EMLSAG00000002364, EMLSAG00000002364-685130 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:ADAM17 "Disintegrin and metalloproteinase domain-containing protein 17" species:9606 "Homo sapiens" [GO:0001666 "response to hypoxia" evidence=IDA] [GO:0001934 "positive regulation of protein phosphorylation" evidence=IMP] [GO:0002446 "neutrophil mediated immunity" evidence=IC] [GO:0002467 "germinal center formation" evidence=ISS] [GO:0002690 "positive regulation of leukocyte chemotaxis" evidence=IC] [GO:0004222 "metalloendopeptidase activity" evidence=IMP;IDA;TAS] [GO:0005112 "Notch binding" evidence=IDA] [GO:0005138 "interleukin-6 receptor binding" evidence=IPI] [GO:0005178 "integrin binding" evidence=IPI] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005886 "plasma membrane" evidence=TAS] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0006509 "membrane protein ectodomain proteolysis" evidence=IDA;IMP] [GO:0006915 "apoptotic process" evidence=TAS] [GO:0007155 "cell adhesion" evidence=IDA] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IDA;TAS] [GO:0007219 "Notch signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=IDA] [GO:0008237 "metallopeptidase activity" evidence=IDA;IMP;TAS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IMP] [GO:0009986 "cell surface" evidence=IDA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IMP] [GO:0015629 "actin cytoskeleton" evidence=IDA] [GO:0016324 "apical plasma membrane" evidence=IDA] [GO:0017124 "SH3 domain binding" evidence=IEA] [GO:0022617 "extracellular matrix disassembly" evidence=TAS] [GO:0030165 "PDZ domain binding" evidence=IPI] [GO:0030183 "B cell differentiation" evidence=ISS] [GO:0030198 "extracellular matrix organization" evidence=TAS] [GO:0030307 "positive regulation of cell growth" evidence=IMP] [GO:0030335 "positive regulation of cell migration" evidence=IMP] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=ISS] [GO:0030574 "collagen catabolic process" evidence=TAS] [GO:0031293 "membrane protein intracellular domain proteolysis" evidence=TAS] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IDA] [GO:0032496 "response to lipopolysaccharide" evidence=IDA] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IMP] [GO:0032722 "positive regulation of chemokine production" evidence=IMP] [GO:0033025 "regulation of mast cell apoptotic process" evidence=ISS] [GO:0033077 "T cell differentiation in thymus" evidence=ISS] [GO:0033627 "cell adhesion mediated by integrin" evidence=IDA] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEP] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IMP] [GO:0042493 "response to drug" evidence=ISS] [GO:0045121 "membrane raft" evidence=IDA] [GO:0045741 "positive regulation of epidermal growth factor-activated receptor activity" evidence=IDA;IMP] [GO:0048011 "neurotrophin TRK receptor signaling pathway" evidence=TAS] [GO:0048536 "spleen development" evidence=ISS] [GO:0048870 "cell motility" evidence=ISS] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IMP;IDA] [GO:0051272 "positive regulation of cellular component movement" evidence=ISS] [GO:0055099 "response to high density lipoprotein particle" evidence=IDA] [GO:0060397 "JAK-STAT cascade involved in growth hormone signaling pathway" evidence=TAS] [GO:0097190 "apoptotic signaling pathway" evidence=TAS] [GO:0005911 "cell-cell junction" evidence=IDA] [GO:0005925 "focal adhesion" evidence=IDA] [GO:0032587 "ruffle membrane" evidence=IDA] Reactome:REACT_578 Reactome:REACT_2001 InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS00142 PROSITE:PS50215 Reactome:REACT_118779 GO:GO:0005737 Reactome:REACT_111102 Reactome:REACT_116125 Reactome:REACT_6900 GO:GO:0007173 GO:GO:0048011 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0007219 GO:GO:0097190 GO:GO:0032722 GO:GO:0005112 GO:GO:0055099 GO:GO:0004222 GO:GO:0002446 GO:GO:0035313 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GO:GO:0051088 GO:GO:0010820 GO:GO:0030574 GO:GO:0022617 GO:GO:0007220 MEROPS:M12.217 eggNOG:NOG269976 KO:K06059 OMA:KVCCRDE OrthoDB:EOG7S4X58 EMBL:U86755 EMBL:U69611 EMBL:U69612 EMBL:U92649 RefSeq:NP_003174.3 UniGene:Hs.404914 PDB:1BKC PDB:1ZXC PDB:2A8H PDB:2DDF PDB:2FV5 PDB:2FV9 PDB:2I47 PDB:2M2F PDB:2OI0 PDB:3B92 PDB:3CKI PDB:3E8R PDB:3EDZ PDB:3EWJ PDB:3G42 PDB:3KMC PDB:3KME PDB:3L0T PDB:3L0V PDB:3LE9 PDB:3LEA PDB:3LGP PDB:3O64 PDBsum:1BKC PDBsum:1ZXC PDBsum:2A8H PDBsum:2DDF PDBsum:2FV5 PDBsum:2FV9 PDBsum:2I47 PDBsum:2M2F PDBsum:2OI0 PDBsum:3B92 PDBsum:3CKI PDBsum:3E8R PDBsum:3EDZ PDBsum:3EWJ PDBsum:3G42 PDBsum:3KMC PDBsum:3KME PDBsum:3L0T PDBsum:3L0V PDBsum:3LE9 PDBsum:3LEA PDBsum:3LGP PDBsum:3O64 ProteinModelPortal:P78536 SMR:P78536 BioGrid:112731 IntAct:P78536 MINT:MINT-108290 STRING:9606.ENSP00000309968 BindingDB:P78536 ChEMBL:CHEMBL3706 GuidetoPHARMACOLOGY:1662 PhosphoSite:P78536 DMDM:14423632 PaxDb:P78536 PRIDE:P78536 DNASU:6868 Ensembl:ENST00000310823 GeneID:6868 KEGG:hsa:6868 UCSC:uc002qzu.3 CTD:6868 GeneCards:GC02M009580 HGNC:HGNC:195 HPA:CAB025906 HPA:HPA010738 HPA:HPA051575 MIM:603639 MIM:614328 neXtProt:NX_P78536 Orphanet:294023 PharmGKB:PA24512 HOGENOM:HOG000033797 HOVERGEN:HBG050457 InParanoid:P78536 PhylomeDB:P78536 BRENDA:3.4.24.86 SignaLink:P78536 ChiTaRS:ADAM17 EvolutionaryTrace:P78536 GeneWiki:ADAM17 GenomeRNAi:6868 NextBio:26807 PRO:PR:P78536 ArrayExpress:P78536 Bgee:P78536 CleanEx:HS_ADAM17 Genevestigator:P78536 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0060397 GO:GO:0031293 