: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000006364 (pep:novel supercontig:LSalAtl2s:LSalAtl2s348:280240:283416:1 gene:EMLSAG00000006364 transcript:EMLSAT00000006364 description:"maker-LSalAtl2s348-augustus-gene-2.10") HSP 1 Score: 72.4034 bits (176), Expect = 3.796e-16 Identity = 31/71 (43.66%), Postives = 53/71 (74.65%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYEST-PMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 V+++F + W PI ++L+L++L+L+ + P + + QI+AH+LAY N C+NPILYAFLS+ FR+ F+ ++ Sbjct: 124 VIVVFAVCWAPIQLVLILKALDLFVTNGPEDYHRIIIQILAHVLAYLNGCINPILYAFLSDNFRKAFYELL 194
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000010948 (pep:novel supercontig:LSalAtl2s:LSalAtl2s733:230784:233291:-1 gene:EMLSAG00000010948 transcript:EMLSAT00000010948 description:"augustus_masked-LSalAtl2s733-processed-gene-2.0") HSP 1 Score: 72.7886 bits (177), Expect = 6.561e-16 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMT-FQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 VV++F L W P+ +++LL+S LYE ++ FQII H LAY NSC+NP LYAFLS FR F Sbjct: 285 VVIVFVLCWSPLQVVMLLKSFKLYEINQTSLVAFQIICHCLAYCNSCLNPFLYAFLSSNFRETF 348
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000003816 (pep:novel supercontig:LSalAtl2s:LSalAtl2s206:593132:594481:1 gene:EMLSAG00000003816 transcript:EMLSAT00000003816 description:"augustus_masked-LSalAtl2s206-processed-gene-6.8") HSP 1 Score: 55.8398 bits (133), Expect = 4.718e-10 Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 0 Query: 30 AVVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSK 136 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC++ G N D R + K G++K+K Sbjct: 265 TVITVYILCWLPYWITQLALIFTPPGHNQDNVVVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTCVK-----GREVNAALHVDNSMFPRRRNHRKTGDKKNK 368
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6") HSP 1 Score: 47.7506 bits (112), Expect = 2.420e-7 Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 0 Query: 21 NALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNM--TFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 A +TL A++L F ++W P ++ +L ++ E+ + + T A+ L Y NS VNP+LYA + FRR + ++TC Sbjct: 554 KAAKTLS--AILLAFIVTWTPYSVLTVLNAVLGKETADVYIPPTLWDFAYYLCYINSTVNPVLYALCNAAFRRTYVRILTC 632
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000012259 (pep:novel supercontig:LSalAtl2s:LSalAtl2s895:238961:260136:1 gene:EMLSAG00000012259 transcript:EMLSAT00000012259 description:"maker-LSalAtl2s895-augustus-gene-1.29") HSP 1 Score: 46.2098 bits (108), Expect = 4.968e-7 Identity = 25/78 (32.05%), Postives = 42/78 (53.85%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM------NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 A+V++F L W P ++ + RS + + N TF + +AY NS +NPI+Y F+S+ FR F + C++ Sbjct: 184 AIVVVFVLCWSPFLVMNIFRSFGVVNISLHGFVKYDNTTFTL----MAYLNSALNPIIYGFMSQNFRDNFRRTVGCLK 257
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|75018194|sp|Q8WPA2.1|AR_BOMMO (RecName: Full=Allatostatin-A receptor; Short=BAR) HSP 1 Score: 82.8037 bits (203), Expect = 1.564e-18 Identity = 45/94 (47.87%), Postives = 58/94 (61.70%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 F + W PI IILL+++LN Y T +T QI++H+LAY NSCVNP+LYAFLSE FR F V+ C P+ +G A K + G GNS Sbjct: 267 FAVCWCPIQIILLVKALNKYHITYFTVTAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYC---PPPYNDGFSGRPQAT-KTTRTGNGNS 356
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|3023827|sp|P56479.1|GALR1_MOUSE (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.633 bits (174), Expect = 1.677e-14 Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F +SWLP H++ L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C HV D S+ E KS+ D Sbjct: 255 FGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC--------------------HVCDESPRSETKENKSRMDT 339
