EMLSAG00000001201, EMLSAG00000001201-683967 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:CG34127 species:7227 "Drosophila melanogaster" [GO:0042043 "neurexin family protein binding" evidence=ISS;IBA] [GO:0052689 "carboxylic ester hydrolase activity" evidence=IKR;NAS] [GO:0006909 "phagocytosis" evidence=IMP] [GO:0022008 "neurogenesis" evidence=IMP] [GO:0009986 "cell surface" evidence=IBA] [GO:0045202 "synapse" evidence=IBA] [GO:0005887 "integral component of plasma membrane" evidence=IBA] [GO:0007416 "synapse assembly" evidence=IBA] [GO:0004872 "receptor activity" evidence=IBA] Pfam:PF00135 EMBL:AE014297 GO:GO:0009986 GO:GO:0005887 GO:GO:0022008 GO:GO:0006909 GO:GO:0008152 GO:GO:0045202 GO:GO:0004872 GeneTree:ENSGT00740000115241 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 GO:GO:0007416 GO:GO:0052689 GO:GO:0042043 OrthoDB:EOG7HF1HM RefSeq:NP_001036685.2 RefSeq:NP_731170.2 UniGene:Dm.17109 ProteinModelPortal:Q9VIC6 SMR:Q9VIC6 EnsemblMetazoa:FBtr0301072 EnsemblMetazoa:FBtr0333927 GeneID:40912 KEGG:dme:Dmel_CG34127 UCSC:CG34127-RA FlyBase:FBgn0083963 InParanoid:Q9VIC6 OMA:LENIVLM PhylomeDB:Q9VIC6 ChiTaRS:CG34127 GenomeRNAi:40912 NextBio:821244 PRO:PR:Q9VIC6 Bgee:Q9VIC6 Uniprot:Q9VIC6) HSP 1 Score: 52.373 bits (124), Expect = 1.394e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 PVL+F+HG+SY W SGN YD SVLA+YG+ Sbjct: 317 PVLVFVHGESYEWNSGNPYDGSVLASYGQ 345
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:nlgn2a "neuroligin 2a" species:7955 "Danio rerio" [GO:0016020 "membrane" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 ZFIN:ZDB-GENE-090918-2 GO:GO:0016020 GO:GO:0007155 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 OrthoDB:EOG7RBZ7R EMBL:BX005336 KO:K07378 TreeFam:TF326187 GeneTree:ENSGT00690000101920 OMA:DIRDPGK EMBL:CR352341 EMBL:CR381592 RefSeq:XP_005172271.1 UniGene:Dr.158875 Ensembl:ENSDART00000125284 GeneID:556158 KEGG:dre:556158 CTD:556158 Bgee:F1QJV3 Uniprot:F1QJV3) HSP 1 Score: 51.2174 bits (121), Expect = 3.054e-7 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LFIHG SY G+GN++DASVLAAYG Sbjct: 183 KPVMLFIHGGSYMEGTGNMFDASVLAAYG 211
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:Nlg4 "Neuroligin 4" species:7227 "Drosophila melanogaster" [GO:0042043 "neurexin family protein binding" evidence=ISS;IBA] [GO:0052689 "carboxylic ester hydrolase activity" evidence=IKR;NAS] [GO:0005887 "integral component of plasma membrane" evidence=IBA] [GO:0045202 "synapse" evidence=IBA] [GO:0007416 "synapse assembly" evidence=IBA] [GO:0009986 "cell surface" evidence=IBA] [GO:0004872 "receptor activity" evidence=IBA] [GO:0030431 "sleep" evidence=IMP] [GO:0051932 "synaptic transmission, GABAergic" evidence=IDA] Pfam:PF00135 EMBL:AE014297 GO:GO:0009986 GO:GO:0005887 GO:GO:0008152 GO:GO:0030431 GO:GO:0045202 GO:GO:0004872 eggNOG:COG2272 GeneTree:ENSGT00740000115241 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 GO:GO:0007416 GO:GO:0052689 GO:GO:0051932 KO:K01044 GO:GO:0042043 EMBL:BT050584 RefSeq:NP_001163662.1 UniGene:Dm.5097 SMR:B6IDZ4 EnsemblMetazoa:FBtr0301680 GeneID:42402 KEGG:dme:Dmel_CG34139 FlyBase:FBgn0083975 OMA:HCAGAST OrthoDB:EOG7HF1HM GenomeRNAi:42402 NextBio:828622 Uniprot:B6IDZ4) HSP 1 Score: 50.447 bits (119), Expect = 6.471e-7 Identity = 19/29 (65.52%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 PV++FIHG+S+ W SGN YD SVLA+YG+ Sbjct: 165 PVIVFIHGESFEWSSGNPYDGSVLASYGE 193
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:nlgn2b "neuroligin 2b" species:7955 "Danio rerio" [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 ZFIN:ZDB-GENE-090918-3 GO:GO:0016020 GO:GO:0007155 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 OrthoDB:EOG7RBZ7R KO:K07378 TreeFam:TF326187 GeneTree:ENSGT00690000101920 EMBL:CT573337 RefSeq:XP_005172672.1 UniGene:Dr.157420 Ensembl:ENSDART00000112484 GeneID:100002407 KEGG:dre:100002407 CTD:100002407 OMA:VPLMTAN Bgee:F1QX74 Uniprot:F1QX74) HSP 1 Score: 50.0618 bits (118), Expect = 6.914e-7 Identity = 21/29 (72.41%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LFIHG S+ G+GN++DASVLAAYG Sbjct: 188 KPVMLFIHGGSFMEGTGNMFDASVLAAYG 216
