EMLSAG00000000789, EMLSAG00000000789-683555 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Galr2 "galanin receptor 2" species:10090 "Mus musculus" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004966 "galanin receptor activity" evidence=ISO] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007189 "adenylate cyclase-activating G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=ISO] [GO:0007218 "neuropeptide signaling pathway" evidence=ISO] [GO:0007268 "synaptic transmission" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031175 "neuron projection development" evidence=IDA] [GO:0042923 "neuropeptide binding" evidence=ISO] [GO:0043647 "inositol phosphate metabolic process" evidence=ISO] [GO:0046488 "phosphatidylinositol metabolic process" evidence=ISO] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003907 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01419 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:1337018 GO:GO:0016021 GO:GO:0005886 GO:GO:0007268 GO:GO:0007204 GO:GO:0007218 GO:GO:0007194 EMBL:CH466558 GO:GO:0031175 EMBL:AL645861 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 GuidetoPHARMACOLOGY:244 CTD:8811 KO:K04231 OMA:FRKICAG EMBL:AF042784 EMBL:AF077375 EMBL:BC116980 EMBL:BC116982 RefSeq:NP_034384.3 UniGene:Mm.57149 ProteinModelPortal:O88854 SMR:O88854 STRING:10090.ENSMUSP00000054062 PhosphoSite:O88854 PRIDE:O88854 Ensembl:ENSMUST00000055872 GeneID:14428 KEGG:mmu:14428 UCSC:uc007mkr.2 InParanoid:Q14A53 NextBio:286037 PRO:PR:O88854 Bgee:O88854 CleanEx:MM_GALR2 Genevestigator:O88854 Uniprot:O88854) HSP 1 Score: 60.077 bits (144), Expect = 4.762e-10 Identity = 33/110 (30.00%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + CI G H E D+ V + G Sbjct: 240 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAG 349
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:GALR2 "Galanin receptor type 2" species:9606 "Homo sapiens" [GO:0004966 "galanin receptor activity" evidence=IEA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005886 "plasma membrane" evidence=TAS] [GO:0006936 "muscle contraction" evidence=TAS] [GO:0007166 "cell surface receptor signaling pathway" evidence=TAS] [GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=TAS] [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007204 "positive regulation of cytosolic calcium ion concentration" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=TAS] [GO:0007268 "synaptic transmission" evidence=TAS] [GO:0007275 "multicellular organismal development" evidence=TAS] [GO:0007586 "digestion" evidence=TAS] [GO:0007611 "learning or memory" evidence=TAS] [GO:0007631 "feeding behavior" evidence=TAS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031175 "neuron projection development" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003907 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01419 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0007275 GO:GO:0005886 Reactome:REACT_111102 GO:GO:0007631 GO:GO:0007204 GO:GO:0007586 GO:GO:0007194 GO:GO:0007611 GO:GO:0006936 GO:GO:0007188 EMBL:CH471099 GO:GO:0031175 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 EMBL:AF040630 EMBL:AF080586 EMBL:AF058762 EMBL:AF042782 EMBL:EF577401 EMBL:BC069130 EMBL:BC074914 EMBL:BC074915 EMBL:BC109051 EMBL:BC109052 PIR:JC5949 RefSeq:NP_003848.1 UniGene:Hs.666366 ProteinModelPortal:O43603 SMR:O43603 IntAct:O43603 STRING:9606.ENSP00000329684 BindingDB:O43603 ChEMBL:CHEMBL3176 GuidetoPHARMACOLOGY:244 PhosphoSite:O43603 PaxDb:O43603 PRIDE:O43603 Ensembl:ENST00000329003 GeneID:8811 KEGG:hsa:8811 UCSC:uc002jqm.1 CTD:8811 GeneCards:GC17P074070 HGNC:HGNC:4133 HPA:HPA044513 MIM:603691 neXtProt:NX_O43603 PharmGKB:PA28546 InParanoid:O43603 KO:K04231 OMA:FRKICAG PhylomeDB:O43603 GeneWiki:Galanin_receptor_2 GenomeRNAi:8811 NextBio:33048 PRO:PR:O43603 Bgee:O43603 CleanEx:HS_GALR2 Genevestigator:O43603 Uniprot:O43603) HSP 1 Score: 60.077 bits (144), Expect = 5.900e-10 Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V +F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + C G H E +D+ H+ + G Sbjct: 241 VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAG 350
