EMLSAG00000000877, EMLSAG00000000877-683643 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592816126|gb|GAXK01138442.1| (TSA: Calanus finmarchicus comp103777_c1_seq1 transcribed RNA sequence) HSP 1 Score: 37.7354 bits (86), Expect = 2.317e-3 Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 0 Query: 6 LLESFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKP--LLDRTQNLKEVAIKFRKTIPFVVQILCTVSLSKQD 77 LLE I QL E LS STA TL V + + + KP L+D + K A F KT V+Q++ ++ + D Sbjct: 743 LLEPSIPQLCECLSQQSTAPPTLQV---LQDIAITKPKCLVDHISSFKLTAANFPKTTVSVIQLMSIIAKNSAD 955
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592893479|gb|GAXK01064896.1| (TSA: Calanus finmarchicus comp5191047_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 9.149e-1 Identity = 15/34 (44.12%), Postives = 20/34 (58.82%), Query Frame = 0 Query: 9 SFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKP 42 SF S LSE LS+ + F LH F +S K+ +P Sbjct: 64 SFCSNLSENLSFFNCCTFNLHFFSLSLSFKI-RP 162
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592820580|gb|GAXK01133988.1| (TSA: Calanus finmarchicus comp3337668_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.501e+0 Identity = 15/40 (37.50%), Postives = 25/40 (62.50%), Query Frame = 0 Query: 27 TLHVFYKMMSVKVCKPLLDRTQNLKEVAIKFRKTIPFVVQ 66 TLHV + ++SVKV ++ NL ++IK R T P +++ Sbjct: 488 TLHVIFSVISVKV-----SQSANLFPISIKARTTFPSILR 592
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592832388|gb|GAXK01125156.1| (TSA: Calanus finmarchicus comp25224_c7_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.701e+0 Identity = 13/34 (38.24%), Postives = 21/34 (61.76%), Query Frame = 0 Query: 17 ELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNL 50 +L +SST T H+F+K +V+ +PL R + L Sbjct: 768 QLKFSSTTQSTHHIFFKPHTVRAEEPLKPRDRTL 869
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592832415|gb|GAXK01125129.1| (TSA: Calanus finmarchicus comp25224_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.909e+0 Identity = 13/34 (38.24%), Postives = 21/34 (61.76%), Query Frame = 0 Query: 17 ELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNL 50 +L +SST T H+F+K +V+ +PL R + L Sbjct: 60 QLKFSSTTQSTHHIFFKPHTVRAEEPLKPRDRTL 161
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592951314|gb|GAXK01007239.1| (TSA: Calanus finmarchicus comp2743286_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.410e+0 Identity = 22/71 (30.99%), Postives = 28/71 (39.44%), Query Frame = 0 Query: 9 SFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNLKEVAIKFRKTIPFVVQILCTVSLSKQDIY 79 S Q S E+ Y+ L VF V VC P+ D T ILCT +LS QD++ Sbjct: 381 SIPKQASNEMDYN----IKLQVFEVAFDVMVCDPIPDST----------------FEYILCTSALSSQDLH 533
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592820185|gb|GAXK01134383.1| (TSA: Calanus finmarchicus comp92866_c1_seq2 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.915e+0 Identity = 11/30 (36.67%), Postives = 19/30 (63.33%), Query Frame = 0 Query: 49 NLKEVAIKFRKTIPFVVQILCTVSLSKQDI 78 LK++ I+FR+ IP ++ CT+ KQ + Sbjct: 554 RLKKIHIQFRRQIPVATKLPCTIQTLKQKM 643
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Match: gi|592820186|gb|GAXK01134382.1| (TSA: Calanus finmarchicus comp92866_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.916e+0 Identity = 11/30 (36.67%), Postives = 19/30 (63.33%), Query Frame = 0 Query: 49 NLKEVAIKFRKTIPFVVQILCTVSLSKQDI 78 LK++ I+FR+ IP ++ CT+ KQ + Sbjct: 567 RLKKIHIQFRRQIPVATKLPCTIQTLKQKM 656
BLAST of EMLSAG00000000877 vs. L. salmonis peptides
Match: EMLSAP00000000877 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1152:53968:54513:-1 gene:EMLSAG00000000877 transcript:EMLSAT00000000877 description:"maker-LSalAtl2s1152-snap-gene-0.24") HSP 1 Score: 161.77 bits (408), Expect = 6.463e-53 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0 Query: 1 MFSSKLLESFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNLKEVAIKFRKTIPFVVQILCTVSLSKQDIYLR 81 MFSSKLLESFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNLKEVAIKFRKTIPFVVQILCTVSLSKQDIYLR Sbjct: 1 MFSSKLLESFISQLSEELSYSSTAVFTLHVFYKMMSVKVCKPLLDRTQNLKEVAIKFRKTIPFVVQILCTVSLSKQDIYLR 81 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000877 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000877 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000000877 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000877 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000877 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000877 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000877 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1152:53968..54513- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000877-683643 ID=EMLSAG00000000877-683643|Name=EMLSAG00000000877|organism=Lepeophtheirus salmonis|type=gene|length=546bp|location=Sequence derived from alignment at LSalAtl2s1152:53968..54513- (Lepeophtheirus salmonis)back to top Add to Basket
|