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 Uniprot:P78536) HSP 1 Score: 55.4546 bits (132), Expect = 2.672e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:Adam17 "Disintegrin and metalloproteinase domain-containing protein 17" species:10116 "Rattus norvegicus" [GO:0005112 "Notch binding" evidence=ISS] [GO:0007219 "Notch signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=ISS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0017124 "SH3 domain binding" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS00142 PROSITE:PS50215 RGD:620404 GO:GO:0016021 GO:GO:0005886 GO:GO:0043066 GO:GO:0009986 GO:GO:0008270 GO:GO:0007219 GO:GO:0005112 GO:GO:0004222 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GO:GO:0006509 GO:GO:0007220 MEROPS:M12.217 eggNOG:NOG269976 KO:K06059 CTD:6868 HOGENOM:HOG000033797 HOVERGEN:HBG050457 BRENDA:3.4.24.86 EMBL:AJ012603 RefSeq:NP_064702.1 UniGene:Rn.144585 ProteinModelPortal:Q9Z1K9 SMR:Q9Z1K9 IntAct:Q9Z1K9 STRING:10116.ENSRNOP00000010648 BindingDB:Q9Z1K9 ChEMBL:CHEMBL2523 PhosphoSite:Q9Z1K9 PaxDb:Q9Z1K9 GeneID:57027 KEGG:rno:57027 InParanoid:Q9Z1K9 NextBio:611284 PRO:PR:Q9Z1K9 Genevestigator:Q9Z1K9 Uniprot:Q9Z1K9) HSP 1 Score: 55.4546 bits (132), Expect = 2.676e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:Adam17 "ADAM metallopeptidase domain 17" species:10116 "Rattus norvegicus" [GO:0001666 "response to hypoxia" evidence=IEA;ISO] [GO:0001934 "positive regulation of protein phosphorylation" evidence=ISO] [GO:0002467 "germinal center formation" evidence=IEA;ISO] [GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISO;IMP] [GO:0005112 "Notch binding" evidence=IEA;ISO;ISS] [GO:0005138 "interleukin-6 receptor binding" evidence=IEA;ISO] [GO:0005178 "integrin binding" evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=IEA;ISO] [GO:0005886 "plasma membrane" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IEA;ISO] [GO:0005911 "cell-cell junction" evidence=IEA;ISO] [GO:0005925 "focal adhesion" evidence=IEA;ISO] [GO:0006508 "proteolysis" evidence=TAS] [GO:0006509 "membrane protein ectodomain proteolysis" evidence=IC;ISO;IMP;TAS] [GO:0007155 "cell adhesion" evidence=ISO] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA;ISO] [GO:0007219 "Notch signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=IEA;ISO;ISS] [GO:0007229 "integrin-mediated signaling pathway" evidence=IEA] [GO:0008237 "metallopeptidase activity" evidence=ISO;IMP] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA;ISO] [GO:0009986 "cell surface" evidence=IEA;ISO;IDA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IEA;ISO] [GO:0015629 "actin cytoskeleton" evidence=IEA;ISO] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA;ISO] [GO:0017124 "SH3 domain binding" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=IEA;ISO] [GO:0030183 "B cell differentiation" evidence=IEA;ISO] [GO:0030307 "positive regulation of cell growth" evidence=IEA;ISO] [GO:0030335 "positive regulation of cell migration" evidence=ISO] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IEA;ISO] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IEA;ISO] [GO:0032496 "response to lipopolysaccharide" evidence=IEA;ISO] [GO:0032587 "ruffle membrane" evidence=IEA;ISO] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IEA;ISO] [GO:0032722 "positive regulation of chemokine production" evidence=IEA;ISO] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IEA;ISO] [GO:0033077 "T cell differentiation in thymus" evidence=IEA;ISO] [GO:0033627 "cell adhesion mediated by integrin" evidence=IEA;ISO] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEA;ISO] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IEA;ISO] [GO:0042493 "response to drug" evidence=IEA;ISO] [GO:0043066 "negative regulation of apoptotic process" evidence=IDA] [GO:0045121 "membrane raft" evidence=IEA;ISO] [GO:0045741 "positive regulation of epidermal growth factor-activated receptor activity" evidence=ISO] [GO:0048536 "spleen development" evidence=IEA;ISO] [GO:0048870 "cell motility" evidence=ISO] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IEA;ISO] [GO:0051272 "positive regulation of cellular component movement" evidence=ISO] [GO:0055099 "response to high density lipoprotein particle" evidence=IEA;ISO] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS00142 PROSITE:PS50215 RGD:620404 GO:GO:0016021 GO:GO:0005886 GO:GO:0043066 GO:GO:0009986 GO:GO:0008270 GO:GO:0007219 GO:GO:0005112 GO:GO:0004222 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GO:GO:0006509 GO:GO:0007220 MEROPS:M12.217 eggNOG:NOG269976 KO:K06059 CTD:6868 HOGENOM:HOG000033797 HOVERGEN:HBG050457 BRENDA:3.4.24.86 EMBL:AJ012603 RefSeq:NP_064702.1 UniGene:Rn.144585 ProteinModelPortal:Q9Z1K9 SMR:Q9Z1K9 IntAct:Q9Z1K9 STRING:10116.ENSRNOP00000010648 BindingDB:Q9Z1K9 ChEMBL:CHEMBL2523 PhosphoSite:Q9Z1K9 PaxDb:Q9Z1K9 GeneID:57027 KEGG:rno:57027 InParanoid:Q9Z1K9 NextBio:611284 PRO:PR:Q9Z1K9 Genevestigator:Q9Z1K9 Uniprot:Q9Z1K9) HSP 1 Score: 55.4546 bits (132), Expect = 2.676e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:Adam17 "a disintegrin and metallopeptidase domain 17" species:10090 "Mus musculus" [GO:0001666 "response to hypoxia" evidence=ISO] [GO:0001934 "positive regulation of protein phosphorylation" evidence=ISO] [GO:0002467 "germinal center formation" evidence=IMP] [GO:0004222 "metalloendopeptidase activity" evidence=ISO] [GO:0005112 "Notch binding" evidence=ISO] [GO:0005138 "interleukin-6 receptor