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|2494997|sp|Q62805.1|GALR1_RAT (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.633 bits (174), Expect = 1.834e-14 Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC-IRPSGPHG 107 F +SWLP H+I L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C + PHG Sbjct: 254 FGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCRVCNESPHG 327
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|311033447|sp|P47211.3|GALR1_HUMAN (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.2478 bits (173), Expect = 2.852e-14 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F +SWLP HII L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 256 FGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|550544281|sp|P49660.2|SSR4_MOUSE (RecName: Full=Somatostatin receptor type 4; Short=SS-4-R; Short=SS4-R; Short=SS4R) HSP 1 Score: 61.6178 bits (148), Expect = 7.181e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 261 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 326
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|401131|sp|P30937.1|SSR4_RAT (RecName: Full=Somatostatin receptor type 4; Short=SS-4-R; Short=SS4-R; Short=SS4R) HSP 1 Score: 61.6178 bits (148), Expect = 7.602e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 260 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 325
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|341940724|sp|O88854.2|GALR2_MOUSE (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 60.077 bits (144), Expect = 2.132e-10 Identity = 33/110 (30.00%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + CI G H E D+ V + G Sbjct: 240 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAG 349
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|6016094|sp|O43603.1|GALR2_HUMAN (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 60.077 bits (144), Expect = 2.564e-10 Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V +F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + C G H E +D+ H+ + G Sbjct: 241 VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAG 350
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|6225768|sp|O54799.1|NMBR_MOUSE (RecName: Full=Neuromedin-B receptor; Short=NMB-R; AltName: Full=Neuromedin-B-preferring bombesin receptor) HSP 1 Score: 59.3066 bits (142), Expect = 5.318e-10 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPM--NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPH 106 F W P H++ L RS N E P +M ++A +L++SNSCVNP LSE FR+ F + + C R S P Sbjct: 275 FVFCWFPNHVLYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPE 348
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|3023820|sp|O08726.1|GALR2_RAT (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 58.9214 bits (141), Expect = 5.744e-10 Identity = 33/110 (30.00%), Postives = 55/110 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT-CIRPS-------------GPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + +RP+ G H E D+ V + G Sbjct: 241 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAG 350
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: AAG22404.3 (allatostatin A receptor 1, isoform D [Drosophila melanogaster]) HSP 1 Score: 88.1965 bits (217), Expect = 1.097e-20 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 367
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: AAF45884.3 (allatostatin A receptor 1, isoform B [Drosophila melanogaster]) HSP 1 Score: 88.1965 bits (217), Expect = 1.097e-20 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 367
