EMLSAG00000001035, EMLSAG00000001035-683801 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001035 vs. C. finmarchicus
Match: gi|592820743|gb|GAXK01133825.1| (TSA: Calanus finmarchicus comp7380391_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.176e+0 Identity = 11/22 (50.00%), Postives = 13/22 (59.09%), Query Frame = 0 Query: 9 FHTSCIYTILSSMNRTGNDPFQ 30 F CIYT+ S + GN PFQ Sbjct: 188 FSLFCIYTVQSLVTEKGNGPFQ 253
BLAST of EMLSAG00000001035 vs. C. finmarchicus
Match: gi|592929470|gb|GAXK01029075.1| (TSA: Calanus finmarchicus comp6285908_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 6.052e+0 Identity = 17/59 (28.81%), Postives = 24/59 (40.68%), Query Frame = 0 Query: 8 NFHTSCIYTILSSMNRTGNDPFQIFQDGM--------KRKSKSVAPIVIPIVYRPRGMS 58 +FHTSC +L TG++P + M KR S + P + PR S Sbjct: 21 HFHTSCSQRLLKKNLPTGHEPLHAVSNKMLSASQIQVKRSSVQIPPTLT*YSLHPRQRS 197
BLAST of EMLSAG00000001035 vs. L. salmonis peptides
Match: EMLSAP00000001035 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1171:186125:186684:-1 gene:EMLSAG00000001035 transcript:EMLSAT00000001035 description:"maker-LSalAtl2s1171-augustus-gene-1.32") HSP 1 Score: 172.555 bits (436), Expect = 5.232e-57 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0 Query: 1 MIKTLVSNFHTSCIYTILSSMNRTGNDPFQIFQDGMKRKSKSVAPIVIPIVYRPRGMSSRLDEIVSRNLFTSSRIHGVCRDLLR 84 MIKTLVSNFHTSCIYTILSSMNRTGNDPFQIFQDGMKRKSKSVAPIVIPIVYRPRGMSSRLDEIVSRNLFTSSRIHGVCRDLLR Sbjct: 1 MIKTLVSNFHTSCIYTILSSMNRTGNDPFQIFQDGMKRKSKSVAPIVIPIVYRPRGMSSRLDEIVSRNLFTSSRIHGVCRDLLR 84 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001035 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001035 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000001035 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001035 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001035 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001035 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001035 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1171:186125..186684- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001035-683801 ID=EMLSAG00000001035-683801|Name=EMLSAG00000001035|organism=Lepeophtheirus salmonis|type=gene|length=560bp|location=Sequence derived from alignment at LSalAtl2s1171:186125..186684- (Lepeophtheirus salmonis)back to top Add to Basket
|