binding" evidence=ISO] [GO:0005178 "integrin binding" evidence=ISO] [GO:0005515 "protein binding" evidence=IPI] [GO:0005576 "extracellular region" evidence=IEA] [GO:0005737 "cytoplasm" evidence=ISO;IDA] [GO:0005886 "plasma membrane" evidence=ISO] [GO:0005887 "integral component of plasma membrane" evidence=ISO] [GO:0005911 "cell-cell junction" evidence=ISO] [GO:0005925 "focal adhesion" evidence=ISO] [GO:0006508 "proteolysis" evidence=IEA] [GO:0006509 "membrane protein ectodomain proteolysis" evidence=ISO;IMP] [GO:0007155 "cell adhesion" evidence=ISO] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=ISO] [GO:0007219 "Notch signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=ISO] [GO:0007229 "integrin-mediated signaling pathway" evidence=IEA] [GO:0008233 "peptidase activity" evidence=IEA] [GO:0008237 "metallopeptidase activity" evidence=ISO;IDA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=ISO] [GO:0009986 "cell surface" evidence=ISO] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=ISO] [GO:0015629 "actin cytoskeleton" evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=ISO] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0017124 "SH3 domain binding" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=ISO] [GO:0030183 "B cell differentiation" evidence=IMP] [GO:0030307 "positive regulation of cell growth" evidence=ISO] [GO:0030335 "positive regulation of cell migration" evidence=ISO] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IMP] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=ISO] [GO:0032496 "response to lipopolysaccharide" evidence=ISO] [GO:0032587 "ruffle membrane" evidence=ISO] [GO:0032717 "negative regulation of interleukin-8 production" evidence=ISO] [GO:0032722 "positive regulation of chemokine production" evidence=ISO] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IMP] [GO:0033077 "T cell differentiation in thymus" evidence=IMP] [GO:0033627 "cell adhesion mediated by integrin" evidence=ISO] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0042493 "response to drug" evidence=IMP] [GO:0043066 "negative regulation of apoptotic process" evidence=ISO] [GO:0045121 "membrane raft" evidence=ISO] [GO:0045741 "positive regulation of epidermal growth factor-activated receptor activity" evidence=ISO] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048536 "spleen development" evidence=IMP] [GO:0048870 "cell motility" evidence=IMP] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=ISO;IDA] [GO:0051272 "positive regulation of cellular component movement" evidence=IMP] [GO:0055099 "response to high density lipoprotein particle" evidence=ISO] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS00142 PROSITE:PS50215 MGI:MGI:1096335 GO:GO:0005886 GO:GO:0005737 GO:GO:0007173 GO:GO:0005576 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0007219 GO:GO:0032722 GO:GO:0005112 GO:GO:0005911 GO:GO:0005925 Reactome:REACT_188257 GO:GO:0055099 GO:GO:0004222 GO:GO:0051272 GO:GO:0035313 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0051088 GO:GO:0010820 GO:GO:0007220 Reactome:REACT_189085 MEROPS:M12.217 eggNOG:NOG269976 KO:K06059 CTD:6868 HOGENOM:HOG000033797 HOVERGEN:HBG050457 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 EMBL:AF056359 EMBL:AF056345 EMBL:AF056346 EMBL:AF056347 EMBL:AF056348 EMBL:AF056349 EMBL:AF056350 EMBL:AF056351 EMBL:AF056352 EMBL:AF056353 EMBL:AF056354 EMBL:AF056355 EMBL:AF056356 EMBL:AF056357 EMBL:AF056358 EMBL:AJ007365 EMBL:AB021709 EMBL:U69613 EMBL:U69614 EMBL:AK139471 EMBL:BC094655 RefSeq:NP_001264195.1 RefSeq:NP_033745.4 UniGene:Mm.27681 ProteinModelPortal:Q9Z0F8 SMR:Q9Z0F8 IntAct:Q9Z0F8 MINT:MINT-246289 BindingDB:Q9Z0F8 ChEMBL:CHEMBL4379 PhosphoSite:Q9Z0F8 PaxDb:Q9Z0F8 PRIDE:Q9Z0F8 Ensembl:ENSMUST00000064536 Ensembl:ENSMUST00000145118 GeneID:11491 KEGG:mmu:11491 UCSC:uc007ndu.1 Reactome:REACT_98458 NextBio:278866 PMAP-CutDB:Q505A7 PRO:PR:Q9Z0F8 ArrayExpress:Q9Z0F8 Bgee:Q9Z0F8 CleanEx:MM_ADAM17 Genevestigator:Q9Z0F8 GO:GO:0032587 GO:GO:0048870 Uniprot:Q9Z0F8) HSP 1 Score: 55.4546 bits (132), Expect = 2.676e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:Adam17 "A disintegrin and metalloproteinase domain 17 (Tumor necrosis factor, alpha, converting enzyme), isoform CRA_a" species:10116 "Rattus norvegicus" [GO:0001666 "response to hypoxia" evidence=IEA] [GO:0002467 "germinal center formation" evidence=IEA] [GO:0004222 "metalloendopeptidase activity" evidence=IEA] [GO:0005138 "interleukin-6 receptor binding" evidence=IEA] [GO:0005178 "integrin binding" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA] [GO:0007229 "integrin-mediated signaling pathway" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IEA] [GO:0015629 "actin cytoskeleton" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=IEA] [GO:0030183 "B cell differentiation" evidence=IEA] [GO:0030307 "positive regulation of cell growth" evidence=IEA] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IEA] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IEA] [GO:0032496 "response to lipopolysaccharide" evidence=IEA] [GO:0032587 "ruffle membrane" evidence=IEA] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IEA] [GO:0032722 "positive regulation of chemokine production" evidence=IEA] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IEA] [GO:0033077 "T cell differentiation in thymus" evidence=IEA] [GO:0033627 "cell adhesion mediated by integrin" evidence=IEA] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEA] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0042493 "response to drug" evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0048536 "spleen development" evidence=IEA] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IEA] [GO:0055099 "response to high density lipoprotein particle" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS50215 RGD:620404 GO:GO:0005737 GO:GO:0007173 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0032722 GO:GO:0005911 GO:GO:0005925 GO:GO:0055099 GO:GO:0004222 GO:GO:0035313 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0051088 GO:GO:0010820 GO:GO:0007229 MEROPS:M12.217 OMA:KVCCRDE OrthoDB:EOG7S4X58 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 GO:GO:0032587 UniGene:Rn.144585 EMBL:CH473947 EMBL:AABR06043295 Ensembl:ENSRNOT00000010648 NextBio:35583839 PRO:PR:G3V711 Uniprot:G3V711) HSP 1 Score: 55.0694 bits (131), Expect = 2.775e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:ADAM17 "Disintegrin and metalloproteinase domain-containing protein 17" species:9823 "Sus scrofa" [GO:0004222 "metalloendopeptidase activity" evidence=IEA] [GO:0005576 "extracellular region" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS50215 GO:GO:0005576 GO:GO:0006508 GO:GO:0008270 GO:GO:0004222 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 OrthoDB:EOG7S4X58 EMBL:FP312696 Ensembl:ENSSSCT00000009451 OMA:HASTHLE Uniprot:F1SA97) HSP 1 Score: 53.9138 bits (128), Expect = 6.369e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:ADAM17 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0001666 "response to hypoxia" evidence=IEA] [GO:0002467 "germinal center formation" evidence=IEA] [GO:0004222 "metalloendopeptidase activity" evidence=IEA] [GO:0005112 "Notch binding" evidence=IEA] [GO:0005138 "interleukin-6 receptor binding" evidence=IEA] [GO:0005178 "integrin binding" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IEA] [GO:0015629 "actin cytoskeleton" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=IEA] [GO:0030183 "B cell differentiation" evidence=IEA] [GO:0030307 "positive regulation of cell growth" evidence=IEA] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IEA] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IEA] [GO:0032496 "response to lipopolysaccharide" evidence=IEA] [GO:0032587 "ruffle membrane" evidence=IEA] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IEA] [GO:0032722 "positive regulation of chemokine production" evidence=IEA] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IEA] [GO:0033077 "T cell differentiation in thymus" evidence=IEA] [GO:0033627 "cell adhesion mediated by integrin" evidence=IEA] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEA] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0042493 "response to drug" evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0048536 "spleen development" evidence=IEA] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IEA] [GO:0055099 "response to high density lipoprotein particle" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS50215 GO:GO:0005737 GO:GO:0007173 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0032722 GO:GO:0005911 GO:GO:0005925 GO:GO:0055099 GO:GO:0004222 GO:GO:0035313 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0051088 GO:GO:0010820 eggNOG:NOG269976 OrthoDB:EOG7S4X58 HOGENOM:HOG000033797 HOVERGEN:HBG050457 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 GO:GO:0032587 EMBL:AADN03003133 EMBL:AY486557 UniGene:Gga.7793 ProteinModelPortal:Q5QHR9 SMR:Q5QHR9 STRING:9031.ENSGALP00000026450 Ensembl:ENSGALT00000031606 Uniprot:Q5QHR9) HSP 1 Score: 54.299 bits (129), Expect = 6.401e-8 Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 0 Query: 54 HEILHSFGAEHDT---PGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK-NGCLK 117 HE+ H+FGAEHD P C+P +++ G Y+M P +G NN++ SSCS ++ + I K C K Sbjct: 405 HELGHNFGAEHDPDSLPECAPTEDQ-GGKYVMYPIAVSGDHENNKMFSSCSKKSIHRTIEVKAQECFK 471
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:Tace "Tace" species:7227 "Drosophila melanogaster" [GO:0004222 "metalloendopeptidase activity" evidence=ISS;IDA;NAS] [GO:0006508 "proteolysis" evidence=NAS] [GO:0008270 "zinc ion binding" evidence=IEA;NAS] [GO:0006509 "membrane protein ectodomain proteolysis" evidence=ISS;IDA] [GO:0016021 "integral component of membrane" evidence=ISS] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS00142 PROSITE:PS50215 EMBL:AE014297 GO:GO:0016021 GO:GO:0008270 GO:GO:0004222 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0006509 EMBL:AY212802 EMBL:AY525768 EMBL:AY061030 EMBL:BT003184 RefSeq:NP_651759.4 RefSeq:NP_733334.1 UniGene:Dm.6531 ProteinModelPortal:Q9VAC5 SMR:Q9VAC5 MEROPS:M12.217 PaxDb:Q9VAC5 EnsemblMetazoa:FBtr0085551 GeneID:43558 KEGG:dme:Dmel_CG7908 UCSC:CG7908-RA CTD:43558 FlyBase:FBgn0039734 eggNOG:NOG269976 InParanoid:Q9VAC5 KO:K06059 OMA:KVCCRDE OrthoDB:EOG7S4X58 PhylomeDB:Q9VAC5 SignaLink:Q9VAC5 GenomeRNAi:43558 NextBio:834538 PRO:PR:Q9VAC5 Bgee:Q9VAC5 Uniprot:Q9VAC5) HSP 1 Score: 53.9138 bits (128), Expect = 6.889e-8 Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GS+LM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 391 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSG 460