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Nmbr "neuromedin B receptor" species:10090 "Mus musculus" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004946 "bombesin receptor activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031989 "bombesin receptor signaling pathway" evidence=IEA] InterPro:IPR000276 InterPro:IPR001556 InterPro:IPR001642 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00358 PRINTS:PR00639 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:1100525 GO:GO:0016021 GO:GO:0005886 GO:GO:0005737 GO:GO:0007268 GO:GO:0007218 HOGENOM:HOG000230781 HOVERGEN:HBG004898 OrthoDB:EOG73V6KG TreeFam:TF331292 GO:GO:0004946 eggNOG:NOG328649 GuidetoPHARMACOLOGY:38 CTD:4829 KO:K04168 OMA:IKSAHNL EMBL:AB010281 RefSeq:NP_032729.1 UniGene:Mm.487342 ProteinModelPortal:O54799 SMR:O54799 STRING:10090.ENSMUSP00000020015 PhosphoSite:O54799 PaxDb:O54799 PRIDE:O54799 Ensembl:ENSMUST00000020015 GeneID:18101 KEGG:mmu:18101 UCSC:uc007elp.1 InParanoid:O54799 NextBio:293267 PRO:PR:O54799 ArrayExpress:O54799 Bgee:O54799 CleanEx:MM_NMBR Genevestigator:O54799 Uniprot:O54799) HSP 1 Score: 59.3066 bits (142), Expect = 1.202e-9 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPM--NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPH 106 F W P H++ L RS N E P +M ++A +L++SNSCVNP LSE FR+ F + + C R S P Sbjct: 275 FVFCWFPNHVLYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPE 348
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:npffr2.2 "neuropeptide FF receptor 2.2" species:7955 "Danio rerio" [GO:0043408 "regulation of MAPK cascade" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0008188 "neuropeptide receptor activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:2000479 "regulation of cAMP-dependent protein kinase activity" evidence=IEA] [GO:0045761 "regulation of adenylate cyclase activity" evidence=IEA] [GO:0031628 "opioid receptor binding" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR005395 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01570 PROSITE:PS00237 PROSITE:PS50262 ZFIN:ZDB-GENE-070705-159 GO:GO:0016021 GO:GO:0007268 GO:GO:0007218 GO:GO:0008188 TreeFam:TF315303 GeneTree:ENSGT00710000106558 EMBL:CR391999 ProteinModelPortal:F1Q764 Ensembl:ENSDART00000085821 OMA:ENGQNIS Uniprot:F1Q764) HSP 1 Score: 59.3066 bits (142), Expect = 1.234e-9 Identity = 35/85 (41.18%), Postives = 49/85 (57.65%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLR---SLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRN 111 V L+F LSWLP+ +++L SL+ + +N+ F +AH LA+ NS VNPI+Y F +E FR+GF A SG G R Sbjct: 291 VVALLFILSWLPLWALMMLSDYASLSERQHRVINIYFYPLAHWLAFCNSSVNPIIYGFFNENFRKGFKAAFKLQLCSGHSGNRRT 375
BLAST of EMLSAG00000000789 vs. GO
Match: - (symbol:Galr2 "Galanin receptor type 2" species:10116 "Rattus norvegicus" [GO:0007194 "negative regulation of adenylate cyclase activity" evidence=IEA] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA;IMP] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR000405 InterPro:IPR003907 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00663 PRINTS:PR01419 PROSITE:PS00237 PROSITE:PS50262 RGD:2657 GO:GO:0016021 GO:GO:0005886 GO:GO:0007204 GO:GO:0007189 GO:GO:0007194 GO:GO:0046488 GO:GO:0043647 GO:GO:0042923 eggNOG:NOG320953 HOGENOM:HOG000230487 HOVERGEN:HBG101447 OrthoDB:EOG7327PK TreeFam:TF315737 GO:GO:0004966 GeneTree:ENSGT00620000087530 GuidetoPHARMACOLOGY:244 CTD:8811 KO:K04231 OMA:FRKICAG EMBL:U94322 EMBL:AF010318 EMBL:Y15248 EMBL:AF008548 RefSeq:NP_062045.1 RefSeq:XP_003751012.1 UniGene:Rn.9789 ProteinModelPortal:O08726 STRING:10116.ENSRNOP00000012523 BindingDB:O08726 ChEMBL:CHEMBL5577 PhosphoSite:O08726 PaxDb:O08726 Ensembl:ENSRNOT00000012523 Ensembl:ENSRNOT00000075548 GeneID:100910349 GeneID:29234 KEGG:rno:100910349 KEGG:rno:29234 InParanoid:O08726 NextBio:608490 PRO:PR:O08726 Genevestigator:O08726 Uniprot:O08726) HSP 1 Score: 58.9214 bits (141), Expect = 1.247e-9 Identity = 33/110 (30.00%), Postives = 55/110 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT-CIRPS-------------GPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + +RP+ G H E D+ V + G Sbjct: 241 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAG 350