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EFX75149.1 (putative allatostatin A receptor, partial [Daphnia pulex]) HSP 1 Score: 84.7297 bits (208), Expect = 9.455e-20 Identity = 37/69 (53.62%), Postives = 52/69 (75.36%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 VV+IF + W PI ++L+L+SL L+E TP+ + QII+H+LAY NSCVNP LYA +S+ FR+ F V+ C Sbjct: 224 VVVIFAVCWCPIQLVLVLKSLALFEITPLTVMIQIISHVLAYMNSCVNPFLYALISDNFRKAFRKVVYC 292
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|KFM63252.1| (Allatostatin-A receptor, partial [Stegodyphus mimosarum]) HSP 1 Score: 81.2629 bits (199), Expect = 1.703e-18 Identity = 37/65 (56.92%), Postives = 48/65 (73.85%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F + W PI I+L+L+S++ Y TP+ + QI +HILAY NSCVNPILYAFLS+ FR+ F VI C Sbjct: 176 FAVCWCPIQIVLVLKSVDSYGLTPLRIVGQITSHILAYMNSCVNPILYAFLSDNFRKAFHKVIAC 240
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EGK97097.1 (AGAP003658-PB [Anopheles gambiae str. PEST]) HSP 1 Score: 79.7221 bits (195), Expect = 8.926e-18 Identity = 34/59 (57.63%), Postives = 46/59 (77.97%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 F W PI +ILLL+SL LY T ++ FQI++H+LAY+NSC+NP+LYAFLS+ FR+ F Sbjct: 240 FAFCWCPIQVILLLKSLKLYGLTHASIIFQIVSHVLAYTNSCINPVLYAFLSDNFRKAF 298
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EAA08925.3 (AGAP003658-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 79.7221 bits (195), Expect = 8.926e-18 Identity = 34/59 (57.63%), Postives = 46/59 (77.97%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 F W PI +ILLL+SL LY T ++ FQI++H+LAY+NSC+NP+LYAFLS+ FR+ F Sbjct: 240 FAFCWCPIQVILLLKSLKLYGLTHASIIFQIVSHVLAYTNSCINPVLYAFLSDNFRKAF 298
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|EEC18662.1| (allatostatin receptor, putative [Ixodes scapularis]) HSP 1 Score: 78.5666 bits (192), Expect = 3.937e-17 Identity = 39/107 (36.45%), Postives = 57/107 (53.27%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYES--TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F + W P+ ++L+L+S++LY P+ + QI + +LAY+NSCVNP LYAFLSE FR+ F +I C P G + D + + C SK N Sbjct: 276 FAVCWCPVQVVLVLKSVDLYGQPMNPLRIVIQIASQVLAYTNSCVNPFLYAFLSENFRKNFRKIIFCC-PKAMTGSGSTRTRIGDDTERTERETTATCITASSKLSN 381
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|EEC00437.1| (allatostatin receptor, putative [Ixodes scapularis]) HSP 1 Score: 78.1814 bits (191), Expect = 4.795e-17 Identity = 45/111 (40.54%), Postives = 60/111 (54.05%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNG---YEMADIKHVKDGRGNSKCGEEKSKGDN 139 F + W P+ I+L+L+S+NLY PMN + QI + ILAY+NSCVNP LYAFLSE FR+ F +I C P V +G + D + + C SK N Sbjct: 285 FAVCWCPVQIVLVLKSVNLY-GQPMNPPRIVVQIASQILAYTNSCVNPFLYAFLSENFRKSFRKIIFCC----PRSVTSSGSTRTRIGDENERTERETTATCITRASKISN 390
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EAA01665.3 (AGAP001774-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 75.0998 bits (183), Expect = 5.742e-17 Identity = 34/75 (45.33%), Postives = 54/75 (72.00%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNG 112 W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C GP G R G Sbjct: 89 WFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYC----GP-GSRRQG 158
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|EEC00436.1| (allatostatin receptor, putative [Ixodes scapularis]) HSP 1 Score: 77.7962 bits (190), Expect = 6.052e-17 Identity = 47/113 (41.59%), Postives = 62/113 (54.87%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMT---FQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG-----VHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F + W P+ ++L+L+S++LY PMN T QI + ILAY+NSCVNP LYAFLS+ FR+ F +I C + G V NG E D R CG + SK N Sbjct: 264 FAVCWCPVQVVLVLKSVDLY-GLPMNPTRIVIQIASQILAYTNSCVNPFLYAFLSDNFRKSFRKIIFCYQKPTSSGRPRSRVGENG-ERTD-------RDMGNCGTKTSKVSN 367
BLAST of EMLSAG00000000789 vs. nr
