EMLSAG00000001081, EMLSAG00000001081-683847 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592794601|gb|GAXK01159967.1| (TSA: Calanus finmarchicus comp629736_c0_seq2 transcribed RNA sequence) HSP 1 Score: 46.595 bits (109), Expect = 3.567e-7 Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 0 Query: 3 RFMVLLLVVGLVYSEAKPWI-QGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSC 71 R LL + L A W L +P+EVD + I+ P++C V+Y P+TCGE F++ SL C Sbjct: 29 RLESLLCFISLA-GIASAWTPSDAALDIPQEVDVDQRIRPDPNNCNVYYYLKVPLTCGEGNAFNKASLRC 235
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592794602|gb|GAXK01159966.1| (TSA: Calanus finmarchicus comp629736_c0_seq1 transcribed RNA sequence) HSP 1 Score: 46.595 bits (109), Expect = 3.742e-7 Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 0 Query: 3 RFMVLLLVVGLVYSEAKPWI-QGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSC 71 R LL + L A W L +P+EVD + I+ P++C V+Y P+TCGE F++ SL C Sbjct: 29 RLESLLCFISLA-GIASAWTPSDAALDIPQEVDVDQRIRPDPNNCNVYYYLKVPLTCGEGNAFNKASLRC 235
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592937709|gb|GAXK01020844.1| (TSA: Calanus finmarchicus comp13199_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 2.846e-2 Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 0 Query: 40 QAHPDDCKVFYV------YNYPMTCGEELVFSQESLSCVPKEKRPEC 80 AHP DC FYV YN +C + LVFS+E +C+ E+ P C Sbjct: 775 HAHPTDCGKFYVCLPNGTYNK-ASCDKPLVFSEEKGACLEAEEVPGC 912
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592930242|gb|GAXK01028303.1| (TSA: Calanus finmarchicus comp5791123_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 3.837e-1 Identity = 10/28 (35.71%), Postives = 18/28 (64.29%), Query Frame = 0 Query: 17 EAKPWIQGVDLSLPREVDPENPIQAHPD 44 + KP + +L+ P++ P NPIQ +P+ Sbjct: 340 QNKPNLSKTNLTYPKQTKPSNPIQTYPN 423
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592857532|gb|GAXK01100030.1| (TSA: Calanus finmarchicus comp6832_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 5.361e-1 Identity = 21/78 (26.92%), Postives = 35/78 (44.87%), Query Frame = 0 Query: 9 LVVGLVYSEAKPW-IQGVDLSLPREVDPENPIQAHPDDCKVFYVYNY-----PMTCGEELVFSQESLSCVPKEKRPEC 80 L G V++E + G D+ P+ + +PI HP DC+ ++ + C VF + + C P E+ EC Sbjct: 474 LCEGSVFNEIDGFSCPGGDIVGPQNLLQAHPIHPHPTDCQYYFSCYHNKEPNKFGCSTGNVFDRLTQVCKPAEEVAEC 707
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592912759|gb|GAXK01045616.1| (TSA: Calanus finmarchicus comp735260_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.381e+0 Identity = 24/65 (36.92%), Postives = 32/65 (49.23%), Query Frame = 0 Query: 19 KPWIQGVD---LSLPREVDP-ENPIQAHPDDCKVFYV----YNYPMTCGEELVFSQESLSCVPKE 75 +P Q D S P EV P E+P P DC+ FYV + +C E LVF +L+C +E Sbjct: 531 RPGCQSKDKFEFSCP-EVGPSEHPRYPDPADCQKFYVCISGSAHHSSCNEGLVFHPLTLACDRQE 722
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592912760|gb|GAXK01045615.1| (TSA: Calanus finmarchicus comp735260_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.586e+0 Identity = 24/65 (36.92%), Postives = 32/65 (49.23%), Query Frame = 0 Query: 19 KPWIQGVD---LSLPREVDP-ENPIQAHPDDCKVFYV----YNYPMTCGEELVFSQESLSCVPKE 75 +P Q D S P EV P E+P P DC+ FYV + +C E LVF +L+C +E Sbjct: 531 RPGCQSKDKFEFSCP-EVGPSEHPRYPDPADCQKFYVCISGSAHHSSCNEGLVFHPLTLACDRQE 722
