EMLSAG00000001066, EMLSAG00000001066-683832 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001066 vs. GO
Match: - (symbol:bt "bent" species:7227 "Drosophila melanogaster" [GO:0005737 "cytoplasm" evidence=ISS] [GO:0004687 "myosin light chain kinase activity" evidence=NAS] [GO:0005200 "structural constituent of cytoskeleton" evidence=ISS] [GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;NAS] [GO:0006468 "protein phosphorylation" evidence=IEA;NAS] [GO:0007498 "mesoderm development" evidence=IEP] [GO:0005524 "ATP binding" evidence=IEA] [GO:0008307 "structural constituent of muscle" evidence=IDA] [GO:0030018 "Z disc" evidence=IDA] [GO:0045214 "sarcomere organization" evidence=IMP] InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR003961 InterPro:IPR007110 InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00041 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011 PROSITE:PS50835 PROSITE:PS50853 SMART:SM00060 SMART:SM00220 GO:GO:0005524 Gene3D:2.60.40.10 InterPro:IPR013783 GO:GO:0030018 GO:GO:0007498 SUPFAM:SSF49265 SUPFAM:SSF56112 GO:GO:0004674 InterPro:IPR003599 SMART:SM00409 InterPro:IPR003598 SMART:SM00408 GO:GO:0045214 GO:GO:0008307 InterPro:IPR013098 Pfam:PF07679 EMBL:AE014135 OrthoDB:EOG72C4ZC GeneTree:ENSGT00720000108588 GO:GO:0004687 OMA:GCKLKWK RefSeq:NP_001162825.1 UniGene:Dm.4645 ProteinModelPortal:D1YSG0 SMR:D1YSG0 EnsemblMetazoa:FBtr0301340 GeneID:43814 KEGG:dme:Dmel_CG32019 CTD:43814 FlyBase:FBgn0005666 SignaLink:D1YSG0 GenomeRNAi:43814 NextBio:836022 PRO:PR:D1YSG0 Bgee:D1YSG0 Uniprot:D1YSG0) HSP 1 Score: 42.743 bits (99), Expect = 2.423e-4 Identity = 21/47 (44.68%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 43 QDTGIYTIRLTCESGTFEASGKVNVLDVPLVP-RSLQPDEVHAEHVK 88 +DTG Y + L+ SGT E+ +V VLD PL P +P+E+ A H+K Sbjct: 2371 KDTGKYKLVLSNSSGTIESEAQVVVLDRPLPPGGPFEPEEIRASHIK 2417
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890593|gb|GAXK01067782.1| (TSA: Calanus finmarchicus comp17337_c10_seq3 transcribed RNA sequence) HSP 1 Score: 34.6538 bits (78), Expect = 2.322e-2 Identity = 18/38 (47.37%), Postives = 24/38 (63.16%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPR 75 K + DTG Y I+LT G+ +AS KVNV+D P P+ Sbjct: 3073 KKAKRTDTGTYNIQLTNTEGSDQASCKVNVVDRPSPPQ 3186
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890594|gb|GAXK01067781.1| (TSA: Calanus finmarchicus comp17337_c10_seq2 transcribed RNA sequence) HSP 1 Score: 34.6538 bits (78), Expect = 2.325e-2 Identity = 18/38 (47.37%), Postives = 24/38 (63.16%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPR 75 K + DTG Y I+LT G+ +AS KVNV+D P P+ Sbjct: 3135 KKAKRTDTGTYNIQLTNTEGSDQASCKVNVVDRPSPPQ 3248
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890666|gb|GAXK01067709.1| (TSA: Calanus finmarchicus comp17337_c9_seq6 transcribed RNA sequence) HSP 1 Score: 34.6538 bits (78), Expect = 2.450e-2 Identity = 18/38 (47.37%), Postives = 24/38 (63.16%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPR 75 K + DTG Y I+LT G+ +AS KVNV+D P P+ Sbjct: 265 KKAKRTDTGTYNIQLTNTEGSDQASCKVNVVDRPSPPQ 378
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890670|gb|GAXK01067705.1| (TSA: Calanus finmarchicus comp17337_c9_seq2 transcribed RNA sequence) HSP 1 Score: 34.6538 bits (78), Expect = 2.479e-2 Identity = 18/38 (47.37%), Postives = 24/38 (63.16%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPR 75 K + DTG Y I+LT G+ +AS KVNV+D P P+ Sbjct: 265 KKAKRTDTGTYNIQLTNTEGSDQASCKVNVVDRPSPPQ 378
