EMLSAG00000003252, EMLSAG00000003252-686018 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592759873|gb|GAXK01194540.1| (TSA: Calanus finmarchicus comp5146588_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 3.473e+0 Identity = 15/43 (34.88%), Postives = 21/43 (48.84%), Query Frame = 0 Query: 19 CKIILSITQYKARMKFSKLYY-LEINFGRSANTFQSLCSFWGL 60 C +L +T Y+ M ++ Y RSA+ F SLCS L Sbjct: 166 CPKVLVVTLYRGGMVVTRTSYRASTTTSRSASMFLSLCSISSL 294
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592956614|gb|GAXK01001942.1| (TSA: Calanus finmarchicus comp1920904_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.738e+0 Identity = 13/31 (41.94%), Postives = 18/31 (58.06%), Query Frame = 0 Query: 1 MFVLICLGTSKCIQHYVYCKIILSITQYKAR 31 +FV +C+ S CI HY C I+ IT K+ Sbjct: 52 LFVFVCIHMSACIMHYALC--IMHITYIKSN 138
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924862|gb|GAXK01033553.1| (TSA: Calanus finmarchicus comp83036_c7_seq7 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.451e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 243 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 380
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924872|gb|GAXK01033543.1| (TSA: Calanus finmarchicus comp83036_c1_seq12 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.451e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 23 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 160
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924863|gb|GAXK01033552.1| (TSA: Calanus finmarchicus comp83036_c7_seq6 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.604e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 279 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 416
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924876|gb|GAXK01033539.1| (TSA: Calanus finmarchicus comp83036_c1_seq8 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.958e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 23 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 160
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924865|gb|GAXK01033550.1| (TSA: Calanus finmarchicus comp83036_c7_seq4 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.301e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 504 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 641
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924867|gb|GAXK01033548.1| (TSA: Calanus finmarchicus comp83036_c7_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 9.203e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 1254 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 1391
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Match: gi|592924868|gb|GAXK01033547.1| (TSA: Calanus finmarchicus comp83036_c7_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 9.284e+0 Identity = 17/47 (36.17%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 15 HYVYCKIILSITQYKARM--KFSKLYYLEI----NFGRSANTFQSLC 55 H +YC + S+ +YK + F +++++E N GRS NT SLC Sbjct: 1413 HVIYCYNVDSVQKYKRNVVDGFCEIHWMEC*FL*NAGRSINTV-SLC 1550
BLAST of EMLSAG00000003252 vs. L. salmonis peptides
Match: EMLSAP00000003252 (pep:novel supercontig:LSalAtl2s:LSalAtl2s178:619771:664999:1 gene:EMLSAG00000003252 transcript:EMLSAT00000003252 description:"snap_masked-LSalAtl2s178-processed-gene-6.1") HSP 1 Score: 125.561 bits (314), Expect = 2.657e-39 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0 Query: 1 MFVLICLGTSKCIQHYVYCKIILSITQYKARMKFSKLYYLEINFGRSANTFQSLCSFWGLQ 61 MFVLICLGTSKCIQHYVYCKIILSITQYKARMKFSKLYYLEINFGRSANTFQSLCSFWGLQ Sbjct: 1 MFVLICLGTSKCIQHYVYCKIILSITQYKARMKFSKLYYLEINFGRSANTFQSLCSFWGLQ 61 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003252 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003252 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 9
BLAST of EMLSAG00000003252 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003252 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003252 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003252 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003252 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s178:619771..664999+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003252-686018 ID=EMLSAG00000003252-686018|Name=EMLSAG00000003252|organism=Lepeophtheirus salmonis|type=gene|length=45229bp|location=Sequence derived from alignment at LSalAtl2s178:619771..664999+ (Lepeophtheirus salmonis)back to top Add to Basket
|