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592847339|gb|GAXK01110205.1| (TSA: Calanus finmarchicus comp1959081_c0_seq1 transcribed RNA sequence) HSP 1 Score: 79.337 bits (194), Expect = 3.154e-18 Identity = 35/59 (59.32%), Postives = 47/59 (79.66%), Query Frame = 0 Query: 43 HIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 +ILLL+S LYE T +N++ QI +H+LAYSNSC+NPILYAFLS PFR GF ++ C++ Sbjct: 243 QLILLLKSFELYEVTILNISVQIGSHVLAYSNSCINPILYAFLSPPFRAGFVKLLPCMK 419
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592933836|gb|GAXK01024717.1| (TSA: Calanus finmarchicus comp4659006_c0_seq1 transcribed RNA sequence) HSP 1 Score: 72.0182 bits (175), Expect = 3.564e-15 Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNL--YESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 AV+ +FT+ W PIH++ + +SL +E +T QI+AH+LAY+NSC+NP+LYA +S FR GF ++ Sbjct: 74 AVITVFTVCWAPIHVVFVRKSLTAEDWEHHYGKLTLQILAHVLAYTNSCLNPLLYAKMSRNFRLGFRQLV 283
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948123|gb|GAXK01010430.1| (TSA: Calanus finmarchicus comp1780950_c0_seq2 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 2.791e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 559 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 723
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592948124|gb|GAXK01010429.1| (TSA: Calanus finmarchicus comp1780950_c0_seq1 transcribed RNA sequence) HSP 1 Score: 71.633 bits (174), Expect = 3.259e-14 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 WLP+ +ILL S L++ + ++ QI +H+LAY+NSCVNPILYAF S PFR+ F Sbjct: 616 WLPLQVILLGNSFGLFKFSVTKVSIQIGSHVLAYANSCVNPILYAFFSTPFRKAF 780
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592858858|gb|GAXK01098704.1| (TSA: Calanus finmarchicus comp3222639_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.6178 bits (148), Expect = 9.553e-12 Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYE--STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPS 103 F + W PIH + + +SL + ++ QI+AH+LAY+NSC+NP+LYA +S FR GF ++ ++ S Sbjct: 10 FVVCWSPIHYVFVRKSLTHADWSHNSSKLSLQILAHLLAYTNSCLNPLLYAKMSRNFRIGFRQLVPLVQKS 222
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592816587|gb|GAXK01137981.1| (TSA: Calanus finmarchicus comp5844387_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.121e-11 Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 42 IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 + ILL ++L Y + N++ QI +H+LAYSNSC+NPI+YAF S FR+ F Sbjct: 251 LQTILLFKALGSYPFSIRNISIQIGSHVLAYSNSCINPIIYAFFSTQFRKSF 406
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592774524|gb|GAXK01180044.1| (TSA: Calanus finmarchicus comp1832915_c0_seq1 transcribed RNA sequence) HSP 1 Score: 61.2326 bits (147), Expect = 1.285e-11 Identity = 27/48 (56.25%), Postives = 39/48 (81.25%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 V ++F+LSWLPI +ILL++S +YE T N++ QI +H+LAYSNSC+N Sbjct: 1 VTVMFSLSWLPIQLILLIKSFEIYEVTIFNISVQIGSHVLAYSNSCIN 144
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592897336|gb|GAXK01061039.1| (TSA: Calanus finmarchicus comp3873770_c0_seq1 transcribed RNA sequence) HSP 1 Score: 58.9214 bits (141), Expect = 8.745e-11 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVN 78 +V +IF LSWLPI +IL ++S + E T N++ QI +HILAYSNSC+N Sbjct: 1 SVTIIFALSWLPIQLILFIKSFTVLEVTIFNISLQIGSHILAYSNSCIN 147
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804419|gb|GAXK01150149.1| (TSA: Calanus finmarchicus comp1591687_c0_seq2 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 2.975e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Match: gi|592804420|gb|GAXK01150148.1| (TSA: Calanus finmarchicus comp1591687_c0_seq1 transcribed RNA sequence) HSP 1 Score: 59.6918 bits (143), Expect = 3.198e-10 Identity = 40/114 (35.09%), Postives = 64/114 (56.14%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSL---NLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI----TCIRPSGPHGVHRNGYEMADIKHVKDGRG--NSKCGEEKSKGDN 139 F + W PI I+LL +++ + ++S + QI++H+LAY+NSC+NP+LYA +S FR GF ++ + RPS YEM + + RG N++ EE S D+ Sbjct: 1060 FMVCWAPIQIVLLHKAVVERDDWDSDFYMIVIQIVSHVLAYTNSCLNPLLYAKMSRNFRCGFSLLVPMWGSSRRPSS-----LLQYEMTSRRKRRSSRGPRNAELPEEASNKDD 1386
