EMLSAG00000001884, EMLSAG00000001884-684650 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592933983|gb|GAXK01024570.1| (TSA: Calanus finmarchicus comp4761704_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 9.385e-1 Identity = 12/33 (36.36%), Postives = 20/33 (60.61%), Query Frame = 0 Query: 45 VIRNHICLSYSSGEEKNNTVTGTLLLKDNNAHL 77 VI H+C+ Y +G N +T ++LL+ AH+ Sbjct: 84 VILIHMCIYYPNGFPFINNITSSILLQPIQAHI 182
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896846|gb|GAXK01061529.1| (TSA: Calanus finmarchicus comp645401_c0_seq10 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.167e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 1229 DIPEVFGLHSNADISYQINTAKGILDQILN 1318
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896847|gb|GAXK01061528.1| (TSA: Calanus finmarchicus comp645401_c0_seq9 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.186e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 1229 DIPEVFGLHSNADISYQINTAKGILDQILN 1318
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896850|gb|GAXK01061525.1| (TSA: Calanus finmarchicus comp645401_c0_seq6 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.229e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 5549 DIPEVFGLHSNADISYQINTAKGILDQILN 5638
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896851|gb|GAXK01061524.1| (TSA: Calanus finmarchicus comp645401_c0_seq5 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.231e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 5549 DIPEVFGLHSNADISYQINTAKGILDQILN 5638
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896852|gb|GAXK01061523.1| (TSA: Calanus finmarchicus comp645401_c0_seq4 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.236e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 7550 DIPEVFGLHSNADISYQINTAKGILDQILN 7639
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896853|gb|GAXK01061522.1| (TSA: Calanus finmarchicus comp645401_c0_seq3 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.236e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 7576 DIPEVFGLHSNADISYQINTAKGILDQILN 7665
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896854|gb|GAXK01061521.1| (TSA: Calanus finmarchicus comp645401_c0_seq2 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.237e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 7550 DIPEVFGLHSNADISYQINTAKGILDQILN 7639
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592896855|gb|GAXK01061520.1| (TSA: Calanus finmarchicus comp645401_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 1.237e+0 Identity = 11/30 (36.67%), Postives = 22/30 (73.33%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKKEIN 31 +IP+VF SNA+I+++++ GI+ + +N Sbjct: 7576 DIPEVFGLHSNADISYQINTAKGILDQILN 7665
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Match: gi|592759903|gb|GAXK01194510.1| (TSA: Calanus finmarchicus comp1475114_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 1.586e+0 Identity = 11/27 (40.74%), Postives = 20/27 (74.07%), Query Frame = 0 Query: 2 EIPKVFIQQSNAEITFELSPTTGIIKK 28 +IP+VF SNA+IT++++ GI+ + Sbjct: 5052 DIPEVFGLHSNADITYQINTAKGILDQ 5132
BLAST of EMLSAG00000001884 vs. L. salmonis peptides
Match: EMLSAP00000001884 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1324:2317:10527:-1 gene:EMLSAG00000001884 transcript:EMLSAT00000001884 description:"maker-LSalAtl2s1324-snap-gene-0.21") HSP 1 Score: 172.17 bits (435), Expect = 7.830e-57 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0 Query: 1 MEIPKVFIQQSNAEITFELSPTTGIIKKEINSGKAKCEKFKYIRVIRNHICLSYSSGEEKNNTVTGTLLLKDNNAHLTFKSSAT 84 MEIPKVFIQQSNAEITFELSPTTGIIKKEINSGKAKCEKFKYIRVIRNHICLSYSSGEEKNNTVTGTLLLKDNNAHLTFKSSAT Sbjct: 1 MEIPKVFIQQSNAEITFELSPTTGIIKKEINSGKAKCEKFKYIRVIRNHICLSYSSGEEKNNTVTGTLLLKDNNAHLTFKSSAT 84
BLAST of EMLSAG00000001884 vs. L. salmonis peptides
Match: EMLSAP00000003126 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1757:18841:58738:-1 gene:EMLSAG00000003126 transcript:EMLSAT00000003126 description:"maker-LSalAtl2s1757-snap-gene-0.6") HSP 1 Score: 46.2098 bits (108), Expect = 3.261e-8 Identity = 19/58 (32.76%), Postives = 38/58 (65.52%), Query Frame = 0 Query: 10 QSNAEITFELSPTTGIIKKEINSGKAKCEKFKYIRVIRNHICLSYSSGEEKNNTVTGT 67 QSNA+ + P++G+I K++ + KC +F+Y++++R H+C+ + + K+N T T Sbjct: 47 QSNAKPVLKNEPSSGVISKDVER-ENKCIQFRYLKLLRMHVCVKFMVQDPKSNKTTNT 103 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001884 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001884 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000001884 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000001884 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001884 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001884 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001884 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1324:2317..10527- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001884-684650 ID=EMLSAG00000001884-684650|Name=EMLSAG00000001884|organism=Lepeophtheirus salmonis|type=gene|length=8211bp|location=Sequence derived from alignment at LSalAtl2s1324:2317..10527- (Lepeophtheirus salmonis)back to top Add to Basket
|