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:NLGN2 "Neuroligin-2" species:9606 "Homo sapiens" [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=ISS] [GO:0004872 "receptor activity" evidence=IBA] [GO:0005887 "integral component of plasma membrane" evidence=ISS;IBA] [GO:0007158 "neuron cell-cell adhesion" evidence=ISS] [GO:0007416 "synapse assembly" evidence=ISS;NAS;IBA] [GO:0009986 "cell surface" evidence=ISS;IBA] [GO:0016020 "membrane" evidence=NAS] [GO:0016337 "cell-cell adhesion" evidence=NAS] [GO:0019233 "sensory perception of pain" evidence=IEA] [GO:0030054 "cell junction" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=ISS] [GO:0035418 "protein localization to synapse" evidence=ISS] [GO:0035641 "locomotory exploration behavior" evidence=IEA] [GO:0042043 "neurexin family protein binding" evidence=ISS;NAS;IBA] [GO:0042734 "presynaptic membrane" evidence=IEA] [GO:0045202 "synapse" evidence=ISS;IBA] [GO:0045211 "postsynaptic membrane" evidence=NAS] [GO:0045217 "cell-cell junction maintenance" evidence=NAS] [GO:0050804 "regulation of synaptic transmission" evidence=ISS] [GO:0050808 "synapse organization" evidence=ISS] [GO:0050839 "cell adhesion molecule binding" evidence=ISS] [GO:0050885 "neuromuscular process controlling balance" evidence=IEA] [GO:0051965 "positive regulation of synapse assembly" evidence=ISS] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=ISS] [GO:0060077 "inhibitory synapse" evidence=ISS] [GO:0072553 "terminal button organization" evidence=ISS] [GO:0097104 "postsynaptic membrane assembly" evidence=ISS] [GO:0097105 "presynaptic membrane assembly" evidence=ISS] [GO:0097116 "gephyrin clustering" evidence=ISS] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=ISS] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=ISS] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=ISS] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=ISS] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 GO:GO:0009986 GO:GO:0005887 GO:GO:0030054 GO:GO:0045211 GO:GO:0004872 GO:GO:0050885 GO:GO:0042734 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 eggNOG:COG2272 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 HOVERGEN:HBG008839 GO:GO:0019233 GO:GO:0051965 GO:GO:0050839 GO:GO:0035418 GO:GO:0007158 GO:GO:2000311 GO:GO:0060077 GO:GO:0035641 GO:GO:0045217 GO:GO:0042043 GO:GO:2000463 OrthoDB:EOG7RBZ7R GO:GO:0072553 GO:GO:0097105 GO:GO:0097104 HOGENOM:HOG000231424 KO:K07378 TreeFam:TF326187 GO:GO:0097119 EMBL:AF376802 EMBL:AB037787 RefSeq:NP_065846.1 UniGene:Hs.26229 ProteinModelPortal:Q8NFZ4 SMR:Q8NFZ4 BioGrid:121611 STRING:9606.ENSP00000305288 MEROPS:S09.995 PhosphoSite:Q8NFZ4 DMDM:31076824 PaxDb:Q8NFZ4 PRIDE:Q8NFZ4 Ensembl:ENST00000302926 Ensembl:ENST00000575301 GeneID:57555 KEGG:hsa:57555 UCSC:uc002ggt.1 CTD:57555 GeneCards:GC17P007311 HGNC:HGNC:14290 HPA:HPA055321 MIM:606479 neXtProt:NX_Q8NFZ4 PharmGKB:PA31648 InParanoid:Q8NFZ4 OMA:DIRDPGK PhylomeDB:Q8NFZ4 GeneWiki:NLGN2 GenomeRNAi:57555 NextBio:64034 PRO:PR:Q8NFZ4 Bgee:Q8NFZ4 CleanEx:HS_NLGN2 Genevestigator:Q8NFZ4 GO:GO:0097116 GO:GO:0097151 Uniprot:Q8NFZ4) HSP 1 Score: 48.521 bits (114), Expect = 2.018e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:Nlgn2 "Neuroligin-2" species:10116 "Rattus norvegicus" [GO:0001966 "thigmotaxis" evidence=IMP] [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=ISS] [GO:0004872 "receptor activity" evidence=IBA] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0007158 "neuron cell-cell adhesion" evidence=IDA] [GO:0007416 "synapse assembly" evidence=IDA] [GO:0007630 "jump response" evidence=IMP] [GO:0009986 "cell surface" evidence=IDA] [GO:0019233 "sensory perception of pain" evidence=ISS] [GO:0030054 "cell junction" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=ISS] [GO:0035176 "social behavior" evidence=IMP] [GO:0035418 "protein localization to synapse" evidence=ISS] [GO:0035641 "locomotory exploration behavior" evidence=ISS] [GO:0042043 "neurexin family protein binding" evidence=ISS;IBA] [GO:0042734 "presynaptic membrane" evidence=IEA] [GO:0045202 "synapse" evidence=ISS;IBA] [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0050804 "regulation of synaptic transmission" evidence=ISS] [GO:0050808 "synapse organization" evidence=IDA] [GO:0050839 "cell adhesion molecule binding" evidence=ISS] [GO:0050885 "neuromuscular process controlling balance" evidence=ISS] [GO:0051965 "positive regulation of synapse assembly" evidence=IDA] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=ISS] [GO:0060077 "inhibitory synapse" evidence=IDA] [GO:0072553 "terminal button organization" evidence=IMP] [GO:0097104 "postsynaptic