EMLSAG00000001468, EMLSAG00000001468-684234 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592902320|gb|GAXK01056055.1| (TSA: Calanus finmarchicus comp943333_c1_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 1.244e+0 Identity = 16/40 (40.00%), Postives = 23/40 (57.50%), Query Frame = 0 Query: 11 IDLDWNYDESKQKEKTRAIDFLQYLGKKTLCPWYISSVLY 50 +DL N D K+K A L+Y+ ++L P ISS+LY Sbjct: 317 LDLVKNVDLDKEKVAQFAKTMLEYISLESLTPKLISSMLY 436
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592841714|gb|GAXK01115830.1| (TSA: Calanus finmarchicus comp4297457_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.969e+0 Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 0 Query: 34 YLGKKTLCPWYISSVLYKV--FKNSNANRVGCQLYFFERYLND 74 +LG K I VL+ + FKNS V C+L FER+L+D Sbjct: 329 FLGYKNSFVKLIHPVLFLLVFFKNSPHKDVCCKLT*FERFLDD 457
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592934059|gb|GAXK01024494.1| (TSA: Calanus finmarchicus comp685688_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.071e+0 Identity = 16/52 (30.77%), Postives = 24/52 (46.15%), Query Frame = 0 Query: 28 AIDFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQLYFFERYLNDSYEID 79 A FL L T+CPW++ S LY F + + F ++L D +I Sbjct: 39 AAVFLSILKTITICPWHMCS*LYLCFSP*TLGLIH*T-HKFTKFLTDFLKIP 191
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592814165|gb|GAXK01140403.1| (TSA: Calanus finmarchicus comp816381_c0_seq4 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.724e+0 Identity = 11/34 (32.35%), Postives = 20/34 (58.82%), Query Frame = 0 Query: 39 TLCPWYISSVLYKVFKNSNANRVGCQLYFFERYL 72 T CP Y++ VL++ + +R CQL + R++ Sbjct: 636 THCPLYLAGVLHQSLHSYPVHRPSCQLLKYVRWI 737
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592814166|gb|GAXK01140402.1| (TSA: Calanus finmarchicus comp816381_c0_seq3 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.725e+0 Identity = 11/34 (32.35%), Postives = 20/34 (58.82%), Query Frame = 0 Query: 39 TLCPWYISSVLYKVFKNSNANRVGCQLYFFERYL 72 T CP Y++ VL++ + +R CQL + R++ Sbjct: 647 THCPLYLAGVLHQSLHSYPVHRPSCQLLKYVRWI 748
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592950284|gb|GAXK01008269.1| (TSA: Calanus finmarchicus comp137826_c3_seq11 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 7.409e+0 Identity = 13/32 (40.62%), Postives = 15/32 (46.88%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRV 61 +L G C S LY VFKNSN N + Sbjct: 266 SYLSLSGIAQYCSILASIALYSVFKNSNTNTI 361 HSP 2 Score: 26.9498 bits (58), Expect = 7.409e+0 Identity = 13/32 (40.62%), Postives = 15/32 (46.88%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRV 61 +L G C S LY VFKNSN N + Sbjct: 406 SYLSLSGIAQYCSILASIALYSVFKNSNTNTI 501
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592950293|gb|GAXK01008260.1| (TSA: Calanus finmarchicus comp137826_c3_seq2 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 7.996e+0 Identity = 13/32 (40.62%), Postives = 15/32 (46.88%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRV 61 +L G C S LY VFKNSN N + Sbjct: 787 SYLSLSGIAQYCSILASIALYSVFKNSNTNTI 882 HSP 2 Score: 26.9498 bits (58), Expect = 7.996e+0 Identity = 13/32 (40.62%), Postives = 15/32 (46.88%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRV 61 +L G C S LY VFKNSN N + Sbjct: 927 SYLSLSGIAQYCSILASIALYSVFKNSNTNTI 1022
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592950283|gb|GAXK01008270.1| (TSA: Calanus finmarchicus comp137826_c3_seq12 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 9.030e+0 Identity = 13/32 (40.62%), Postives = 15/32 (46.88%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRV 61 +L G C S LY VFKNSN N + Sbjct: 11 SYLSLSGIAQYCSILASIALYSVFKNSNTNTI 106
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592928236|gb|GAXK01030260.1| (TSA: Calanus finmarchicus comp210779_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 9.104e+0 Identity = 12/35 (34.29%), Postives = 18/35 (51.43%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQ 64 +F+QY+ K LCP + SS V + + R C Sbjct: 55 EFMQYILSKHLCPKFESSTYGSVSERHSLRRSACH 159
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Match: gi|592928237|gb|GAXK01030259.1| (TSA: Calanus finmarchicus comp210779_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 9.132e+0 Identity = 12/35 (34.29%), Postives = 18/35 (51.43%), Query Frame = 0 Query: 30 DFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQ 64 +F+QY+ K LCP + SS V + + R C Sbjct: 55 EFMQYILSKHLCPKFESSTYGSVSERHSLRRSACH 159
BLAST of EMLSAG00000001468 vs. L. salmonis peptides
Match: EMLSAP00000001468 (pep:novel supercontig:LSalAtl2s:LSalAtl2s124:214827:230486:1 gene:EMLSAG00000001468 transcript:EMLSAT00000001468 description:"snap_masked-LSalAtl2s124-processed-gene-2.2") HSP 1 Score: 165.236 bits (417), Expect = 2.698e-54 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 0 Query: 1 MVGGVSIPIQIDLDWNYDESKQKEKTRAIDFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQLYFFERYLNDSYEID 79 MVGGVSIPIQIDLDWNYDESKQKEKTRAIDFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQLYFFERYLNDSYEID Sbjct: 1 MVGGVSIPIQIDLDWNYDESKQKEKTRAIDFLQYLGKKTLCPWYISSVLYKVFKNSNANRVGCQLYFFERYLNDSYEID 79 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001468 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001468 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 10
BLAST of EMLSAG00000001468 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001468 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001468 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001468 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001468 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s124:214827..230486+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001468-684234 ID=EMLSAG00000001468-684234|Name=EMLSAG00000001468|organism=Lepeophtheirus salmonis|type=gene|length=15660bp|location=Sequence derived from alignment at LSalAtl2s124:214827..230486+ (Lepeophtheirus salmonis)back to top Add to Basket
|