EMLSAG00000003994, EMLSAG00000003994-686760 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592919333|gb|GAXK01039042.1| (TSA: Calanus finmarchicus comp1178872_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 8.565e-1 Identity = 24/70 (34.29%), Postives = 36/70 (51.43%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEAP--TTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E P + I M+ V P+ CK +NG +ID+ I V Sbjct: 772 LIELQSKYILIVEGGALQIGT-EEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 972
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592889308|gb|GAXK01069067.1| (TSA: Calanus finmarchicus comp2496085_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.206e+0 Identity = 22/54 (40.74%), Postives = 26/54 (48.15%), Query Frame = 0 Query: 5 KTKYILC--ILGGILQVGNFQEAPTTIPIQMNDP-VPPLNPCKSKPCQNGICSI 55 +TK I+ +L I N TIP Q NDP PP +P S PCQ G I Sbjct: 83 RTKEIMVQQMLHEIANRRNPGSPSLTIPTQPNDPKTPPASPLGS-PCQRGYLDI 241
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592938193|gb|GAXK01020360.1| (TSA: Calanus finmarchicus comp12693_c4_seq5 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.323e+0 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEA-PTTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E + I M+ V P+ CK +NG +ID+ I V Sbjct: 2795 LIELQSKYILIVEGGALQIGTEEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 2995
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592938194|gb|GAXK01020359.1| (TSA: Calanus finmarchicus comp12693_c4_seq4 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.345e+0 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEA-PTTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E + I M+ V P+ CK +NG +ID+ I V Sbjct: 2795 LIELQSKYILIVEGGALQIGTEEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 2995
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592938195|gb|GAXK01020358.1| (TSA: Calanus finmarchicus comp12693_c4_seq3 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.345e+0 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEA-PTTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E + I M+ V P+ CK +NG +ID+ I V Sbjct: 2795 LIELQSKYILIVEGGALQIGTEEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 2995
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592938196|gb|GAXK01020357.1| (TSA: Calanus finmarchicus comp12693_c4_seq2 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.347e+0 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEA-PTTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E + I M+ V P+ CK +NG +ID+ I V Sbjct: 2795 LIELQSKYILIVEGGALQIGTEEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 2995
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592938197|gb|GAXK01020356.1| (TSA: Calanus finmarchicus comp12693_c4_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.347e+0 Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEA-PTTIPIQMNDPVP----PLNPCKSKPCQNGICSIDYENSLIEV 64 +I ++KYIL + GG LQ+G +E + I M+ V P+ CK +NG +ID+ I V Sbjct: 2795 LIELQSKYILIVEGGALQIGTEEEPYDSKAIITMHGNVRCTEMPIFGCKVLGVRNG--TIDFHGEYIPV 2995
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592783288|gb|GAXK01171280.1| (TSA: Calanus finmarchicus comp62613_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.135e+0 Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0 Query: 37 VPPLNPCKSKPCQNGICSIDYENSLI 62 +PP+N ++PC N + I Y ++L+ Sbjct: 157 IPPVNIAITEPCTNSLVWIRYTDTLV 234
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592825351|gb|GAXK01129838.1| (TSA: Calanus finmarchicus comp70730_c1_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.660e+0 Identity = 17/38 (44.74%), Postives = 21/38 (55.26%), Query Frame = 0 Query: 14 GGILQVGNFQEAPTTIPIQMNDPVPPLNPCKSKPCQNG 51 GG+LQVGNF P P+ VP L+ C+ P Q G Sbjct: 280 GGVLQVGNF---PNWRPV-F*ARVPVLHKCRGSPHQLG 381
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Match: gi|592825350|gb|GAXK01129839.1| (TSA: Calanus finmarchicus comp70730_c1_seq3 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 3.723e+0 Identity = 17/38 (44.74%), Postives = 21/38 (55.26%), Query Frame = 0 Query: 14 GGILQVGNFQEAPTTIPIQMNDPVPPLNPCKSKPCQNG 51 GG+LQVGNF P P+ VP L+ C+ P Q G Sbjct: 300 GGVLQVGNF---PNWRPV-F*ARVPVLHKCRGSPHQLG 401
BLAST of EMLSAG00000003994 vs. L. salmonis peptides
Match: EMLSAP00000003994 (pep:novel supercontig:LSalAtl2s:LSalAtl2s213:493018:493464:-1 gene:EMLSAG00000003994 transcript:EMLSAT00000003994 description:"snap_masked-LSalAtl2s213-processed-gene-4.8") HSP 1 Score: 134.806 bits (338), Expect = 9.751e-43 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0 Query: 1 MIYQKTKYILCILGGILQVGNFQEAPTTIPIQMNDPVPPLNPCKSKPCQNGICSIDYENSLIEVFK 66 MIYQKTKYILCILGGILQVGNFQEAPTTIPIQMNDPVPPLNPCKSKPCQNGICSIDYENSLIEVFK Sbjct: 1 MIYQKTKYILCILGGILQVGNFQEAPTTIPIQMNDPVPPLNPCKSKPCQNGICSIDYENSLIEVFK 66 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003994 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003994 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 22
Pagesback to top
BLAST of EMLSAG00000003994 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003994 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003994 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003994 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003994 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s213:493018..493464- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003994-686760 ID=EMLSAG00000003994-686760|Name=EMLSAG00000003994|organism=Lepeophtheirus salmonis|type=gene|length=447bp|location=Sequence derived from alignment at LSalAtl2s213:493018..493464- (Lepeophtheirus salmonis)back to top Add to Basket
|