EMLSAG00000000920, EMLSAG00000000920-683686 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592789954|gb|GAXK01164614.1| (TSA: Calanus finmarchicus comp599222_c1_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 1.555e-1 Identity = 14/35 (40.00%), Postives = 21/35 (60.00%), Query Frame = 0 Query: 21 CHQIPGVGSFPFFIKTPVD--NAHVEKSVENVHAQ 53 H +PG GS PF ++PVD NA ++ +HA+ Sbjct: 1042 SHNLPGRGSLPFIDQSPVDSINAPTFATISAIHAR 1146
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592757686|gb|GAXK01196727.1| (TSA: Calanus finmarchicus comp249481_c0_seq6 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 1.645e-1 Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 34 IKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSS 78 + P DNA +K+VEN + +V D IK++ + + +E VS+ Sbjct: 422 VNIPTDNAPADKAVENSESLVVSSDDLNIKEIIKNDEKFIESVSA 556
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592757691|gb|GAXK01196722.1| (TSA: Calanus finmarchicus comp249481_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 1.717e-1 Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 34 IKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSS 78 + P DNA +K+VEN + +V D IK++ + + +E VS+ Sbjct: 422 VNIPTDNAPADKAVENSESLVVSSDDLNIKEIIKNDEKFIESVSA 556
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592757685|gb|GAXK01196728.1| (TSA: Calanus finmarchicus comp249481_c0_seq7 transcribed RNA sequence) HSP 1 Score: 32.3426 bits (72), Expect = 1.789e-1 Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 34 IKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSS 78 + P DNA +K+VEN + +V D IK++ + + +E VS+ Sbjct: 422 VNIPTDNAPADKAVENSESLVVSSDDLNIKEIIKNDEKFIESVSA 556
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592757690|gb|GAXK01196723.1| (TSA: Calanus finmarchicus comp249481_c0_seq2 transcribed RNA sequence) HSP 1 Score: 32.3426 bits (72), Expect = 1.870e-1 Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 34 IKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSS 78 + P DNA +K+VEN + +V D IK++ + + +E VS+ Sbjct: 422 VNIPTDNAPADKAVENSESLVVSSDDLNIKEIIKNDEKFIESVSA 556
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592928291|gb|GAXK01030209.1| (TSA: Calanus finmarchicus comp210975_c2_seq2 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.930e+0 Identity = 17/63 (26.98%), Postives = 32/63 (50.79%), Query Frame = 0 Query: 5 LKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQIV---LVPDAKIKK 64 L+ C +Q K+QRC ++ G G F+K P +++ +EN I ++ + +I+K Sbjct: 92 LRCCSSNRDQ--KVQRCFEVNGFGGVN-FLKNPCKYLDMDEIIENNAESIENNRMIDEQRIEK 271
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592928292|gb|GAXK01030208.1| (TSA: Calanus finmarchicus comp210975_c2_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.884e+0 Identity = 17/63 (26.98%), Postives = 32/63 (50.79%), Query Frame = 0 Query: 5 LKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQIV---LVPDAKIKK 64 L+ C +Q K+QRC ++ G G F+K P +++ +EN I ++ + +I+K Sbjct: 135 LRCCSSNRDQ--KVQRCFEVNGFGGVN-FLKNPCKYLDMDEIIENNAESIENNRMIDEQRIEK 314
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Match: gi|592928293|gb|GAXK01030207.1| (TSA: Calanus finmarchicus comp210975_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 5.718e+0 Identity = 15/50 (30.00%), Postives = 25/50 (50.00%), Query Frame = 0 Query: 5 LKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQI 54 L+ C +Q K+QRC ++ G G F+K P +++ +EN I Sbjct: 141 LRCCSSNRDQ--KVQRCFEVNGFGGVN-FLKNPCKYLDMDEIIENNAESI 281
BLAST of EMLSAG00000000920 vs. L. salmonis peptides
Match: EMLSAP00000000920 (pep:novel supercontig:LSalAtl2s:LSalAtl2s115:757843:760876:-1 gene:EMLSAG00000000920 transcript:EMLSAT00000000920 description:"maker-LSalAtl2s115-snap-gene-7.15") HSP 1 Score: 210.69 bits (535), Expect = 1.738e-71 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0 Query: 1 MFGKLKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSSNTIPMFLKRVQTSLQIFNGCFPKS 102 MFGKLKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSSNTIPMFLKRVQTSLQIFNGCFPKS Sbjct: 1 MFGKLKSCPQKVEQYFKIQRCHQIPGVGSFPFFIKTPVDNAHVEKSVENVHAQIVLVPDAKIKKLSRETTRLVEYVSSNTIPMFLKRVQTSLQIFNGCFPKS 102 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000920 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000920 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000000920 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000920 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000920 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000920 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000920 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s115:757843..760876- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000920-683686 ID=EMLSAG00000000920-683686|Name=EMLSAG00000000920|organism=Lepeophtheirus salmonis|type=gene|length=3034bp|location=Sequence derived from alignment at LSalAtl2s115:757843..760876- (Lepeophtheirus salmonis)back to top Add to Basket
|