Match: gi|929348663|ref|XP_014100691.1| (PREDICTED: allatostatin-A receptor-like [Bactrocera oleae]) HSP 1 Score: 88.9669 bits (219), Expect = 4.171e-18 Identity = 38/68 (55.88%), Postives = 54/68 (79.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 F + WLPIH+IL+L++L++Y ST + + QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 331 FAICWLPIHVILVLKALDMYASTHLTVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGTP 398
BLAST of EMLSAG00000000789 vs. nr
Match: gi|807033491|ref|XP_012158906.1| (PREDICTED: allatostatin-A receptor-like [Ceratitis capitata]) HSP 1 Score: 89.3521 bits (220), Expect = 4.225e-18 Identity = 38/68 (55.88%), Postives = 54/68 (79.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 F + WLPIH+IL+L++L++Y ST + + QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 447 FAICWLPIHVILVLKALDMYASTHLTVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGTP 514
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1061482441|gb|ODM99727.1| (Allatostatin-A receptor [Orchesella cincta]) HSP 1 Score: 85.8853 bits (211), Expect = 5.080e-18 Identity = 44/82 (53.66%), Postives = 55/82 (67.07%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKH 120 WLPI +LLL+SLNLY+ T + + QI AH+L Y NSCVNPILYAFLS+ FR+ F VI C P+ NG ++ IKH Sbjct: 84 WLPIQTVLLLKSLNLYQITDLTVAIQITAHVLGYMNSCVNPILYAFLSDNFRKAFRKVIQCKALLLPNHPPPNGSQI--IKH 163
BLAST of EMLSAG00000000789 vs. nr
Match: gi|85857456|gb|ABC86264.1| (RE48774p [Drosophila melanogaster]) HSP 1 Score: 88.1965 bits (217), Expect = 5.260e-18 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 367
BLAST of EMLSAG00000000789 vs. nr
Match: gi|195340964|ref|XP_002037082.1| (GM12299 [Drosophila sechellia] >gi|1013890306|ref|XP_016037984.1| uncharacterized protein Dsimw501_GD16646, isoform A [Drosophila simulans] >gi|1013890308|ref|XP_016037985.1| uncharacterized protein Dsimw501_GD16646, isoform B [Drosophila simulans] >gi|194131198|gb|EDW53241.1| GM12299 [Drosophila sechellia] >gi|194203431|gb|EDX17007.1| GD16646 [Drosophila simulans] >gi|900929035|gb|KMZ08052.1| uncharacterized protein Dsimw501_GD16646, isoform A [Drosophila simulans] >gi|900929036|gb|KMZ08053.1| uncharacterized protein Dsimw501_GD16646, isoform B [Drosophila simulans]) HSP 1 Score: 88.1965 bits (217), Expect = 5.260e-18 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 298 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 367
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold338_size202645-snap-gene-1.15 (protein:Tk00724 transcript:maker-scaffold338_size202645-snap-gene-1.15-mRNA-1 annotation:"allatostatin a receptor") HSP 1 Score: 155.992 bits (393), Expect = 6.313e-47 Identity = 73/110 (66.36%), Postives = 89/110 (80.91%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADI-KHVKDGRGNSKCGEEKSKGDN 139 VV+IF LSWLPIHIIL++R + LY +TP+ +T QII+HILAYSNSCVNPILYA+LSEPFRRGFWAVITCI+PSGPHGV +NGYEM D+ H + KC ++ G+N Sbjct: 271 VVIIFALSWLPIHIILIMRGMKLYPNTPLTVTTQIISHILAYSNSCVNPILYAWLSEPFRRGFWAVITCIKPSGPHGVLQNGYEMGDVMPHGRQAGHAKKCAQK--NGNN 378
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-5.8 (protein:Tk03859 transcript:maker-scaffold20_size707684-snap-gene-5.8-mRNA-1 annotation:"af336364_1allatostatin receptor") HSP 1 Score: 66.6254 bits (161), Expect = 4.758e-14 Identity = 42/107 (39.25%), Postives = 56/107 (52.34%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLY-----ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI-TCIRP--SGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKG 137 W PI +LL+++L +Y E P + FQI AH LAY NSCVNPILYAFLS+ FR+ F + C G G YE+ ++ D R +S +G Sbjct: 313 WAPIQFVLLMKALKVYNTKGPEDFP-RIIFQIFAHCLAYVNSCVNPILYAFLSDNFRKAFHQFLPDCCHKVMGGARGRPALQYELTTLR--ADRRNSSNLKRYGKRG 416
