EMLSAG00000003518, EMLSAG00000003518-686284 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003518 vs. C. finmarchicus
Match: gi|592884215|gb|GAXK01074160.1| (TSA: Calanus finmarchicus comp123194_c0_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 5.639e+0 Identity = 12/40 (30.00%), Postives = 20/40 (50.00%), Query Frame = 0 Query: 35 FRIRSGTVSHEELYGDSQGADAPLGHHYKGFEYEGNTLAK 74 R + V ++EL D+ H YKGF+++G +K Sbjct: 730 LRPQKSEVEYKELMKDNYEEIPSTAHSYKGFKFKGEDFSK 849
BLAST of EMLSAG00000003518 vs. C. finmarchicus
Match: gi|592884216|gb|GAXK01074159.1| (TSA: Calanus finmarchicus comp123194_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 5.694e+0 Identity = 12/40 (30.00%), Postives = 20/40 (50.00%), Query Frame = 0 Query: 35 FRIRSGTVSHEELYGDSQGADAPLGHHYKGFEYEGNTLAK 74 R + V ++EL D+ H YKGF+++G +K Sbjct: 730 LRPQKSEVEYKELMKDNYEEIPSTAHSYKGFKFKGEDFSK 849
BLAST of EMLSAG00000003518 vs. L. salmonis peptides
Match: EMLSAP00000003518 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1921:15745:16339:-1 gene:EMLSAG00000003518 transcript:EMLSAT00000003518 description:"snap_masked-LSalAtl2s1921-processed-gene-0.0") HSP 1 Score: 169.859 bits (429), Expect = 5.768e-56 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0 Query: 1 MGPAKIIVNDSLAIILLSLYALRELELPRMSDFFFRIRSGTVSHEELYGDSQGADAPLGHHYKGFEYEGNTLAKPPRVQVIY 82 MGPAKIIVNDSLAIILLSLYALRELELPRMSDFFFRIRSGTVSHEELYGDSQGADAPLGHHYKGFEYEGNTLAKPPRVQVIY Sbjct: 1 MGPAKIIVNDSLAIILLSLYALRELELPRMSDFFFRIRSGTVSHEELYGDSQGADAPLGHHYKGFEYEGNTLAKPPRVQVIY 82 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003518 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003518 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000003518 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003518 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003518 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003518 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003518 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1921:15745..16339- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003518-686284 ID=EMLSAG00000003518-686284|Name=EMLSAG00000003518|organism=Lepeophtheirus salmonis|type=gene|length=595bp|location=Sequence derived from alignment at LSalAtl2s1921:15745..16339- (Lepeophtheirus salmonis)back to top Add to Basket
|