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000000789 (pep:novel supercontig:LSalAtl2s:LSalAtl2s112:585535:586017:-1 gene:EMLSAG00000000789 transcript:EMLSAT00000000789 description:"maker-LSalAtl2s112-augustus-gene-5.9") HSP 1 Score: 290.041 bits (741), Expect = 1.366e-101 Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 0 Query: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN Sbjct: 1 IISWIGISFPASSHNWTLLCNALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000006364 (pep:novel supercontig:LSalAtl2s:LSalAtl2s348:280240:283416:1 gene:EMLSAG00000006364 transcript:EMLSAT00000006364 description:"maker-LSalAtl2s348-augustus-gene-2.10") HSP 1 Score: 72.4034 bits (176), Expect = 3.796e-16 Identity = 31/71 (43.66%), Postives = 53/71 (74.65%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYEST-PMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 V+++F + W PI ++L+L++L+L+ + P + + QI+AH+LAY N C+NPILYAFLS+ FR+ F+ ++ Sbjct: 124 VIVVFAVCWAPIQLVLILKALDLFVTNGPEDYHRIIIQILAHVLAYLNGCINPILYAFLSDNFRKAFYELL 194
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000010948 (pep:novel supercontig:LSalAtl2s:LSalAtl2s733:230784:233291:-1 gene:EMLSAG00000010948 transcript:EMLSAT00000010948 description:"augustus_masked-LSalAtl2s733-processed-gene-2.0") HSP 1 Score: 72.7886 bits (177), Expect = 6.561e-16 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMT-FQIIAHILAYSNSCVNPILYAFLSEPFRRGF 93 VV++F L W P+ +++LL+S LYE ++ FQII H LAY NSC+NP LYAFLS FR F Sbjct: 285 VVIVFVLCWSPLQVVMLLKSFKLYEINQTSLVAFQIICHCLAYCNSCLNPFLYAFLSSNFRETF 348
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000003816 (pep:novel supercontig:LSalAtl2s:LSalAtl2s206:593132:594481:1 gene:EMLSAG00000003816 transcript:EMLSAT00000003816 description:"augustus_masked-LSalAtl2s206-processed-gene-6.8") HSP 1 Score: 55.8398 bits (133), Expect = 4.718e-10 Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 0 Query: 30 AVVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSK 136 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC++ G N D R + K G++K+K Sbjct: 265 TVITVYILCWLPYWITQLALIFTPPGHNQDNVVVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTCVK-----GREVNAALHVDNSMFPRRRNHRKTGDKKNK 368
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6") HSP 1 Score: 47.7506 bits (112), Expect = 2.420e-7 Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 0 Query: 21 NALQTLDQRAVVLIFTLSWLPIHIILLLRSLNLYESTPMNM--TFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 A +TL A++L F ++W P ++ +L ++ E+ + + T A+ L Y NS VNP+LYA + FRR + ++TC Sbjct: 554 KAAKTLS--AILLAFIVTWTPYSVLTVLNAVLGKETADVYIPPTLWDFAYYLCYINSTVNPVLYALCNAAFRRTYVRILTC 632
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Match: EMLSAP00000012259 (pep:novel supercontig:LSalAtl2s:LSalAtl2s895:238961:260136:1 gene:EMLSAG00000012259 transcript:EMLSAT00000012259 description:"maker-LSalAtl2s895-augustus-gene-1.29") HSP 1 Score: 46.2098 bits (108), Expect = 4.968e-7 Identity = 25/78 (32.05%), Postives = 42/78 (53.85%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM------NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 A+V++F L W P ++ + RS + + N TF + +AY NS +NPI+Y F+S+ FR F + C++ Sbjct: 184 AIVVVFVLCWSPFLVMNIFRSFGVVNISLHGFVKYDNTTFTL----MAYLNSALNPIIYGFMSQNFRDNFRRTVGCLK 257
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|75018194|sp|Q8WPA2.1|AR_BOMMO (RecName: Full=Allatostatin-A receptor; Short=BAR) HSP 1 Score: 82.8037 bits (203), Expect = 1.564e-18 Identity = 45/94 (47.87%), Postives = 58/94 (61.70%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 F + W PI IILL+++LN Y T +T QI++H+LAY NSCVNP+LYAFLSE FR F V+ C P+ +G A K + G GNS Sbjct: 267 FAVCWCPIQIILLVKALNKYHITYFTVTAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYC---PPPYNDGFSGRPQAT-KTTRTGNGNS 356
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|3023827|sp|P56479.1|GALR1_MOUSE (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.633 bits (174), Expect = 1.677e-14 Identity = 41/105 (39.05%), Postives = 52/105 (49.52%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F +SWLP H++ L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C HV D S+ E KS+ D Sbjct: 255 FGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC--------------------HVCDESPRSETKENKSRMDT 339
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|2494997|sp|Q62805.1|GALR1_RAT (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.633 bits (174), Expect = 1.834e-14 Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC-IRPSGPHG 107 F +SWLP H+I L + TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C + PHG Sbjct: 254 FGISWLPHHVIHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCRVCNESPHG 327