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592937708|gb|GAXK01020845.1| (TSA: Calanus finmarchicus comp13199_c0_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.967e+0 Identity = 17/47 (36.17%), Postives = 23/47 (48.94%), Query Frame = 0 Query: 40 QAHPDDCKVFYV------YNYPMTCGEELVFSQESLSCVPKEKRPEC 80 A P DC FYV YN +C + VFS++ +C+ E P C Sbjct: 772 HADPKDCGKFYVCLPNGTYNK-ASCDKPRVFSEDKGACLEAEDVPGC 909
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592932207|gb|GAXK01026346.1| (TSA: Calanus finmarchicus comp19022_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 7.984e+0 Identity = 15/45 (33.33%), Postives = 22/45 (48.89%), Query Frame = 0 Query: 41 AHPDDCKVFYVYN----YPMTCGEELVFSQESLSCVPKEKRPECA 81 A P+DC VF+ C L FSQ++ C+ + PEC+ Sbjct: 342 ADPEDCGVFWNCQDGKANRYECPPGLAFSQDTHGCLWASEVPECS 476
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Match: gi|592935380|gb|GAXK01023173.1| (TSA: Calanus finmarchicus comp115025_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 8.512e+0 Identity = 20/75 (26.67%), Postives = 33/75 (44.00%), Query Frame = 0 Query: 1 MYRFMVLLLVVGLVYSEAKPWIQGVDLSLPREVDPENPIQAHPDDCKVFY--VYNYPM--TCGEELVFSQESLSC 71 M F ++ + GL+ K D P E HP+DC ++Y V+ P+ +C LV+S + +C Sbjct: 1573 MSPFFIIFALFGLLPGNIK-----TDFRCPEEFG----YYQHPEDCSLYYVCVFGGPLLESCTGGLVYSHDLQTC 1770
BLAST of EMLSAG00000001081 vs. L. salmonis peptides
Match: EMLSAP00000001081 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:715360:716166:1 gene:EMLSAG00000001081 transcript:EMLSAT00000001081 description:"maker-LSalAtl2s117-augustus-gene-7.26") HSP 1 Score: 168.703 bits (426), Expect = 1.301e-55 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0 Query: 1 MYRFMVLLLVVGLVYSEAKPWIQGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSCVPKEKRPECA 81 MYRFMVLLLVVGLVYSEAKPWIQGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSCVPKEKRPECA Sbjct: 1 MYRFMVLLLVVGLVYSEAKPWIQGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSCVPKEKRPECA 81
BLAST of EMLSAG00000001081 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold556_size137522-snap-gene-0.33 (protein:Tk02036 transcript:maker-scaffold556_size137522-snap-gene-0.33-mRNA-1 annotation:"PREDICTED: hemocytin-like") HSP 1 Score: 109.768 bits (273), Expect = 1.513e-33 Identity = 51/85 (60.00%), Postives = 65/85 (76.47%), Query Frame = 0 Query: 2 YRFMVLLLVVGLVYSE--AKPWIQGVDLSLPREVDPENPIQAHPDDCKVFYVYNYPMTCGEELVFSQESLSCVPK---EKRPECA 81 + + +L + L+ ++ AKPWIQGV+L LPREVDPE+PI AHPDDC VFY+YNYPMTCGEELVF+ ++L+C P RPECA Sbjct: 10 FLTLTFILALSLITTQIQAKPWIQGVELDLPREVDPESPIVAHPDDCHVFYMYNYPMTCGEELVFNPDTLACEPAANVSSRPECA 94 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001081 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001081 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 12
Pagesback to top
BLAST of EMLSAG00000001081 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001081 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001081 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001081 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001081 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s117:715360..716166+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001081-683847 ID=EMLSAG00000001081-683847|Name=EMLSAG00000001081|organism=Lepeophtheirus salmonis|type=gene|length=807bp|location=Sequence derived from alignment at LSalAtl2s117:715360..716166+ (Lepeophtheirus salmonis)back to top Add to Basket
|