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:ADAM17 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0001666 "response to hypoxia" evidence=IEA] [GO:0002467 "germinal center formation" evidence=IEA] [GO:0004222 "metalloendopeptidase activity" evidence=IEA] [GO:0005112 "Notch binding" evidence=IEA] [GO:0005138 "interleukin-6 receptor binding" evidence=IEA] [GO:0005178 "integrin binding" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IEA] [GO:0015629 "actin cytoskeleton" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=IEA] [GO:0030183 "B cell differentiation" evidence=IEA] [GO:0030307 "positive regulation of cell growth" evidence=IEA] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IEA] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IEA] [GO:0032496 "response to lipopolysaccharide" evidence=IEA] [GO:0032587 "ruffle membrane" evidence=IEA] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IEA] [GO:0032722 "positive regulation of chemokine production" evidence=IEA] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IEA] [GO:0033077 "T cell differentiation in thymus" evidence=IEA] [GO:0033627 "cell adhesion mediated by integrin" evidence=IEA] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEA] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0042493 "response to drug" evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0048536 "spleen development" evidence=IEA] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IEA] [GO:0055099 "response to high density lipoprotein particle" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS50215 GO:GO:0005737 GO:GO:0007173 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0032722 GO:GO:0005911 GO:GO:0005925 GO:GO:0055099 GO:GO:0004222 GO:GO:0035313 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0051088 GO:GO:0010820 KO:K06059 OMA:KVCCRDE OrthoDB:EOG7S4X58 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 GO:GO:0032587 EMBL:AAEX03010701 EMBL:AAEX03010702 RefSeq:NP_001273795.1 UniGene:Cfa.23330 Ensembl:ENSCAFT00000005426 GeneID:475662 Uniprot:F1PFZ9) HSP 1 Score: 53.9138 bits (128), Expect = 8.080e-8 Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKN 113 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK+ Sbjct: 401 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKS 462
BLAST of EMLSAG00000002364 vs. GO
Match: - (symbol:ADAM17 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0001666 "response to hypoxia" evidence=IEA] [GO:0002467 "germinal center formation" evidence=IEA] [GO:0004222 "metalloendopeptidase activity" evidence=IEA] [GO:0005112 "Notch binding" evidence=IEA] [GO:0005138 "interleukin-6 receptor binding" evidence=IEA] [GO:0005178 "integrin binding" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0005911 "cell-cell junction" evidence=IEA] [GO:0005925 "focal adhesion" evidence=IEA] [GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA] [GO:0007220 "Notch receptor processing" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0009986 "cell surface" evidence=IEA] [GO:0010820 "positive regulation of T cell chemotaxis" evidence=IEA] [GO:0015629 "actin cytoskeleton" evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA] [GO:0030165 "PDZ domain binding" evidence=IEA] [GO:0030183 "B cell differentiation" evidence=IEA] [GO:0030307 "positive regulation of cell growth" evidence=IEA] [GO:0030511 "positive regulation of transforming growth factor beta receptor signaling pathway" evidence=IEA] [GO:0031659 "positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle" evidence=IEA] [GO:0032496 "response to lipopolysaccharide" evidence=IEA] [GO:0032587 "ruffle membrane" evidence=IEA] [GO:0032717 "negative regulation of interleukin-8 production" evidence=IEA] [GO:0032722 "positive regulation of chemokine production" evidence=IEA] [GO:0033025 "regulation of mast cell apoptotic process" evidence=IEA] [GO:0033077 "T cell differentiation in thymus" evidence=IEA] [GO:0033627 "cell adhesion mediated by integrin" evidence=IEA] [GO:0035313 "wound healing, spreading of epidermal cells" evidence=IEA] [GO:0035625 "epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0042493 "response to drug" evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0048536 "spleen development" evidence=IEA] [GO:0051088 "PMA-inducible membrane protein ectodomain proteolysis" evidence=IEA] [GO:0055099 "response to high density lipoprotein particle" evidence=IEA] InterPro:IPR001590 InterPro:IPR002870 InterPro:IPR024079 Pfam:PF01562 PROSITE:PS50215 GO:GO:0005737 GO:GO:0007173 GO:GO:0030307 GO:GO:0009986 GO:GO:0005887 GO:GO:0045121 GO:GO:0042493 GO:GO:0015629 GO:GO:0016324 GO:GO:0008284 GO:GO:0008270 GO:GO:0032496 GO:GO:0001666 GO:GO:0032722 GO:GO:0005911 GO:GO:0005925 GO:GO:0055099 GO:GO:0004222 GO:GO:0035313 TreeFam:TF314733 Gene3D:3.40.390.10 Gene3D:4.10.70.10 InterPro:IPR001762 Pfam:PF00200 SMART:SM00050 SUPFAM:SSF57552 PROSITE:PS50214 GeneTree:ENSGT00670000097974 GO:GO:0051088 GO:GO:0010820 OMA:KVCCRDE OrthoDB:EOG7S4X58 GO:GO:0030183 GO:GO:0033627 GO:GO:0035625 GO:GO:0002467 GO:GO:0032717 GO:GO:0031659 GO:GO:0030511 GO:GO:0033025 GO:GO:0048536 GO:GO:0033077 GO:GO:0032587 EMBL:DAAA02031941 Ensembl:ENSBTAT00000065783 Uniprot:G3MZB3) HSP 1 Score: 53.9138 bits (128), Expect = 8.626e-8 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 406 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 466
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Match: gi|592798388|gb|GAXK01156180.1| (TSA: Calanus finmarchicus comp284459_c1_seq2 transcribed RNA sequence) HSP 1 Score: 33.8834 bits (76), Expect = 9.110e-2 Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 0 Query: 28 NTLFITTRRREDPKCLNLRMTILNLG---HEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNN 94 N + T R+ +CLNL + ++ G HE+LHS G EH+ P SP D GS L+ P + + S + Sbjct: 370 NRCYATVGRKGGMQCLNLDKSCMSNGTIVHELLHSMGFEHEHVRPHNSPFDL---GSVLLYPPAQSKQFSKD 576