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|311033447|sp|P47211.3|GALR1_HUMAN (RecName: Full=Galanin receptor type 1; Short=GAL1-R; Short=GALR-1) HSP 1 Score: 71.2478 bits (173), Expect = 2.852e-14 Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F +SWLP HII L ++ TP + F+I AH LAYSNS VNPI+YAFLSE FR+ + V C Sbjct: 256 FGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC 320
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|550544281|sp|P49660.2|SSR4_MOUSE (RecName: Full=Somatostatin receptor type 4; Short=SS-4-R; Short=SS4-R; Short=SS4R) HSP 1 Score: 61.6178 bits (148), Expect = 7.181e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 261 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 326
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|401131|sp|P30937.1|SSR4_RAT (RecName: Full=Somatostatin receptor type 4; Short=SS-4-R; Short=SS4-R; Short=SS4R) HSP 1 Score: 61.6178 bits (148), Expect = 7.602e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIR 101 VV +F L W+P +++ LL NL+ T ++ T ++ IL+Y+NSC NPILY FLS+ FRR F V+ C+R Sbjct: 260 VVTVFVLCWMPFYVVQLL---NLF-VTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQRVL-CLR 325
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|341940724|sp|O88854.2|GALR2_MOUSE (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 60.077 bits (144), Expect = 2.132e-10 Identity = 33/110 (30.00%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + CI G H E D+ V + G Sbjct: 240 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAG 349
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|6016094|sp|O43603.1|GALR2_HUMAN (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 60.077 bits (144), Expect = 2.564e-10 Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT--------------CIRPSGPHGVHRNGYEMADIKHVKDGRG 126 V +F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + C G H E +D+ H+ + G Sbjct: 241 VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAG 350
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|6225768|sp|O54799.1|NMBR_MOUSE (RecName: Full=Neuromedin-B receptor; Short=NMB-R; AltName: Full=Neuromedin-B-preferring bombesin receptor) HSP 1 Score: 59.3066 bits (142), Expect = 5.318e-10 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPM--NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPH 106 F W P H++ L RS N E P +M ++A +L++SNSCVNP LSE FR+ F + + C R S P Sbjct: 275 FVFCWFPNHVLYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPE 348
BLAST of EMLSAG00000000789 vs. SwissProt
Match: gi|3023820|sp|O08726.1|GALR2_RAT (RecName: Full=Galanin receptor type 2; Short=GAL2-R; Short=GALR-2) HSP 1 Score: 58.9214 bits (141), Expect = 5.744e-10 Identity = 33/110 (30.00%), Postives = 55/110 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVIT-CIRPS-------------GPHGVHRNGYEMADIKHVKDGRG 126 V ++F L W+P H ++L + T +I++H+++Y+NSCVNPI+YA +S+ FR+GF + +RP+ G H E D+ V + G Sbjct: 241 VAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAG 350
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_016771724.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_006560263.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: XP_006560262.1 (PREDICTED: allatostatin-A receptor isoform X1 [Apis mellifera]) HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-16 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHG 107 W PI +IL+ +SL++Y T + QI +HILAY+NSCVNPILYAFLS+ FR+ F +I C RP Sbjct: 275 WCPIQVILVTKSLDVYPLTSATIMVQIASHILAYTNSCVNPILYAFLSDSFRKAFRKIIYC-RPRSEQN 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EGK97485.1 (AGAP001773-PC [Anopheles gambiae str. PEST]) HSP 1 Score: 76.6406 bits (187), Expect = 1.612e-16 Identity = 37/85 (43.53%), Postives = 58/85 (68.24%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYE 114 VV F W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C GP G R G + Sbjct: 261 VVAAFASLWFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYC----GP-GSRRQGSQ 340
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EEB15019.1 (class A rhodopsin-like G-protein coupled receptor GPRals, putative [Pediculus humanus corporis]) HSP 1 Score: 76.2554 bits (186), Expect = 2.071e-16 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0 Query: 34 IFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAV 96 IF W PI +ILL++SL Y++T + QI++H+L Y NSCVNPILYAFLS+ FR+ F V Sbjct: 282 IFAFCWCPIQVILLVKSLKYYQTTYATVLIQILSHLLGYMNSCVNPILYAFLSDNFRKAFRKV 344
