EMLSAG00000002342, EMLSAG00000002342-685108 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592935769|gb|GAXK01022784.1| (TSA: Calanus finmarchicus comp1074813_c0_seq1 transcribed RNA sequence) HSP 1 Score: 46.2098 bits (108), Expect = 4.834e-5 Identity = 22/44 (50.00%), Postives = 28/44 (63.64%), Query Frame = 0 Query: 171 ACVVCERIFFTIKQLERHQ-------CNECEQRFNTLMLLEYHK 207 C VC+R F T +QLERHQ C+ C+ FN+LM LE+HK Sbjct: 309 TCNVCDRSFQTPRQLERHQLRKRHWGCDACDNLFNSLMDLEHHK 440
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592874582|gb|GAXK01082980.1| (TSA: Calanus finmarchicus comp656804_c0_seq2 transcribed RNA sequence) HSP 1 Score: 43.5134 bits (101), Expect = 2.448e-4 Identity = 21/50 (42.00%), Postives = 30/50 (60.00%), Query Frame = 0 Query: 165 WGRDSNACVVCERIFFTIKQLERHQ-------CNECEQRFNTLMLLEYHK 207 WG + C VC+R F T +LE+H C+ CE+ FN++M LE+HK Sbjct: 241 WGDEELTCNVCDRAFTTPWELEKHMIKRRHWLCSCCEKMFNSVMQLEHHK 390
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592874583|gb|GAXK01082979.1| (TSA: Calanus finmarchicus comp656804_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.5874 bits (96), Expect = 1.345e-3 Identity = 20/50 (40.00%), Postives = 29/50 (58.00%), Query Frame = 0 Query: 165 WGRDSNACVVCERIFFTIKQLERHQ-------CNECEQRFNTLMLLEYHK 207 W + C VC+R F T +LE+H C+ CE+ FN++M LE+HK Sbjct: 241 WSDEELTCNVCDRAFTTPWELEKHMIKRRHWLCSCCEKMFNSVMQLEHHK 390
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592876836|gb|GAXK01080864.1| (TSA: Calanus finmarchicus comp948476_c0_seq2 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 4.277e-1 Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 0 Query: 171 ACVVCERIFFTIKQLERHQ----------CNECEQRFNTLMLLEYHK 207 +C VC++ F T LE HQ CN+CE +F T L+ HK Sbjct: 202 SCNVCDKAFKTKHNLESHQPVHVDRRDFECNQCESQFKTKQALKSHK 342
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592799761|gb|GAXK01154807.1| (TSA: Calanus finmarchicus comp6586459_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 8.357e-1 Identity = 12/51 (23.53%), Postives = 26/51 (50.98%), Query Frame = 0 Query: 167 RDSNACVVCERIFFTIKQLERH-----------QCNECEQRFNTLMLLEYH 206 +D C VC +IF+++ ++ H +C C++ F++ + +YH Sbjct: 172 QDKRTCPVCSKIFYSVGNMKAHVKSHHDAVGRFECENCDKTFSSKVGFQYH 324
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592883795|gb|GAXK01074580.1| (TSA: Calanus finmarchicus comp500815_c0_seq11 transcribed RNA sequence) HSP 1 Score: 31.9574 bits (71), Expect = 1.243e+0 Identity = 17/55 (30.91%), Postives = 29/55 (52.73%), Query Frame = 0 Query: 163 IYWGRDSNACVVCERIFFTIKQLERH----------QCNECEQRFNTLMLLEYHK 207 +Y D+ +C C+R F +K LE+H QC+EC +F++ L+ H+ Sbjct: 324 VYSSEDA-SCQFCQRKFRKLKDLEKHTSNKVCLKYFQCHECGMKFSSGANLKRHE 485
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592861473|gb|GAXK01096089.1| (TSA: Calanus finmarchicus comp55712_c1_seq7 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 1.540e+0 Identity = 17/46 (36.96%), Postives = 22/46 (47.83%), Query Frame = 0 Query: 172 CVVCERIFFTIKQLERH----------QCNECEQRFNTLMLLEYHK 207 C C R F +I +L+RH CNECE +F L+ HK Sbjct: 227 CTECGRTFGSISKLKRHLVSHTGEKPYPCNECESKFARKDKLDNHK 364
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592819584|gb|GAXK01134984.1| (TSA: Calanus finmarchicus comp4600813_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 1.573e+0 Identity = 16/45 (35.56%), Postives = 26/45 (57.78%), Query Frame = 0 Query: 169 SNACVVCERIFFTIKQLERH-------QCNECEQRFNTLMLLEYH 206 S+AC +CER+F ++ +L+ H CN C F+T L++H Sbjct: 62 SHACSICERVFQSMPELKGHMEKKHCSDCNICCIMFSTSTDLKFH 196