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Match: gi|592950324|gb|GAXK01008229.1| (TSA: Calanus finmarchicus comp136904_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.4982 bits (75), Expect = 1.299e-1 Identity = 20/59 (33.90%), Postives = 32/59 (54.24%), Query Frame = 0 Query: 48 TILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVR 106 +I+ L HE+ HS GA+HD +DE+ +Y+M+ +T S E S CS ++ Sbjct: 833 SIITLAHELGHSLGAQHDE---DVKDEDCGQNYIMA---ATMNDSLVEEFSGCSARTMQ 991
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Match: gi|592819780|gb|GAXK01134788.1| (TSA: Calanus finmarchicus comp704460_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 1.640e-1 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 48 TILNLGHEILHSFGAEHD---TPG--CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISS 111 ++ + HE+ H+ G HD T G CSP+ +LMSP GK + S CS S + +F++S Sbjct: 1004 SVFVIAHEMGHNLGMNHDGETTEGNLCSPD------KFLMSPVLGPGKVT----WSDCSNSELNQFLTS 1180
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Match: gi|592751996|gb|GAXK01202417.1| (TSA: Calanus finmarchicus comp87100_c0_seq1 transcribed RNA sequence) HSP 1 Score: 32.3426 bits (72), Expect = 3.633e-1 Identity = 30/94 (31.91%), Postives = 45/94 (47.87%), Query Frame = 0 Query: 27 FNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHD---TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFIS-SKNGCL 116 FNT ++ R + L+L + HE+ HSFGA HD C+P +E G++LM P G S S CS + K + +++ CL Sbjct: 521 FNTGLVSFRHLGNQ--LSLADSQETFMHELGHSFGAAHDPKEDDKCAPGGKE--GNFLMYP-GPLGNSFIRREFSQCSKFEIAKVLDETEHSCL 787
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Match: gi|592899754|gb|GAXK01058621.1| (TSA: Calanus finmarchicus comp588319_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 5.749e-1 Identity = 23/77 (29.87%), Postives = 39/77 (50.65%), Query Frame = 0 Query: 48 TILNLGHEILHSFGAEHDTPGCSPEDEEIN---GSYLMSPYTSTGKSSNNELLSSCSISAVRKFISS-----KNGCL 116 +++ L HEI H+FGA HD ED N +Y+M+ +G S + S CS++ ++ +S+ + GC Sbjct: 783 SVMTLAHEIGHNFGAYHD------EDTTCNYKPNNYIMA---MSGSSLEHPEFSPCSLNDMQDRMSTILRNQEKGCF 986
BLAST of EMLSAG00000002364 vs. L. salmonis peptides
Match: EMLSAP00000002364 (pep:novel supercontig:LSalAtl2s:LSalAtl2s144:982912:985173:1 gene:EMLSAG00000002364 transcript:EMLSAT00000002364 description:"maker-LSalAtl2s144-augustus-gene-10.16") HSP 1 Score: 249.21 bits (635), Expect = 4.365e-86 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 0 Query: 1 MGKIISIVWKIRPHVHDLFLQYKGYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNGCLKILK 120 MGKIISIVWKIRPHVHDLFLQYKGYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNGCLKILK Sbjct: 1 MGKIISIVWKIRPHVHDLFLQYKGYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNGCLKILK 120
BLAST of EMLSAG00000002364 vs. L. salmonis peptides
Match: EMLSAP00000008968 (pep:novel supercontig:LSalAtl2s:LSalAtl2s55:295607:297551:-1 gene:EMLSAG00000008968 transcript:EMLSAT00000008968 description:"maker-LSalAtl2s55-augustus-gene-3.14") HSP 1 Score: 83.1889 bits (204), Expect = 1.569e-19 Identity = 46/102 (45.10%), Postives = 65/102 (63.73%), Query Frame = 0 Query: 24 GYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHD-----TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISS--KNGCLKI 118 YSFN LFI+ + ++ + + LRM +LNL HE+LHSFGA HD P C P+D+ ING YLMS Y++ G N+E+LS C+ AV + + S + CL + Sbjct: 383 AYSFNALFISLKSSQEHR-IPLRMGVLNLVHELLHSFGARHDPEPAQNPSCVPKDKWINGRYLMSKYSNDGHKLNHEILSPCTEMAVIENLKSHHRTKCLTL 483
BLAST of EMLSAG00000002364 vs. L. salmonis peptides
Match: EMLSAP00000009451 (pep:novel supercontig:LSalAtl2s:LSalAtl2s607:176320:181083:1 gene:EMLSAG00000009451 transcript:EMLSAT00000009451 description:"augustus_masked-LSalAtl2s607-processed-gene-1.1") HSP 1 Score: 47.3654 bits (111), Expect = 2.697e-7 Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKN 113 R L HE H++G+EHD + CSP + GSYLM Y+ +G NN+ S CS+ +RK + +K+ Sbjct: 235 READLVTAHEFGHNWGSEHDPDSSECSPSASQ-GGSYLMYTYSVSGYDINNKKFSPCSLRFIRKVLLAKS 303
BLAST of EMLSAG00000002364 vs. SwissProt
Match: gi|14423632|sp|P78536.1|ADA17_HUMAN (RecName: Full=Disintegrin and metalloproteinase domain-containing protein 17; Short=ADAM 17; AltName: Full=Snake venom-like protease; AltName: Full=TNF-alpha convertase; AltName: Full=TNF-alpha-converting enzyme; AltName: CD_antigen=CD156b; Flags: Precursor) HSP 1 Score: 55.4546 bits (132), Expect = 7.279e-9 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. SwissProt
Match: gi|14423630|sp|Q9Z1K9.1|ADA17_RAT (RecName: Full=Disintegrin and metalloproteinase domain-containing protein 17; Short=ADAM 17; AltName: Full=TNF-alpha convertase; AltName: Full=TNF-alpha-converting enzyme; AltName: CD_antigen=CD156b; Flags: Precursor) HSP 1 Score: 55.4546 bits (132), Expect = 7.281e-9 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. SwissProt
Match: gi|341940611|sp|Q9Z0F8.3|ADA17_MOUSE (RecName: Full=Disintegrin and metalloproteinase domain-containing protein 17; Short=ADAM 17; AltName: Full=TNF-alpha convertase; AltName: Full=TNF-alpha-converting enzyme; AltName: CD_antigen=CD156b; Flags: Precursor) HSP 1 Score: 55.4546 bits (132), Expect = 7.281e-9 Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P +E+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 405 HELGHNFGAEHDPDGLAECAP-NEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 465
BLAST of EMLSAG00000002364 vs. SwissProt