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EGK97484.1 (AGAP001773-PB [Anopheles gambiae str. PEST]) HSP 1 Score: 75.8702 bits (185), Expect = 2.551e-16 Identity = 35/82 (42.68%), Postives = 56/82 (68.29%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRN 111 VV F W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C S G R+ Sbjct: 261 VVAAFASLWFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYCGPRSRRQGSQRH 342
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EAL38533.3 (AGAP001773-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 74.7146 bits (182), Expect = 6.053e-16 Identity = 34/77 (44.16%), Postives = 55/77 (71.43%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYE-STPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYE 114 W PI +IL+L+S+++++ T ++ QI++H+LAY++SC+NP+LYAFLSE FR+ F ++ C GP G R G + Sbjct: 259 WFPIQVILVLKSVDVFKPDTHFKISLQIVSHVLAYTSSCINPLLYAFLSENFRKAFRKIVYC----GP-GSRRQGSQ 330
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: gb|EEC01085.1| (allatostatin receptor, putative [Ixodes scapularis]) HSP 1 Score: 75.0998 bits (183), Expect = 7.706e-16 Identity = 45/111 (40.54%), Postives = 61/111 (54.95%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMN---MTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSG---PHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKGDN 139 F + W P+ I+L+L+S+ LY PMN + QI + ILAY+NSCVNP LYAFLSE FR+ F +I C + + G R K ++ GN C + SK N Sbjct: 318 FAVCWCPVQIVLVLKSVELY-GLPMNPPRIVIQIASQILAYTNSCVNPFLYAFLSENFRKSFRKIIFCYQRNASSSSSGPSRTRIGEEGEKTERETMGN--CTTKTSKISN 425
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: EFX71121.1 (putative allatostatin A receptor, partial [Daphnia pulex]) HSP 1 Score: 73.1738 bits (178), Expect = 1.509e-15 Identity = 32/65 (49.23%), Postives = 44/65 (67.69%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 F + W PI + L+L+SL L+E T + + QI +HILAY NSCVNP LYAF+S+ F + F + C Sbjct: 230 FAVCWFPIQLFLVLKSLALFEMTALTVMIQITSHILAYMNSCVNPFLYAFISDNFLKAFRKFVYC 294
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Match: AGB96422.1 (allatostatin A receptor 2, isoform C [Drosophila melanogaster]) HSP 1 Score: 73.559 bits (179), Expect = 1.947e-15 Identity = 32/62 (51.61%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLYES-TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 WLP+ +ILLL+SL++ E+ T + Q+ A LAYS+SC+NP+LYAFLSE FR+ F+ + C Sbjct: 269 WLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNC 330
BLAST of EMLSAG00000000789 vs. nr
Match: gi|734704274|gb|AJA32745.1| (FGLa/AST receptor [Rhodnius prolixus]) HSP 1 Score: 96.2857 bits (238), Expect = 7.795e-21 Identity = 45/86 (52.33%), Postives = 59/86 (68.60%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEM 115 VV IF + W PI +IL+++S+ YE TP ++ QI++H+LAY NSCVNPILYAFLSE FR+ F VI C G H H NG ++ Sbjct: 302 VVVAIFAICWCPIQVILVMKSIGQYEITPTSVMVQIVSHVLAYMNSCVNPILYAFLSENFRKAFRKVIYCGPEGGSHPPHLNGRQI 387
BLAST of EMLSAG00000000789 vs. nr
Match: gi|646642281|gb|KDQ71582.1| (Galanin receptor type 2 [Zootermopsis nevadensis]) HSP 1 Score: 88.9669 bits (219), Expect = 7.410e-20 Identity = 44/95 (46.32%), Postives = 61/95 (64.21%), Query Frame = 0 Query: 34 IFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMAD---IKHVKDGR 125 IF + W PI IIL+L+S+++YE T ++ QI++ ++AY NSCVNPILYAFLS+ FR+ F V+ C GP G Y+ A I H +GR Sbjct: 36 IFAICWFPIQIILVLKSIDMYEITNASVMIQIVSQVMAYMNSCVNPILYAFLSDHFRKAFRKVVNC----GPWGSGGTRYQRASTTIIPHQANGR 126
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1037028684|ref|XP_017033969.1| (PREDICTED: allatostatin-A receptor, partial [Drosophila kikkawai]) HSP 1 Score: 87.8113 bits (216), Expect = 2.119e-19 Identity = 37/70 (52.86%), Postives = 56/70 (80.00%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++L+LY ++ +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 55 LAFAICWLPIHVILVLKALDLYGASHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCCSP 124
BLAST of EMLSAG00000000789 vs. nr