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592861472|gb|GAXK01096090.1| (TSA: Calanus finmarchicus comp55712_c1_seq8 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 1.801e+0 Identity = 17/46 (36.96%), Postives = 22/46 (47.83%), Query Frame = 0 Query: 172 CVVCERIFFTIKQLERH----------QCNECEQRFNTLMLLEYHK 207 C C R F +I +L+RH CNECE +F L+ HK Sbjct: 227 CTECGRTFGSISKLKRHLVSHTGEKPYPCNECESKFARKDKLDNHK 364
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Match: gi|592841422|gb|GAXK01116122.1| (TSA: Calanus finmarchicus comp169770_c4_seq2 transcribed RNA sequence) HSP 1 Score: 30.0314 bits (66), Expect = 2.458e+0 Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 0 Query: 183 KQLERHQCNECEQRFNTLMLLEYHK 207 K++E+HQC C QRF L++HK Sbjct: 4 KEMEKHQCTACGQRFIDSTRLKWHK 78
BLAST of EMLSAG00000002342 vs. L. salmonis peptides
Match: EMLSAP00000002342 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1445:3332:39376:-1 gene:EMLSAG00000002342 transcript:EMLSAT00000002342 description:"maker-LSalAtl2s1445-snap-gene-0.6") HSP 1 Score: 495.738 bits (1275), Expect = 2.323e-179 Identity = 242/242 (100.00%), Postives = 242/242 (100.00%), Query Frame = 0 Query: 1 MAMPLCESCKGLETISSEGIKYVSKVVQTTPHLARRLIHLSKEEDXPSFSSASSSFTTSSVIPSATLNINNSSNSPKNKKKSNIFKGAFKSIICSINGFMFPNNRKKWLSNGMKKLQMDYNSNIESSSFIEDISIETENRGKLNNTKDSDDNNMEEMEDDADIYWGRDSNACVVCERIFFTIKQLERHQCNECEQRFNTLMLLEYHKEDSADDYDSEDSYNPMDSNDVDDISGDEEKEYLLL 242 MAMPLCESCKGLETISSEGIKYVSKVVQTTPHLARRLIHLSKEEDXPSFSSASSSFTTSSVIPSATLNINNSSNSPKNKKKSNIFKGAFKSIICSINGFMFPNNRKKWLSNGMKKLQMDYNSNIESSSFIEDISIETENRGKLNNTKDSDDNNMEEMEDDADIYWGRDSNACVVCERIFFTIKQLERHQCNECEQRFNTLMLLEYHKEDSADDYDSEDSYNPMDSNDVDDISGDEEKEYLLL Sbjct: 1 MAMPLCESCKGLETISSEGIKYVSKVVQTTPHLARRLIHLSKEEDXPSFSSASSSFTTSSVIPSATLNINNSSNSPKNKKKSNIFKGAFKSIICSINGFMFPNNRKKWLSNGMKKLQMDYNSNIESSSFIEDISIETENRGKLNNTKDSDDNNMEEMEDDADIYWGRDSNACVVCERIFFTIKQLERHQCNECEQRFNTLMLLEYHKEDSADDYDSEDSYNPMDSNDVDDISGDEEKEYLLL 242
BLAST of EMLSAG00000002342 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold708_size108518-processed-gene-0.2 (protein:Tk11258 transcript:snap_masked-scaffold708_size108518-processed-gene-0.2-mRNA-1 annotation:"PREDICTED: uncharacterized protein LOC100123324") HSP 1 Score: 69.3218 bits (168), Expect = 6.407e-14 Identity = 44/110 (40.00%), Postives = 63/110 (57.27%), Query Frame = 0 Query: 148 DSDDNNMEEMEDDADIYWGRDSNACVVCERIFFTIKQLERHQ-------CNECEQRFNTLMLLEYHKEDSADDYDSEDSYNPMDSND---------VDDISGDEEKEYLL 241 D D+ + E +D+ W D +C+VCER FFT +QLERHQ C EC++RFN+L+LLEYHK D + + ED P DS D ++D+ GD + +L+ Sbjct: 199 DEDEFSGSETSEDSS-SWVEDF-SCLVCERAFFTARQLERHQLKKRHWGCGECDRRFNSLILLEYHK-DELNHWSEEDF--PYDSEDDDFDSLREVMNDVRGDLGELHLI 303 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002342 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002342 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000002342 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000002342 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002342 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000002342 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002342 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1445:3332..39376- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002342-685108 ID=EMLSAG00000002342-685108|Name=EMLSAG00000002342|organism=Lepeophtheirus salmonis|type=gene|length=36045bp|location=Sequence derived from alignment at LSalAtl2s1445:3332..39376- (Lepeophtheirus salmonis)back to top Add to Basket
|