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890581|gb|GAXK01067794.1| (TSA: Calanus finmarchicus comp17337_c10_seq15 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.150e-1 Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = 0 Query: 12 KLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS 76 K ++ +S+ H + + T + A+ + D G+YT+ ++ E GT A V VLD P P + Sbjct: 1107 KNKVVYSDEHYDVMVQRRQTVIDIAFS--KRYDAGVYTLEVSNELGTATARANVTVLDRPAPPEA 1295 HSP 2 Score: 27.7202 bits (60), Expect = 4.751e+0 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVP 74 + DTG I+L ESG+ + N+LDVP P Sbjct: 231 KRSDTGDIVIKLVNESGSDKGGFYFNILDVPGPP 332
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890576|gb|GAXK01067799.1| (TSA: Calanus finmarchicus comp17337_c10_seq20 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.179e-1 Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = 0 Query: 12 KLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS 76 K ++ +S+ H + + T + A+ + D G+YT+ ++ E GT A V VLD P P + Sbjct: 904 KNKVVYSDEHYDVMVQRRQTVIDIAFS--KRYDAGVYTLEVSNELGTATARANVTVLDRPAPPEA 1092 HSP 2 Score: 27.7202 bits (60), Expect = 4.946e+0 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVP 74 + DTG I+L ESG+ + N+LDVP P Sbjct: 28 KRSDTGDIVIKLVNESGSDKGGFYFNILDVPGPP 129
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890648|gb|GAXK01067727.1| (TSA: Calanus finmarchicus comp17337_c9_seq24 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 2.377e-1 Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = 0 Query: 12 KLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS 76 K ++ +S+ H + + T + A+ + D G+YT+ ++ E GT A V VLD P P + Sbjct: 466 KNKVVYSDEHYDVMVQRRQTVIDIAFS--KRYDAGVYTLEVSNELGTATARANVTVLDRPAPPEA 654 HSP 2 Score: 27.7202 bits (60), Expect = 5.185e+0 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVP 74 + DTG I+L ESG+ + N+LDVP P Sbjct: 1429 KRSDTGDIVIKLVNESGSDKGGFYFNILDVPGPP 1530
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890651|gb|GAXK01067724.1| (TSA: Calanus finmarchicus comp17337_c9_seq21 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 3.095e-1 Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = 0 Query: 12 KLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS 76 K ++ +S+ H + + T + A+ + D G+YT+ ++ E GT A V VLD P P + Sbjct: 926 KNKVVYSDEHYDVMVQRRQTVIDIAFS--KRYDAGVYTLEVSNELGTATARANVTVLDRPAPPEA 1114 HSP 2 Score: 29.261 bits (64), Expect = 1.606e+0 Identity = 15/48 (31.25%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS-LQPDEVHAEHV 87 + DTG+Y + ++GT + V VLDVP P + + P E+ +++ Sbjct: 122 KRSDTGVYKLVAKNKNGTDTMTCNVTVLDVPGPPEAPVDPKEIRKDYM 265 HSP 3 Score: 27.7202 bits (60), Expect = 6.156e+0 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVP 74 + DTG I+L ESG+ + N+LDVP P Sbjct: 1889 KRSDTGDIVIKLVNESGSDKGGFYFNILDVPGPP 1990
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592890661|gb|GAXK01067714.1| (TSA: Calanus finmarchicus comp17337_c9_seq11 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 3.255e-1 Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = 0 Query: 12 KLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS 76 K ++ +S+ H + + T + A+ + D G+YT+ ++ E GT A V VLD P P + Sbjct: 2441 KNKVVYSDEHYDVMVQRRQTVIDIAFS--KRYDAGVYTLEVSNELGTATARANVTVLDRPAPPEA 2629 HSP 2 Score: 29.261 bits (64), Expect = 1.677e+0 Identity = 15/48 (31.25%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRS-LQPDEVHAEHV 87 + DTG+Y + ++GT + V VLDVP P + + P E+ +++ Sbjct: 1637 KRSDTGVYKLVAKNKNGTDTMTCNVTVLDVPGPPEAPVDPKEIRKDYM 1780 HSP 3 Score: 27.7202 bits (60), Expect = 6.412e+0 Identity = 14/34 (41.18%), Postives = 19/34 (55.88%), Query Frame = 0 Query: 41 RDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVP 74 + DTG I+L ESG+ + N+LDVP P Sbjct: 3404 KRSDTGDIVIKLVNESGSDKGGFYFNILDVPGPP 3505