Match: gi|924564512|gb|ALC49137.1| (maker320 [Drosophila busckii]) HSP 1 Score: 86.6557 bits (213), Expect = 2.654e-19 Identity = 42/96 (43.75%), Postives = 62/96 (64.58%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F + WLPIH+IL++++L++Y + +++ QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P V +M G G S Sbjct: 36 LAFAICWLPIHVILVMKALDMYGGSHLSVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP--PPIV--TNQQMTKTTRTATGNGTS 127
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1036728462|ref|XP_017086382.1| (PREDICTED: allatostatin-A receptor isoform X2 [Drosophila eugracilis] >gi|1036728481|ref|XP_017086383.1| PREDICTED: allatostatin-A receptor isoform X2 [Drosophila eugracilis]) HSP 1 Score: 88.1965 bits (217), Expect = 4.441e-19 Identity = 38/70 (54.29%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY + +++ QII+H++AY+NSC+NPILYAFLS+ FR+ F V+ C P Sbjct: 103 LAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP 172
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1134490889|gb|JAV34980.1| (putative allatostatin-a receptor [Culex tarsalis]) HSP 1 Score: 89.7373 bits (221), Expect = 7.615e-19 Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F W PI +IL+L+SL +YE T +++ QI+AH+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P + G + K + G G S Sbjct: 224 LAFAFCWCPIQVILVLKSLEMYEVTHVSIITQIVAHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGAP--PSLLIPQGPRTGETKTTRTGNGTS 317
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1060276924|ref|XP_017850147.1| (PREDICTED: allatostatin-A receptor-like [Drosophila busckii]) HSP 1 Score: 86.2705 bits (212), Expect = 8.528e-19 Identity = 42/96 (43.75%), Postives = 62/96 (64.58%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F + WLPIH+IL++++L++Y + +++ QII+H+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P V +M G G S Sbjct: 66 LAFAICWLPIHVILVMKALDMYGGSHLSVIIQIISHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGSP--PPIVTNQ--QMTKTTRTATGNGTS 157
BLAST of EMLSAG00000000789 vs. nr
Match: gi|907637410|ref|XP_013099793.1| (PREDICTED: allatostatin-A receptor [Stomoxys calcitrans]) HSP 1 Score: 90.5077 bits (223), Expect = 1.083e-18 Identity = 39/70 (55.71%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 L F + WLPIH+IL+L++LNLY ++ + + QIIAH+LAY+NSC+NPILYAFLS+ FR+ F ++ C P Sbjct: 315 LAFAICWLPIHVILVLKALNLYGTSNVTVIIQIIAHVLAYTNSCINPILYAFLSDNFRKAFRKIVWCCSP 384
BLAST of EMLSAG00000000789 vs. nr
Match: gi|1134490881|gb|JAV34976.1| (putative allatostatin-a receptor [Culex tarsalis]) HSP 1 Score: 89.7373 bits (221), Expect = 1.125e-18 Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = 0 Query: 33 LIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADIKHVKDGRGNS 128 L F W PI +IL+L+SL +YE T +++ QI+AH+LAY+NSC+NPILYAFLS+ FR+ F V+ C P P + G + K + G G S Sbjct: 256 LAFAFCWCPIQVILVLKSLEMYEVTHVSIITQIVAHVLAYTNSCINPILYAFLSDNFRKAFRKVVWCGAP--PSLLIPQGPRTGETKTTRTGNGTS 349
BLAST of EMLSAG00000000789 vs. nr
Match: gi|668448947|gb|KFB38427.1| (AGAP003658-PB-like protein [Anopheles sinensis]) HSP 1 Score: 83.5741 bits (205), Expect = 1.209e-18 Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 35 FTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAV 96 F W PI +ILLL+SL LYE T ++ FQI++H+LAY+NSC+NP+LYAFLS+ FR+ F V Sbjct: 9 FAFCWCPIQVILLLKSLKLYELTHASIIFQIVSHVLAYTNSCINPVLYAFLSDNFRKAFRKV 70
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold338_size202645-snap-gene-1.15 (protein:Tk00724 transcript:maker-scaffold338_size202645-snap-gene-1.15-mRNA-1 annotation:"allatostatin a receptor") HSP 1 Score: 155.992 bits (393), Expect = 6.313e-47 Identity = 73/110 (66.36%), Postives = 89/110 (80.91%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNGYEMADI-KHVKDGRGNSKCGEEKSKGDN 139 VV+IF LSWLPIHIIL++R + LY +TP+ +T QII+HILAYSNSCVNPILYA+LSEPFRRGFWAVITCI+PSGPHGV +NGYEM D+ H + KC ++ G+N Sbjct: 271 VVIIFALSWLPIHIILIMRGMKLYPNTPLTVTTQIISHILAYSNSCVNPILYAWLSEPFRRGFWAVITCIKPSGPHGVLQNGYEMGDVMPHGRQAGHAKKCAQK--NGNN 378
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-5.8 (protein:Tk03859 transcript:maker-scaffold20_size707684-snap-gene-5.8-mRNA-1 annotation:"af336364_1allatostatin receptor") HSP 1 Score: 66.6254 bits (161), Expect = 4.758e-14 Identity = 42/107 (39.25%), Postives = 56/107 (52.34%), Query Frame = 0 Query: 39 WLPIHIILLLRSLNLY-----ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI-TCIRP--SGPHGVHRNGYEMADIKHVKDGRGNSKCGEEKSKG 137 W PI +LL+++L +Y E P + FQI AH LAY NSCVNPILYAFLS+ FR+ F + C G G YE+ ++ D R +S +G Sbjct: 313 WAPIQFVLLMKALKVYNTKGPEDFP-RIIFQIFAHCLAYVNSCVNPILYAFLSDNFRKAFHQFLPDCCHKVMGGARGRPALQYELTTLR--ADRRNSSNLKRYGKRG 416