Match: gi|47117671|sp|Q9VAC5.2|ADA17_DROME (RecName: Full=ADAM 17-like protease; Flags: Precursor) HSP 1 Score: 53.9138 bits (128), Expect = 2.072e-8 Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GS+LM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 391 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSG 460
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: gb|EEZ98535.2| (ADAM 17-like protease [Tribolium castaneum]) HSP 1 Score: 55.4546 bits (132), Expect = 3.226e-9 Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 388 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 457
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: gb|KYB29228.1| (ADAM 17-like protease [Tribolium castaneum]) HSP 1 Score: 54.299 bits (129), Expect = 7.669e-9 Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHDT--PGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 34 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 103
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: EAA08066.5 (AGAP002381-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 53.9138 bits (128), Expect = 9.325e-9 Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GS+LM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 421 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSG 490
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: AAF56986.2 (tace, isoform A [Drosophila melanogaster]) HSP 1 Score: 53.9138 bits (128), Expect = 1.004e-8 Identity = 28/71 (39.44%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GS+LM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 391 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSG 460
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: XP_394087.5 (PREDICTED: disintegrin and metalloproteinase domain-containing protein 10-like isoform X2 [Apis mellifera]) HSP 1 Score: 52.7582 bits (125), Expect = 2.686e-8 Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 0 Query: 50 LNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK----NGCL 116 + L HEI H+FG+ HD C+P E+ G+++M ++G NN S CS+SA+ ++SK GC Sbjct: 480 VTLAHEIGHNFGSPHDPEQCTPGGED--GNFIMFARATSGDKRNNNRFSPCSLSAINPVLNSKARSPKGCF 548
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: XP_016772087.1 (PREDICTED: disintegrin and metalloproteinase domain-containing protein 10-like isoform X1 [Apis mellifera]) HSP 1 Score: 52.7582 bits (125), Expect = 2.687e-8 Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 0 Query: 50 LNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK----NGCL 116 + L HEI H+FG+ HD C+P E+ G+++M ++G NN S CS+SA+ ++SK GC Sbjct: 481 VTLAHEIGHNFGSPHDPEQCTPGGED--GNFIMFARATSGDKRNNNRFSPCSLSAINPVLNSKARSPKGCF 549
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: EEB10207.1 (adam, putative [Pediculus humanus corporis]) HSP 1 Score: 52.373 bits (124), Expect = 3.827e-8 Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 410 READLVTAHEFGHNWGSEHDPDITECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 479
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: XP_623993.3 (PREDICTED: ADAM 17-like protease [Apis mellifera]) HSP 1 Score: 52.373 bits (124), Expect = 4.017e-8 Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 397 READLVTAHEFGHNWGSEHDPDITECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 466
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: EFX84833.1 (hypothetical protein DAPPUDRAFT_314368 [Daphnia pulex]) HSP 1 Score: 51.6026 bits (122), Expect = 6.596e-8 Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHDT--PGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE+ H++G+EHD P CSP + GSYLM Y+ +G NN+ S CS+ ++R + +K G Sbjct: 412 READLVTAHELGHNWGSEHDPDLPECSPPASQ-GGSYLMYTYSVSGYDVNNKKFSPCSLRSIRAVLLAKAG 481
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Match: EAA08447.6 (AGAP003070-PA [Anopheles gambiae str. PEST]) HSP 1 Score: 50.0618 bits (118), Expect = 2.689e-7 Identity = 24/71 (33.80%), Postives = 39/71 (54.93%), Query Frame = 0 Query: 50 LNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK----NGCL 116 + L HEI H+FG+ HD C+P E+ G+++M ++G NN S CS+ A+ +++K GC Sbjct: 586 VTLAHEIGHNFGSPHDPEQCTPGGED--GNFIMFARATSGDKRNNNRFSPCSLKAIEPVLNAKARSAKGCF 654
BLAST of EMLSAG00000002364 vs. nr
Match: gi|762117669|ref|XP_011441696.1| (PREDICTED: ADAM 17-like protease [Crassostrea gigas]) HSP 1 Score: 68.5514 bits (166), Expect = 3.833e-11 Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 0 Query: 20 LQYKGY--SFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKN-GCL 116 Q +GY +FNT + + + E + L+L ++ + HE+ H++G+EHD TPGC+P E+ G YLM PY+ +G NN++ SSCS + I SK GC Sbjct: 363 FQSQGYETTFNTGWSSAQNSEGDRVLSLEAALV-IAHELGHNWGSEHDPDTPGCAPGVEK-GGKYLMYPYSVSGYEHNNQIFSSCSRRYIYNVIKSKGPGCF 462
BLAST of EMLSAG00000002364 vs. nr
Match: gi|926646194|ref|XP_013789433.1| (PREDICTED: disintegrin and metalloproteinase domain-containing protein 10-like, partial [Limulus polyphemus]) HSP 1 Score: 63.5438 bits (153), Expect = 2.191e-9 Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 0 Query: 26 SFNTLFITTR--RREDPKCLNLRMTILNLGHEILHSFGAEHDT---PGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 S+NTL +TT+ R PK T L + HE HSFG+ HD+ P CSP + G ++M+PY++ G N++L SSC+ +A+ I +K Sbjct: 334 SYNTLIVTTKHNNRPSPKA----TTALTVTHEFGHSFGSPHDSTSNPKCSPGG--VKGQFIMNPYSNDGSKVNHKLFSSCTRAAIAPVIQTK 419
BLAST of EMLSAG00000002364 vs. nr