membrane assembly" evidence=ISS] [GO:0097105 "presynaptic membrane assembly" evidence=IDA] [GO:0097116 "gephyrin clustering" evidence=ISS] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=ISS] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=IMP] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=ISS] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=ISS] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 RGD:621118 GO:GO:0009986 GO:GO:0005887 GO:GO:0030054 GO:GO:0045211 GO:GO:0004872 GO:GO:0050885 GO:GO:0042734 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 eggNOG:COG2272 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 HOVERGEN:HBG008839 GO:GO:0019233 GO:GO:0035176 GO:GO:0051965 GO:GO:0050839 GO:GO:0035418 GO:GO:0007158 GO:GO:0001966 GO:GO:0007630 GO:GO:2000311 GO:GO:0060077 GO:GO:0035641 GO:GO:0042043 GO:GO:2000463 GO:GO:0072553 GO:GO:0097105 GO:GO:0097104 HOGENOM:HOG000231424 KO:K07378 GO:GO:0097119 MEROPS:S09.995 CTD:57555 GO:GO:0097116 GO:GO:0097151 EMBL:U41662 RefSeq:NP_446444.1 UniGene:Rn.55111 ProteinModelPortal:Q62888 SMR:Q62888 BioGrid:250669 IntAct:Q62888 MINT:MINT-1891708 STRING:10116.ENSRNOP00000053713 PhosphoSite:Q62888 PaxDb:Q62888 PRIDE:Q62888 GeneID:117096 KEGG:rno:117096 UCSC:RGD:621118 InParanoid:Q62888 NextBio:619966 PRO:PR:Q62888 Genevestigator:Q62888 Uniprot:Q62888) HSP 1 Score: 48.521 bits (114), Expect = 2.019e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:Nlgn2 "neuroligin 2" species:10116 "Rattus norvegicus" [GO:0001966 "thigmotaxis" evidence=IMP] [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=IEA;ISO;ISS] [GO:0004872 "receptor activity" evidence=IBA] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0007158 "neuron cell-cell adhesion" evidence=IDA] [GO:0007416 "synapse assembly" evidence=IDA] [GO:0007630 "jump response" evidence=IMP] [GO:0009986 "cell surface" evidence=IDA] [GO:0016020 "membrane" evidence=IEA] [GO:0019233 "sensory perception of pain" evidence=IEA;ISO;ISS] [GO:0030054 "cell junction" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=IEA;ISO;ISS] [GO:0035176 "social behavior" evidence=IMP] [GO:0035418 "protein localization to synapse" evidence=IEA;ISO;ISS] [GO:0035641 "locomotory exploration behavior" evidence=IEA;ISO;ISS] [GO:0042043 "neurexin family protein binding" evidence=ISO;ISS;IBA] [GO:0042734 "presynaptic membrane" evidence=IEA] [GO:0045202 "synapse" evidence=IEA;ISO;ISS;IBA] [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0050804 "regulation of synaptic transmission" evidence=ISO;ISS] [GO:0050808 "synapse organization" evidence=IDA] [GO:0050839 "cell adhesion molecule binding" evidence=IEA;ISO;ISS] [GO:0050885 "neuromuscular process controlling balance" evidence=IEA;ISO;ISS] [GO:0051965 "positive regulation of synapse assembly" evidence=IDA] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=IEA;ISO;ISS] [GO:0060077 "inhibitory synapse" evidence=IDA] [GO:0072553 "terminal button organization" evidence=IMP] [GO:0097104 "postsynaptic membrane assembly" evidence=IEA;ISO;ISS] [GO:0097105 "presynaptic membrane assembly" evidence=IEA;ISO;IDA] [GO:0097116 "gephyrin clustering" evidence=IEA;ISO;ISS] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=IEA;ISO;ISS] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=IEA;ISO;IMP] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=IEA;ISO;ISS] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=IEA;ISO;ISS] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 RGD:621118 GO:GO:0009986 GO:GO:0005887 GO:GO:0030054 GO:GO:0045211 GO:GO:0004872 GO:GO:0050885 GO:GO:0042734 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 eggNOG:COG2272 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 HOVERGEN:HBG008839 GO:GO:0019233 GO:GO:0035176 GO:GO:0051965 GO:GO:0050839 GO:GO:0035418 GO:GO:0007158 GO:GO:0001966 GO:GO:0007630 GO:GO:2000311 GO:GO:0060077 GO:GO:0035641 GO:GO:0042043 GO:GO:2000463 GO:GO:0072553 GO:GO:0097105 GO:GO:0097104 HOGENOM:HOG000231424 KO:K07378 GO:GO:0097119 MEROPS:S09.995 CTD:57555 GO:GO:0097116 GO:GO:0097151 EMBL:U41662 RefSeq:NP_446444.1 UniGene:Rn.55111 ProteinModelPortal:Q62888 SMR:Q62888 BioGrid:250669 IntAct:Q62888 MINT:MINT-1891708 STRING:10116.ENSRNOP00000053713 PhosphoSite:Q62888 PaxDb:Q62888 PRIDE:Q62888 GeneID:117096 KEGG:rno:117096 UCSC:RGD:621118 InParanoid:Q62888 NextBio:619966 PRO:PR:Q62888 Genevestigator:Q62888 