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold20_size707684-snap-gene-2.11 (protein:Tk03842 transcript:maker-scaffold20_size707684-snap-gene-2.11-mRNA-1 annotation:"neuropeptide gpcr a23") HSP 1 Score: 50.447 bits (119), Expect = 1.981e-8 Identity = 31/76 (40.79%), Postives = 41/76 (53.95%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRP 102 VV IF W+P I +L + +N Y +N+ F + H LA SNSC NP +Y SE FRR F + C+RP Sbjct: 411 VVSIFAFCWMPWQIYATTMLFIPQVNSYRY--INIIF-FVCHWLAMSNSCYNPFIYGVYSEKFRREFSIRLPCLRP 483
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold152_size304267-processed-gene-0.11 (protein:Tk10103 transcript:snap_masked-scaffold152_size304267-processed-gene-0.11-mRNA-1 annotation:"somatostatin receptor type 2") HSP 1 Score: 49.6766 bits (117), Expect = 3.662e-8 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 31 VVLIFTLSWLP--IHIILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 V+ ++ L WLP I + L+ + + + + ++A L+YSNS +NP+LYAFLSE F++ F TC Sbjct: 303 VITVYILCWLPYWITQLALIFTEPGHTQDNVMVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTC 373
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold763_size101323-snap-gene-0.15 (protein:Tk04717 transcript:maker-scaffold763_size101323-snap-gene-0.15-mRNA-1 annotation:"lymnokinin receptor") HSP 1 Score: 48.1358 bits (113), Expect = 1.582e-7 Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHI----ILLLRSLNLYESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITC 99 VV IF + WLP H+ +LL+ +N Y +N+ F +H LA NSC NP +YA SE F+R F C Sbjct: 376 VVVAIFGVCWLPWHLYQISVLLVPEINEYHY--INIIF-FFSHWLAMFNSCCNPFIYAIYSEKFKREFQQFAHC 446
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold272_size230267-processed-gene-1.9 (protein:Tk00260 transcript:snap_masked-scaffold272_size230267-processed-gene-1.9-mRNA-1 annotation:"retinal rod rhodopsin-sensitive cgmp 3 -cyclic phosphodiesterase subunit delta isoform x2") HSP 1 Score: 47.7506 bits (112), Expect = 1.756e-7 Identity = 27/85 (31.76%), Postives = 46/85 (54.12%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYESTPM-----NMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCI---RPSGPH 106 +V ++F LSWLP++ LL + P+ +TF I+ ++L +N+CVNP+LY + +E FR + + + RPS Sbjct: 319 SVTVVFFLSWLPLNTFRLLSEFGPAQLHPLLGGREELTFGIL-NLLGATNACVNPLLYGYFNENFRNEYKYIYRAMPWQRPSAAQ 402
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold567_size135338-snap-gene-0.22 (protein:Tk01951 transcript:maker-scaffold567_size135338-snap-gene-0.22-mRNA-1 annotation:"GK13031") HSP 1 Score: 46.9802 bits (110), Expect = 3.815e-7 Identity = 29/118 (24.58%), Postives = 59/118 (50.00%), Query Frame = 0 Query: 31 VVLIFTLSWLPIHII-LLLRSLNLY-ESTPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVITCIRPSGPHGVHRNG---YEMADIKHVKDGRG----NSKCGEEKSKGDN 139 + L+F + W P++++ +++ S +L+ E+ + + + H++ S++C+NPILY + +E R +I I P R+ E+ D+ HV R + CG+ D+ Sbjct: 298 ISLVFCVCWFPLNLLGVIIDSTDLFRENHQLMLCIFVACHLVGMSSACINPILYGYRNEGVRSEISHMIKRISFRTPTSRKRSQSKLLELQDLNHVAIKRNVSYFDEDCGQNADGRDS 415
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold941_size78300-snap-gene-0.19 (protein:Tk00817 transcript:maker-scaffold941_size78300-snap-gene-0.19-mRNA-1 annotation:"prolactin-releasing peptide receptor") HSP 1 Score: 45.8246 bits (107), Expect = 8.439e-7 Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 30 AVVLIFTLSWLPIHIILLLRSLNLYES---TPMNMTFQIIAHILAYSNSCVNPILYAFLSEPFRRGFWAVI 97 ++V+IF W P+++I L ++L+ + TF + HILA S++C NP LY +L+E FR F +I Sbjct: 264 SMVVIFGTCWFPLNVINFLADIDLFPIFCWEYYHFTF-FLCHILAMSSNCYNPFLYGWLNESFRGEFLKMI 333 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000789 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 6
BLAST of EMLSAG00000000789 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000789 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 8
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s112:585535..586017- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000789-683555 ID=EMLSAG00000000789-683555|Name=EMLSAG00000000789|organism=Lepeophtheirus salmonis|type=gene|length=483bp|location=Sequence derived from alignment at LSalAtl2s112:585535..586017- (Lepeophtheirus salmonis)back to top Add to Basket
|