Match: gi|999969453|gb|KXJ08627.1| (Disintegrin and metalloproteinase domain-containing protein 10 [Exaiptasia pallida]) HSP 1 Score: 60.4622 bits (145), Expect = 2.366e-8 Identity = 34/93 (36.56%), Postives = 55/93 (59.14%), Query Frame = 0 Query: 24 GYSFNTLFITTR---RREDPKCLNLRMTILNLGHEILHSFGAEHDTPG-CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 G S+NT +TT+ R P R++ + HE+ H FG++HD G CSP + NG+Y+M ++G SNN+ S CS++A+R +++K Sbjct: 333 GKSYNTGIVTTKLYGRFTPP-----RISEVTFAHELGHGFGSQHDPEGTCSPGGK--NGNYIMYSKATSGDRSNNDKFSPCSLTAIRDNVNAK 418
BLAST of EMLSAG00000002364 vs. nr
Match: gi|762118072|ref|XP_011441911.1| (PREDICTED: ADAM 17-like protease [Crassostrea gigas]) HSP 1 Score: 60.4622 bits (145), Expect = 3.084e-8 Identity = 39/93 (41.94%), Postives = 54/93 (58.06%), Query Frame = 0 Query: 26 SFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHD-TPG-CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNGCL 116 S NT F +T L+ R L HE+ H++G+EHD T G C+P G YLM PY+ +G SNN+ SSCSI+ + + +S+K GCL Sbjct: 357 SLNTGFTSTMYSSGSTVLS-RQAELVTAHELGHNWGSEHDPTSGDCAPF--FFGGKYLMYPYSVSGDDSNNDKFSSCSINYISRVLSTKIGCL 446
BLAST of EMLSAG00000002364 vs. nr
Match: gi|260825444|ref|XP_002607676.1| (hypothetical protein BRAFLDRAFT_82878 [Branchiostoma floridae] >gi|229293025|gb|EEN63686.1| hypothetical protein BRAFLDRAFT_82878 [Branchiostoma floridae]) HSP 1 Score: 58.9214 bits (141), Expect = 8.923e-8 Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 0 Query: 22 YKGYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 +K SFNT +T R ++ +TI+++ HE H FG+ HD C P + G+Y+M PY + G+ NN+ S CS ++R ++ K Sbjct: 139 WKERSFNTAMVTFDRHGSQ--MSRAVTIISVVHEFGHGFGSPHDPEECRPGGAQ--GNYVMYPYATDGRKPNNDDFSVCSKQSMRPVMAIK 225
BLAST of EMLSAG00000002364 vs. nr
Match: gi|913321019|ref|XP_013191652.1| (PREDICTED: disintegrin and metalloproteinase domain-containing protein 10-like [Amyelois transitella]) HSP 1 Score: 58.5362 bits (140), Expect = 1.246e-7 Identity = 38/93 (40.86%), Postives = 50/93 (53.76%), Query Frame = 0 Query: 24 GYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNGCL 116 G SFNTL I ED + + R+ L L HE+ HSFGA HD +PE +LMS +STG+SS + S CS + +SS + CL Sbjct: 245 GRSFNTLAIAHATTEDKQRVPERVAGLTLAHEMGHSFGAHHDDNFPNPECR----GFLMSAQSSTGESSMHFEFSVCSKRRIAATLSSMSYCL 333
BLAST of EMLSAG00000002364 vs. nr
Match: gi|340380949|ref|XP_003388984.1| (PREDICTED: disintegrin and metalloproteinase domain-containing protein 10-like [Amphimedon queenslandica]) HSP 1 Score: 58.151 bits (139), Expect = 1.770e-7 Identity = 36/101 (35.64%), Postives = 52/101 (51.49%), Query Frame = 0 Query: 22 YKGYSFNTLFITTRRREDPKCLNLRMTILNLGHEILHSFGAEHDTPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK-----NGCLK 117 Y G + NT +T + + N T L HE H+FG+EHD C+P D Y+M+ + + G SNN+ S CSI A++ I+SK NGC + Sbjct: 355 YGGKTLNTGVVTMVNY-NQRVSNAAAT-LTFAHEAGHNFGSEHDMGSCNPSDNP----YIMTAFANDGTKSNNDNFSPCSIDAMKVIIASKGQDRRNGCFR 449
BLAST of EMLSAG00000002364 vs. nr
Match: gi|1059410556|ref|XP_017778198.1| (PREDICTED: ADAM 17-like protease isoform X2 [Nicrophorus vespilloides]) HSP 1 Score: 56.9954 bits (136), Expect = 4.104e-7 Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 390 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 459
BLAST of EMLSAG00000002364 vs. nr
Match: gi|1059410554|ref|XP_017778197.1| (PREDICTED: ADAM 17-like protease isoform X1 [Nicrophorus vespilloides]) HSP 1 Score: 56.9954 bits (136), Expect = 4.105e-7 Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKNG 114 R L HE H++G+EHD P CSP + GSYLM Y+ +G NN+ S CS+ ++RK + +K+G Sbjct: 393 READLVTAHEFGHNWGSEHDPDIPECSPSASQ-GGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSG 462
BLAST of EMLSAG00000002364 vs. nr
Match: gi|847016664|ref|XP_012804599.1| (PREDICTED: disintegrin and metalloproteinase domain-containing protein 17 isoform X1 [Jaculus jaculus]) HSP 1 Score: 56.9954 bits (136), Expect = 4.353e-7 Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 54 HEILHSFGAEHDTPG---CSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSK 112 HE+ H+FGAEHD G C+P DE+ G Y+M P +G NN++ S+CS ++ K I SK Sbjct: 242 HELGHNFGAEHDPDGLAECAP-DEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESK 302
BLAST of EMLSAG00000002364 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold698_size109766-snap-gene-0.16 (protein:Tk05780 transcript:maker-scaffold698_size109766-snap-gene-0.16-mRNA-1 annotation:"AGAP002381-PA") HSP 1 Score: 47.7506 bits (112), Expect = 1.244e-7 Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 0 Query: 46 RMTILNLGHEILHSFGAEHD--TPGCSPEDEEINGSYLMSPYTSTGKSSNNELLSSCSISAVRKFISSKN 113 R L HE H++G+EHD + CSP + GSYLM Y+ +G NN+ S CS+ +RK + +K+ Sbjct: 435 READLVTAHEFGHNWGSEHDPDSSECSPSASQ-GGSYLMYTYSVSGYDVNNKKFSPCSLRFIRKVLLAKS 503 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002364 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000002364 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000002364 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 3
BLAST of EMLSAG00000002364 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 4
BLAST of EMLSAG00000002364 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 16
Pagesback to top
BLAST of EMLSAG00000002364 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 20
Pagesback to top
BLAST of EMLSAG00000002364 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s144:982912..985173+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002364-685130 ID=EMLSAG00000002364-685130|Name=EMLSAG00000002364|organism=Lepeophtheirus salmonis|type=gene|length=2262bp|location=Sequence derived from alignment at LSalAtl2s144:982912..985173+ (Lepeophtheirus salmonis)back to top Add to Basket
|