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Match: gi|592772905|gb|GAXK01181663.1| (TSA: Calanus finmarchicus comp129544_c2_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 4.441e-1 Identity = 14/34 (41.18%), Postives = 20/34 (58.82%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVP 71 KA D G+Y +RL ESG FE++ V++ P Sbjct: 3081 KAMEDNHGGVYKLRLKNESGVFESAANVDIDGPP 3182 HSP 2 Score: 28.8758 bits (63), Expect = 1.898e+0 Identity = 14/44 (31.82%), Postives = 24/44 (54.55%), Query Frame = 0 Query: 44 DTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHV 87 ++GIY + ++ + G+ E V VLD+P P S+ E + V Sbjct: 2157 NSGIYKVTISNDQGSCEIDVPVEVLDIPSPPLSVSVKEFTKDSV 2288
BLAST of EMLSAG00000001066 vs. L. salmonis peptides
Match: EMLSAP00000001066 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1177:93902:94514:-1 gene:EMLSAG00000001066 transcript:EMLSAT00000001066 description:"maker-LSalAtl2s1177-snap-gene-0.7") HSP 1 Score: 184.111 bits (466), Expect = 2.134e-61 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0 Query: 1 MEGQTSKNTLSKLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHVK 88 MEGQTSKNTLSKLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHVK Sbjct: 1 MEGQTSKNTLSKLRIQHSETHTGLKSVQNATGSERAYKADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHVK 88
BLAST of EMLSAG00000001066 vs. L. salmonis peptides
Match: EMLSAP00000000141 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1021:93859:109614:1 gene:EMLSAG00000000141 transcript:EMLSAT00000000141 description:"maker-LSalAtl2s1021-augustus-gene-0.30") HSP 1 Score: 68.9366 bits (167), Expect = 9.702e-15 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHV 87 KA+R DTG YTI+L C+ GT +A+G VNVLDVP PR L PDE+ AEH+ Sbjct: 897 KANRSIDTGHYTIKLLCDGGTQQATGYVNVLDVPEKPRXLNPDEIRAEHI 946
BLAST of EMLSAG00000001066 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold17_size721972-snap-gene-1.18 (protein:Tk09953 transcript:maker-scaffold17_size721972-snap-gene-1.18-mRNA-1 annotation:"LD10678p") HSP 1 Score: 80.1073 bits (196), Expect = 1.467e-19 Identity = 37/51 (72.55%), Postives = 44/51 (86.27%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHVK 88 +ADR +DTG+YTI+LTCE+GTFEASG+VNVLDVP R L PDEV AEH+K Sbjct: 925 RADRVRDTGLYTIKLTCEAGTFEASGRVNVLDVPTKCRQLVPDEVRAEHIK 975
BLAST of EMLSAG00000001066 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold175_size286436-snap-gene-1.47 (protein:Tk09286 transcript:maker-scaffold175_size286436-snap-gene-1.47-mRNA-1 annotation:"GK13703") HSP 1 Score: 76.2554 bits (186), Expect = 3.769e-18 Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 0 Query: 38 KADRDQDTGIYTIRLTCESGTFEASGKVNVLDVPLVPRSLQPDEVHAEHVK 88 KA+R D G Y IRL CE GTFEA+G VNVLDVP PRSL+PDE+ AEHVK Sbjct: 426 KAERAVDAGHYKIRLVCEGGTFEATGYVNVLDVPEKPRSLRPDEIRAEHVK 476 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001066 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 1
BLAST of EMLSAG00000001066 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001066 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000001066 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001066 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001066 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001066 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 2
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1177:93902..94514- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001066-683832 ID=EMLSAG00000001066-683832|Name=EMLSAG00000001066|organism=Lepeophtheirus salmonis|type=gene|length=613bp|location=Sequence derived from alignment at LSalAtl2s1177:93902..94514- (Lepeophtheirus salmonis)back to top Add to Basket
|