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-2.11 (protein:Tk03842 transcript:maker-scaffold20_size707684-snap-gene-2.11-mRNA-1 annotation:"neuropeptide gpcr a23") HSP 1 Score: 50.447 bits (119), Expect = 1.981e-8 Identity = 31/76 (40.79%), Postives = 41/76 (53.95%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 VV IF W+P I +L + +N Y +N+ F + H LA SNSC NP +Y SE FRR F + C+RP Sbjct: 411 VVSIFAFCWMPWQIYATTMLFIPQVNSYRY--INIIF-FVCHWLAMSNSCYNPFIYGVYSEKFRREFSIRLPCLRP 483
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold152_size304267-processed-gene-0.11 (protein:Tk10103 transcript:snap_masked-scaffold152_size304267-processed-gene-0.11-mRNA-1 annotation:"somatostatin receptor type 2") HSP 1 Score: 49.6766 bits (117), Expect = 3.662e-8 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 31 VVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC Sbjct: 303 VITVYILCWLPYWITQLALIFTEPGHTQDNVMVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTC 373
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold763_size101323-snap-gene-0.15 (protein:Tk04717 transcript:maker-scaffold763_size101323-snap-gene-0.15-mRNA-1 annotation:"lymnokinin receptor") HSP 1 Score: 48.1358 bits (113), Expect = 1.582e-7 Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 VV IF + WLP H+ +LL+ +N Y +N+ F +H LA NSC NP +YA SE F+R F C Sbjct: 376 VVVAIFGVCWLPWHLYQISVLLVPEINEYHY--INIIF-FFSHWLAMFNSCCNPFIYAIYSEKFKREFQQFAHC 446
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold272_size230267-processed-gene-1.9 (protein:Tk00260 transcript:snap_masked-scaffold272_size230267-processed-gene-1.9-mRNA-1 annotation:"retinal rod rhodopsin-sensitive cgmp 3 -cyclic phosphodiesterase subunit delta isoform x2") HSP 1 Score: 47.7506 bits (112), Expect = 1.756e-7 Identity = 27/85 (31.76%), Postives = 46/85 (54.12%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM-----NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCI---RPSGPH 106 +V ++F LSWLP++ LL + P+ +TF I+ ++L +N+CVNP+LY + +E FR + + + RPS Sbjct: 319 SVTVVFFLSWLPLNTFRLLSEFGPAQLHPLLGGREELTFGIL-NLLGATNACVNPLLYGYFNENFRNEYKYIYRAMPWQRPSAAQ 402
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold567_size135338-snap-gene-0.22 (protein:Tk01951 transcript:maker-scaffold567_size135338-snap-gene-0.22-mRNA-1 annotation:"GK13031") HSP 1 Score: 46.9802 bits (110), Expect = 3.815e-7 Identity = 29/118 (24.58%), Postives = 59/118 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHII-LLLRSLNLY-ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNG---YEMADIKHVKDGRG----NSKCGEEKSKGDN 139 + L+F + W P++++ +++ S +L+ E+ + + + H++ S++C+NPILY + +E R +I I P R+ E+ D+ HV R + CG+ D+ Sbjct: 298 ISLVFCVCWFPLNLLGVIIDSTDLFRENHQLMLCIFVACHLVGMSSACINPILYGYRNEGVRSEISHMIKRISFRTPTSRKRSQSKLLELQDLNHVAIKRNVSYFDEDCGQNADGRDS 415
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold941_size78300-snap-gene-0.19 (protein:Tk00817 transcript:maker-scaffold941_size78300-snap-gene-0.19-mRNA-1 annotation:"prolactin-releasing peptide receptor") HSP 1 Score: 45.8246 bits (107), Expect = 8.439e-7 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYES---TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 ++V+IF W P+++I L ++L+ + TF + HILA S++C NP LY +L+E FR F +I Sbjct: 264 SMVVIFGTCWFPLNVINFLADIDLFPIFCWEYYHFTF-FLCHILAMSSNCYNPFLYGWLNESFRGEFLKMI 333 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000789 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 6
BLAST of EMLSAG00000000789 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 8
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s112:585535..586017- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000789-683555 ID=EMLSAG00000000789-683555|Name=EMLSAG00000000789|organism=Lepeophtheirus salmonis|type=gene|length=483bp|location=Sequence derived from alignment at LSalAtl2s112:585535..586017- (Lepeophtheirus salmonis)back to top Add to Basket
|