EMLSAG00000002921, EMLSAG00000002921-685687 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592784573|gb|GAXK01169995.1| (TSA: Calanus finmarchicus comp59_c1_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 1.718e-1 Identity = 17/29 (58.62%), Postives = 19/29 (65.52%), Query Frame = 0 Query: 22 QVTNLWGRETF---EVEMKAKADRDKASP 47 VT+L GRET MK KADRD+ASP Sbjct: 379 HVTDLSGRETICRVTGGMKVKADRDEASP 465
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592952839|gb|GAXK01005714.1| (TSA: Calanus finmarchicus comp235921_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 5.462e+0 Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 0 Query: 12 TPSPHSTLLFQVTNLWGRET 31 TPS HS++L QV LW T Sbjct: 38 TPSLHSSMLSQVLQLWSHAT 97
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592860589|gb|GAXK01096973.1| (TSA: Calanus finmarchicus comp55365_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 6.223e+0 Identity = 8/24 (33.33%), Postives = 14/24 (58.33%), Query Frame = 0 Query: 7 ESKMPTPSPHSTLLFQVTNLWGRE 30 +MP+P PH+ L+ + N W + Sbjct: 1583 RGRMPSPGPHTPLMMKTDNSWAQR 1654
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592793630|gb|GAXK01160938.1| (TSA: Calanus finmarchicus comp502165_c0_seq8 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.360e+0 Identity = 15/43 (34.88%), Postives = 22/43 (51.16%), Query Frame = 0 Query: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKA-KADR 42 + + ++ES + TPS H + VTN W T V + K DR Sbjct: 1632 LFSALNESILETPSMHESSFISVTNPWAMVTVPVYRRVTKLDR 1760
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592793631|gb|GAXK01160937.1| (TSA: Calanus finmarchicus comp502165_c0_seq7 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.364e+0 Identity = 15/43 (34.88%), Postives = 22/43 (51.16%), Query Frame = 0 Query: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKA-KADR 42 + + ++ES + TPS H + VTN W T V + K DR Sbjct: 1644 LFSALNESILETPSMHESSFISVTNPWAMVTVPVYRRVTKLDR 1772
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592793634|gb|GAXK01160934.1| (TSA: Calanus finmarchicus comp502165_c0_seq4 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.392e+0 Identity = 15/43 (34.88%), Postives = 22/43 (51.16%), Query Frame = 0 Query: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKA-KADR 42 + + ++ES + TPS H + VTN W T V + K DR Sbjct: 1742 LFSALNESILETPSMHESSFISVTNPWAMVTVPVYRRVTKLDR 1870
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592793636|gb|GAXK01160932.1| (TSA: Calanus finmarchicus comp502165_c0_seq2 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 7.395e+0 Identity = 15/43 (34.88%), Postives = 22/43 (51.16%), Query Frame = 0 Query: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKA-KADR 42 + + ++ES + TPS H + VTN W T V + K DR Sbjct: 1754 LFSALNESILETPSMHESSFISVTNPWAMVTVPVYRRVTKLDR 1882
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Match: gi|592906044|gb|GAXK01052331.1| (TSA: Calanus finmarchicus comp2128137_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 9.634e+0 Identity = 10/27 (37.04%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 14 SPHSTLLFQVTNLWGRETFEVEMKAKA 40 S TL F++ LW R +FE+++ A Sbjct: 116 STSGTLFFRLLFLWPRRSFEIKLNISA 196
BLAST of EMLSAG00000002921 vs. L. salmonis peptides
Match: EMLSAP00000002921 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1685:6905:7075:1 gene:EMLSAG00000002921 transcript:EMLSAT00000002921 description:"augustus_masked-LSalAtl2s1685-processed-gene-0.0") HSP 1 Score: 99.7525 bits (247), Expect = 1.523e-29 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0 Query: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKAKADRDKASP 47 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKAKADRDKASP Sbjct: 1 MVTQVHESKMPTPSPHSTLLFQVTNLWGRETFEVEMKAKADRDKASP 47 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002921 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002921 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000002921 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000002921 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002921 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000002921 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002921 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1685:6905..7075+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002921-685687 ID=EMLSAG00000002921-685687|Name=EMLSAG00000002921|organism=Lepeophtheirus salmonis|type=gene|length=171bp|location=Sequence derived from alignment at LSalAtl2s1685:6905..7075+ (Lepeophtheirus salmonis)back to top Add to Basket
|