Uniprot:Q62888) HSP 1 Score: 48.521 bits (114), Expect = 2.019e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:Nlgn2 "neuroligin 2" species:10090 "Mus musculus" [GO:0001966 "thigmotaxis" evidence=ISO] [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=IGI] [GO:0004872 "receptor activity" evidence=IBA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0005887 "integral component of plasma membrane" evidence=ISO;IBA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0007158 "neuron cell-cell adhesion" evidence=ISO] [GO:0007416 "synapse assembly" evidence=ISO;IBA] [GO:0007630 "jump response" evidence=ISO] [GO:0009986 "cell surface" evidence=ISO;IBA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0019233 "sensory perception of pain" evidence=IMP] [GO:0030054 "cell junction" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=IMP] [GO:0035176 "social behavior" evidence=ISO] [GO:0035418 "protein localization to synapse" evidence=IDA] [GO:0035641 "locomotory exploration behavior" evidence=IMP] [GO:0042043 "neurexin family protein binding" evidence=IBA;IPI] [GO:0045202 "synapse" evidence=IDA] [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0050804 "regulation of synaptic transmission" evidence=IGI] [GO:0050808 "synapse organization" evidence=ISO] [GO:0050839 "cell adhesion molecule binding" evidence=IPI] [GO:0050885 "neuromuscular process controlling balance" evidence=IMP] [GO:0051965 "positive regulation of synapse assembly" evidence=ISO] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=IMP] [GO:0060076 "excitatory synapse" evidence=IC] [GO:0060077 "inhibitory synapse" evidence=ISO;IC] [GO:0072553 "terminal button organization" evidence=ISO] [GO:0097104 "postsynaptic membrane assembly" evidence=IDA] [GO:0097105 "presynaptic membrane assembly" evidence=ISO;IDA;IMP] [GO:0097116 "gephyrin clustering" evidence=IDA] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=IDA] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=ISO;IMP] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=IMP] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=IMP] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 MGI:MGI:2681835 GO:GO:0009986 GO:GO:0005887 GO:GO:0030054 GO:GO:0045211 GO:GO:0004872 GO:GO:0050885 GO:GO:0042734 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 eggNOG:COG2272 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 HOVERGEN:HBG008839 GO:GO:0019233 GO:GO:0035176 EMBL:AL603707 GO:GO:0051965 GO:GO:0060076 GO:GO:0035418 GO:GO:0007158 GO:GO:0001966 GO:GO:0007630 GO:GO:2000311 GO:GO:0060077 GO:GO:0035641 GO:GO:0042043 GO:GO:2000463 OrthoDB:EOG7RBZ7R GO:GO:0072553 GO:GO:0097105 GO:GO:0097104 HOGENOM:HOG000231424 KO:K07378 TreeFam:TF326187 GO:GO:0097119 GeneTree:ENSGT00690000101920 CTD:57555 OMA:DIRDPGK GO:GO:0097116 GO:GO:0097151 EMBL:AK173159 RefSeq:NP_942562.2 RefSeq:XP_006532964.1 UniGene:Mm.151293 PDB:3BL8 PDBsum:3BL8 ProteinModelPortal:Q69ZK9 SMR:Q69ZK9 DIP:DIP-29702N IntAct:Q69ZK9 STRING:10090.ENSMUSP00000104274 PhosphoSite:Q69ZK9 PaxDb:Q69ZK9 PRIDE:Q69ZK9 Ensembl:ENSMUST00000056484 Ensembl:ENSMUST00000108634 GeneID:216856 KEGG:mmu:216856 UCSC:uc007jrw.1 InParanoid:Q69ZK9 ChiTaRS:NLGN2 EvolutionaryTrace:Q69ZK9 NextBio:375400 PRO:PR:Q69ZK9 ArrayExpress:Q69ZK9 Bgee:Q69ZK9 CleanEx:MM_NLGN2 Genevestigator:Q69ZK9 Uniprot:Q69ZK9) HSP 1 Score: 48.521 bits (114), Expect = 2.019e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:Nlgn2 "Neuroligin-2" species:10116 "Rattus norvegicus" [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0019233 "sensory perception of pain" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=IEA] [GO:0035418 "protein localization to synapse" evidence=IEA] [GO:0035641 "locomotory exploration behavior" evidence=IEA] [GO:0045202 "synapse" evidence=IEA] [GO:0050839 "cell adhesion molecule binding" evidence=IEA] [GO:0050885 "neuromuscular process controlling balance" evidence=IEA] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=IEA] [GO:0097104 "postsynaptic membrane assembly" evidence=IEA] [GO:0097105 "presynaptic membrane assembly" evidence=IEA] [GO:0097116 "gephyrin clustering" evidence=IEA] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=IEA] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=IEA] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=IEA] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=IEA] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 RGD:621118 GO:GO:0016020 GO:GO:0045202 GO:GO:0050885 GO:GO:0007155 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 GO:GO:0019233 GO:GO:0035418 GO:GO:2000311 GO:GO:0035641 GO:GO:2000463 OrthoDB:EOG7RBZ7R GO:GO:0097105 GO:GO:0097104 TreeFam:TF326187 GO:GO:0097119 GeneTree:ENSGT00690000101920 OMA:DIRDPGK GO:GO:0097116 GO:GO:0097151 EMBL:AABR06064395 PRIDE:F1LQ41 Ensembl:ENSRNOT00000056872 NextBio:35576324 Uniprot:F1LQ41) HSP 1 Score: 48.521 bits (114), Expect = 2.152e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. GO
Match: - (symbol:NLGN2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0002087 "regulation of respiratory gaseous exchange by neurological system process" evidence=IEA] [GO:0007155 "cell adhesion" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0019233 "sensory perception of pain" evidence=IEA] [GO:0032230 "positive regulation of synaptic transmission, GABAergic" evidence=IEA] [GO:0035418 "protein localization to synapse" evidence=IEA] [GO:0035641 "locomotory exploration behavior" evidence=IEA] [GO:0045202 "synapse" evidence=IEA] [GO:0050839 "cell adhesion molecule binding" evidence=IEA] [GO:0050885 "neuromuscular process controlling balance" evidence=IEA] [GO:0051968 "positive regulation of synaptic transmission, glutamatergic" evidence=IEA] [GO:0097104 "postsynaptic membrane assembly" evidence=IEA] [GO:0097105 "presynaptic membrane assembly" evidence=IEA] [GO:0097116 "gephyrin clustering" evidence=IEA] [GO:0097119 "postsynaptic density protein 95 clustering" evidence=IEA] [GO:0097151 "positive regulation of inhibitory postsynaptic membrane potential" evidence=IEA] [GO:2000311 "regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=IEA] [GO:2000463 "positive regulation of excitatory postsynaptic membrane potential" evidence=IEA] InterPro:IPR000460 PRINTS:PR01090 Pfam:PF00135 GO:GO:0016020 GO:GO:0045202 GO:GO:0050885 GO:GO:0007155 GO:GO:0002087 GO:GO:0032230 GO:GO:0051968 InterPro:IPR002018 InterPro:IPR019819 PROSITE:PS00941 GO:GO:0019233 GO:GO:0035418 GO:GO:2000311 GO:GO:0035641 GO:GO:2000463 OrthoDB:EOG7RBZ7R GO:GO:0097105 GO:GO:0097104 KO:K07378 TreeFam:TF326187 GO:GO:0097119 GeneTree:ENSGT00690000101920 CTD:57555 OMA:DIRDPGK GO:GO:0097116 GO:GO:0097151 EMBL:AAEX03003614 RefSeq:XP_849499.2 Ensembl:ENSCAFT00000025833 GeneID:479482 KEGG:cfa:479482 NextBio:20854659 Uniprot:E2R9D0) HSP 1 Score: 48.521 bits (114), Expect = 2.153e-6 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592849241|gb|GAXK01108303.1| (TSA: Calanus finmarchicus comp770362_c0_seq1 transcribed RNA sequence) HSP 1 Score: 58.151 bits (139), Expect = 5.895e-10 Identity = 24/28 (85.71%), Postives = 26/28 (92.86%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PV+LFIHGDS+NWGSGNLYD S LAAYG Sbjct: 1544 PVVLFIHGDSFNWGSGNLYDGSGLAAYG 1627
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592758053|gb|GAXK01196360.1| (TSA: Calanus finmarchicus comp596152_c0_seq1 transcribed RNA sequence) HSP 1 Score: 54.6842 bits (130), Expect = 7.762e-9 Identity = 21/28 (75.00%), Postives = 25/28 (89.29%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PV+LF+HG+SY WGSGNLYD VLA+YG Sbjct: 2388 PVMLFVHGESYQWGSGNLYDGRVLASYG 2471
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592920112|gb|GAXK01038263.1| (TSA: Calanus finmarchicus comp958982_c0_seq1 transcribed RNA sequence) HSP 1 Score: 48.1358 bits (113), Expect = 1.085e-6 Identity = 19/29 (65.52%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 PV++FIHG+SY W SGN YD SVL++YG+ Sbjct: 3712 PVIVFIHGESYEWNSGNPYDGSVLSSYGQ 3798
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592834793|gb|GAXK01122751.1| (TSA: Calanus finmarchicus comp1604784_c0_seq1 transcribed RNA sequence) HSP 1 Score: 45.4394 bits (106), Expect = 7.843e-6 Identity = 18/29 (62.07%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 PVL+FIHG+S++WGS NLYD +LA G+ Sbjct: 1040 PVLVFIHGESWSWGSSNLYDGRILATLGQ 1126
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592954508|gb|GAXK01004045.1| (TSA: Calanus finmarchicus comp255811_c0_seq2 transcribed RNA sequence) HSP 1 Score: 35.8094 bits (81), Expect = 1.033e-2 Identity = 14/22 (63.64%), Postives = 17/22 (77.27%), Query Frame = 0 Query: 48 PSQLKPVLLFIHGDSYNWGSGN 69 P LKPV+ +IHG S+N GSGN Sbjct: 1672 PQSLKPVMFWIHGGSFNTGSGN 1737
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592954509|gb|GAXK01004044.1| (TSA: Calanus finmarchicus comp255811_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.8094 bits (81), Expect = 1.034e-2 Identity = 14/22 (63.64%), Postives = 17/22 (77.27%), Query Frame = 0 Query: 48 PSQLKPVLLFIHGDSYNWGSGN 69 P LKPV+ +IHG S+N GSGN Sbjct: 1683 PQSLKPVMFWIHGGSFNTGSGN 1748
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592824440|gb|GAXK01130128.1| (TSA: Calanus finmarchicus comp71345_c1_seq5 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 4.191e-2 Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 S+LKPV+++IHG + GSGN Y L G Sbjct: 45 SKLKPVMIWIHGGGFTQGSGNDYTPENLIRAG 140
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592824441|gb|GAXK01130127.1| (TSA: Calanus finmarchicus comp71345_c1_seq4 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 5.417e-2 Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 S+LKPV+++IHG + GSGN Y L G Sbjct: 157 SKLKPVMIWIHGGGFTQGSGNDYTPEPLIRAG 252
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592824442|gb|GAXK01130126.1| (TSA: Calanus finmarchicus comp71345_c1_seq3 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 5.888e-2 Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 S+LKPV+++IHG + GSGN Y L G Sbjct: 253 SKLKPVMIWIHGGGFTQGSGNDYTPEPLIRAG 348
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Match: gi|592824438|gb|GAXK01130130.1| (TSA: Calanus finmarchicus comp71345_c2_seq1 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 5.982e-2 Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 S+LKPV+++IHG + GSGN Y L G Sbjct: 704 SKLKPVMIWIHGGGFTQGSGNDYTPEPLIRAG 799
BLAST of EMLSAG00000001201 vs. L. salmonis peptides
Match: EMLSAP00000001201 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11:1004918:1009952:1 gene:EMLSAG00000001201 transcript:EMLSAT00000001201 description:"snap_masked-LSalAtl2s11-processed-gene-11.15") HSP 1 Score: 172.555 bits (436), Expect = 6.118e-57 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0 Query: 1 MLSPDSEKDSFSLVWETKFINDKKLTSYTYSWGLGFVDIQSFWFGQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGKKFKY 85 MLSPDSEKDSFSLVWETKFINDKKLTSYTYSWGLGFVDIQSFWFGQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGKKFKY Sbjct: 1 MLSPDSEKDSFSLVWETKFINDKKLTSYTYSWGLGFVDIQSFWFGQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGKKFKY 85
BLAST of EMLSAG00000001201 vs. L. salmonis peptides
Match: EMLSAP00000007250 (pep:novel supercontig:LSalAtl2s:LSalAtl2s407:317900:333553:1 gene:EMLSAG00000007250 transcript:EMLSAT00000007250 description:"maker-LSalAtl2s407-augustus-gene-2.6") HSP 1 Score: 48.521 bits (114), Expect = 5.597e-8 Identity = 17/29 (58.62%), Postives = 27/29 (93.10%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 PV++++HG+S+ WGSGNL+DA +LAA+G+ Sbjct: 19 PVMVYVHGESFKWGSGNLWDARILAAFGE 47
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|31076824|sp|Q8NFZ4.1|NLGN2_HUMAN (RecName: Full=Neuroligin-2; Flags: Precursor) HSP 1 Score: 48.521 bits (114), Expect = 4.530e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|31076782|sp|Q62888.1|NLGN2_RAT (RecName: Full=Neuroligin-2; Flags: Precursor) HSP 1 Score: 48.521 bits (114), Expect = 4.530e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|83305800|sp|Q69ZK9.2|NLGN2_MOUSE (RecName: Full=Neuroligin-2; Flags: Precursor) HSP 1 Score: 48.521 bits (114), Expect = 4.530e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+LF+HG SY G+GN++D SVLAAYG Sbjct: 177 KPVMLFLHGGSYMEGTGNMFDGSVLAAYG 205
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|31076822|sp|Q8N2Q7.2|NLGN1_HUMAN (RecName: Full=Neuroligin-1; Flags: Precursor) HSP 1 Score: 48.1358 bits (113), Expect = 7.316e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+++IHG SY G+GNLYD SVLA+YG Sbjct: 190 KPVMVYIHGGSYMEGTGNLYDGSVLASYG 218
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|31076781|sp|Q62765.1|NLGN1_RAT (RecName: Full=Neuroligin-1; AltName: Full=Neuroligin I; Flags: Precursor) HSP 1 Score: 48.1358 bits (113), Expect = 7.461e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+++IHG SY G+GNLYD SVLA+YG Sbjct: 193 KPVMVYIHGGSYMEGTGNLYDGSVLASYG 221
BLAST of EMLSAG00000001201 vs. SwissProt
Match: gi|31076842|sp|Q99K10.2|NLGN1_MOUSE (RecName: Full=Neuroligin-1; Flags: Precursor) HSP 1 Score: 47.7506 bits (112), Expect = 8.555e-7 Identity = 20/29 (68.97%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 52 KPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 KPV+++IHG SY G+GNLYD SVLA+YG Sbjct: 193 KPVMVYIHGGSYMEGTGNLYDGSVLASYG 221
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: XP_006561899.1 (PREDICTED: uncharacterized protein LOC724358 isoform X2 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.230e-8 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 45 GQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 GQ + PV++FIHG+S+ W SGN YD ++LAAYG Sbjct: 160 GQKTLRKYPVMVFIHGESFEWNSGNPYDGTILAAYG 195
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: XP_016769670.1 (PREDICTED: uncharacterized protein LOC724358 isoform X1 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.230e-8 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 45 GQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 GQ + PV++FIHG+S+ W SGN YD ++LAAYG Sbjct: 160 GQKTLRKYPVMVFIHGESFEWNSGNPYDGTILAAYG 195
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: XP_016769669.1 (PREDICTED: uncharacterized protein LOC724358 isoform X1 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.230e-8 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 45 GQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 GQ + PV++FIHG+S+ W SGN YD ++LAAYG Sbjct: 160 GQKTLRKYPVMVFIHGESFEWNSGNPYDGTILAAYG 195
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: XP_006561898.1 (PREDICTED: uncharacterized protein LOC724358 isoform X1 [Apis mellifera]) HSP 1 Score: 51.6026 bits (122), Expect = 2.230e-8 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 45 GQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 GQ + PV++FIHG+S+ W SGN YD ++LAAYG Sbjct: 160 GQKTLRKYPVMVFIHGESFEWNSGNPYDGTILAAYG 195
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: gb|KYB27546.1| (Neuroligin-1-like Protein [Tribolium castaneum]) HSP 1 Score: 51.6026 bits (122), Expect = 2.260e-8 Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 47 SPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYG 80 S S PV++F+HG+SY W SGN YD SVLA+YG Sbjct: 14 SSSSKYPVVVFVHGESYEWNSGNPYDGSVLASYG 47
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: EEB10943.1 (conserved hypothetical protein [Pediculus humanus corporis]) HSP 1 Score: 48.521 bits (114), Expect = 2.333e-8 Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 40 QSFWFGQSPSQLK---PVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 ++F G P + + PV++++HG+SY W SGN YD SVLAAYG Sbjct: 19 KTFLKGGVPPEEEGPLPVIVYVHGESYEWNSGNPYDGSVLAAYGN 63
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: XP_016769312.1 (PREDICTED: neuroligin 3 isoform X1 [Apis mellifera]) HSP 1 Score: 50.8322 bits (120), Expect = 3.687e-8 Identity = 19/28 (67.86%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PV++F+HG+SY W SGN YD SVLA+YG Sbjct: 141 PVIVFVHGESYEWSSGNPYDGSVLASYG 168
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: NP_001139208.1 (neuroligin 3 precursor [Apis mellifera]) HSP 1 Score: 50.8322 bits (120), Expect = 3.702e-8 Identity = 19/28 (67.86%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PV++F+HG+SY W SGN YD SVLA+YG Sbjct: 141 PVIVFVHGESYEWSSGNPYDGSVLASYG 168
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: EFX68936.1 (hypothetical protein DAPPUDRAFT_62811 [Daphnia pulex]) HSP 1 Score: 50.447 bits (119), Expect = 5.342e-8 Identity = 19/28 (67.86%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PV++FIHG+SY W SGN YD S+LA+YG Sbjct: 132 PVIVFIHGESYEWNSGNPYDGSILASYG 159
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Match: EEB12234.1 (Neuroligin-3 precursor, putative [Pediculus humanus corporis]) HSP 1 Score: 50.447 bits (119), Expect = 5.455e-8 Identity = 20/28 (71.43%), Postives = 24/28 (85.71%), Query Frame = 0 Query: 53 PVLLFIHGDSYNWGSGNLYDASVLAAYG 80 PVL+FIHG+SY+W SGN YD SVLA+Y Sbjct: 204 PVLVFIHGESYDWNSGNPYDGSVLASYA 231
BLAST of EMLSAG00000001201 vs. nr
Match: gi|1058227542|gb|JAT17287.1| (hypothetical protein g.306 [Graphocephala atropunctata]) HSP 1 Score: 58.9214 bits (141), Expect = 2.359e-8 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 40 QSFWFGQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 S W PS L PV++FIHG+S+ W SGNLYD SVLA+YGK Sbjct: 140 HSLWDKPPPSNL-PVMVFIHGESFEWNSGNLYDGSVLASYGK 180
BLAST of EMLSAG00000001201 vs. nr
Match: gi|1058220254|gb|JAT13643.1| (hypothetical protein g.304 [Graphocephala atropunctata]) HSP 1 Score: 58.9214 bits (141), Expect = 2.359e-8 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 40 QSFWFGQSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 S W PS L PV++FIHG+S+ W SGNLYD SVLA+YGK Sbjct: 140 HSLWDKPPPSNL-PVMVFIHGESFEWNSGNLYDGSVLASYGK 180
BLAST of EMLSAG00000001201 vs. nr
Match: gi|669226097|emb|CDW52633.1| (protein nlg c; protein nlg b; protein nlg a [Trichuris trichiura]) HSP 1 Score: 58.5362 bits (140), Expect = 3.245e-8 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 ++L PVL+ IHGDSYNW SG LYD S+LAAYGK Sbjct: 171 TELMPVLVIIHGDSYNWNSGTLYDGSILAAYGK 203
BLAST of EMLSAG00000001201 vs. nr
Match: gi|942384783|gb|JAN74321.1| (Neuroligin-4, Y-linked [Daphnia magna]) HSP 1 Score: 58.5362 bits (140), Expect = 3.667e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 44 FGQSPSQLKP---VLLFIHGDSYNWGSGNLYDASVLAAYGK 81 F SP+ LKP V++FIHG+SY+WGSGN YD SVLAA GK Sbjct: 176 FAASPTALKPRYPVIVFIHGESYSWGSGNPYDGSVLAAVGK 216
BLAST of EMLSAG00000001201 vs. nr
Match: gi|942366397|gb|JAN65128.1| (Neuroligin-4, Y-linked [Daphnia magna]) HSP 1 Score: 58.5362 bits (140), Expect = 3.699e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 44 FGQSPSQLKP---VLLFIHGDSYNWGSGNLYDASVLAAYGK 81 F SP+ LKP V++FIHG+SY+WGSGN YD SVLAA GK Sbjct: 159 FAASPTALKPRYPVIVFIHGESYSWGSGNPYDGSVLAAVGK 199
BLAST of EMLSAG00000001201 vs. nr
Match: gi|942363303|gb|JAN63581.1| (Neuroligin-4, Y-linked [Daphnia magna]) HSP 1 Score: 58.5362 bits (140), Expect = 3.699e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 44 FGQSPSQLKP---VLLFIHGDSYNWGSGNLYDASVLAAYGK 81 F SP+ LKP V++FIHG+SY+WGSGN YD SVLAA GK Sbjct: 159 FAASPTALKPRYPVIVFIHGESYSWGSGNPYDGSVLAAVGK 199
BLAST of EMLSAG00000001201 vs. nr
Match: gi|1022762823|gb|KZS08483.1| (Neuroligin-3 [Daphnia magna]) HSP 1 Score: 58.5362 bits (140), Expect = 3.846e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 44 FGQSPSQLKP---VLLFIHGDSYNWGSGNLYDASVLAAYGK 81 F SP+ LKP V++FIHG+SY+WGSGN YD SVLAA GK Sbjct: 159 FAASPTALKPRYPVIVFIHGESYSWGSGNPYDGSVLAAVGK 199
BLAST of EMLSAG00000001201 vs. nr
Match: gi|669326518|gb|KFD66728.1| (hypothetical protein M514_06829 [Trichuris suis]) HSP 1 Score: 58.151 bits (139), Expect = 4.577e-8 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 49 SQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 ++L PVL+ IHGDSYNW SG LYD S+LAAYG+ Sbjct: 196 TELMPVLVIIHGDSYNWNSGTLYDGSILAAYGR 228
BLAST of EMLSAG00000001201 vs. nr
Match: gi|321457857|gb|EFX68935.1| (hypothetical protein DAPPUDRAFT_10046, partial [Daphnia pulex]) HSP 1 Score: 58.151 bits (139), Expect = 5.716e-8 Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 44 FGQSPSQLKP---VLLFIHGDSYNWGSGNLYDASVLAAYGK 81 F SP+ LKP V++FIHG+SY+WGSGN YD SVLAA GK Sbjct: 119 FAASPTSLKPRYPVIVFIHGESYSWGSGNPYDGSVLAAVGK 159
BLAST of EMLSAG00000001201 vs. nr
Match: gi|730369963|gb|KHJ41690.1| (Carboxylesterase [Trichuris suis]) HSP 1 Score: 57.7658 bits (138), Expect = 5.766e-8 Identity = 24/36 (66.67%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 46 QSPSQLKPVLLFIHGDSYNWGSGNLYDASVLAAYGK 81 Q ++L PVL+ IHGDSYNW SG LYD S+LAAYG+ Sbjct: 9 QPQTELMPVLVIIHGDSYNWNSGTLYDGSILAAYGR 44
BLAST of EMLSAG00000001201 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold276_size226481-snap-gene-1.31 (protein:Tk04712 transcript:maker-scaffold276_size226481-snap-gene-1.31-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_10046") HSP 1 Score: 45.4394 bits (106), Expect = 2.026e-7 Identity = 19/29 (65.52%), Postives = 24/29 (82.76%), Query Frame = 0 Query: 53 PVLLFIHG-DSYNWGSGNLYDASVLAAYG 80 PV++FIHG DSY WGSGNLYD + +AA+ Sbjct: 154 PVVVFIHGEDSYEWGSGNLYDGTAMAAFA 182 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001201 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001201 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001201 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000001201 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 6
BLAST of EMLSAG00000001201 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001201 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000001201 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s11:1004918..1009952+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001201-683967 ID=EMLSAG00000001201-683967|Name=EMLSAG00000001201|organism=Lepeophtheirus salmonis|type=gene|length=5035bp|location=Sequence derived from alignment at LSalAtl2s11:1004918..1009952+ (Lepeophtheirus salmonis)back to top Add to Basket
|