EMLSAG00000004551, EMLSAG00000004551-687317 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875430|gb|GAXK01082147.1| (TSA: Calanus finmarchicus comp112334_c7_seq17 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 2.610e+0 Identity = 11/40 (27.50%), Postives = 23/40 (57.50%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFD 45 F+L ++L++KVRYL+L C + + + + + + D Sbjct: 268 FFLGLDSLLLVKVRYLSLSACRLSLGESFLFAIGVVSTLD 387
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875484|gb|GAXK01082093.1| (TSA: Calanus finmarchicus comp112334_c1_seq12 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.085e+0 Identity = 11/40 (27.50%), Postives = 23/40 (57.50%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFD 45 F+L ++L++KVRYL+L C + + + + + + D Sbjct: 679 FFLGLDSLLLVKVRYLSLSACRLSLGESFLFAIGVVSTLD 798
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875444|gb|GAXK01082133.1| (TSA: Calanus finmarchicus comp112334_c7_seq3 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.091e+0 Identity = 11/40 (27.50%), Postives = 23/40 (57.50%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFD 45 F+L ++L++KVRYL+L C + + + + + + D Sbjct: 268 FFLGLDSLLLVKVRYLSLSACRLSLGESFLFAIGVVSTLD 387
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875490|gb|GAXK01082087.1| (TSA: Calanus finmarchicus comp112334_c1_seq6 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.135e+0 Identity = 11/40 (27.50%), Postives = 23/40 (57.50%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFD 45 F+L ++L++KVRYL+L C + + + + + + D Sbjct: 679 FFLGLDSLLLVKVRYLSLSACRLSLGESFLFAIGVVSTLD 798
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592957934|gb|GAXK01000622.1| (TSA: Calanus finmarchicus comp7840065_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.803e+0 Identity = 11/18 (61.11%), Postives = 15/18 (83.33%), Query Frame = 0 Query: 40 IDMSFDIDDCISDLKKTQ 57 IDM + I +CISDL+K+Q Sbjct: 141 IDMKWIISNCISDLEKSQ 194
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875441|gb|GAXK01082136.1| (TSA: Calanus finmarchicus comp112334_c7_seq6 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.467e+0 Identity = 10/25 (40.00%), Postives = 18/25 (72.00%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEMEI 30 F+L ++L++KVRYL+L C + + Sbjct: 24 FFLGLDSLLLVKVRYLSLSACRLSL 98
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Match: gi|592875439|gb|GAXK01082138.1| (TSA: Calanus finmarchicus comp112334_c7_seq8 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 7.750e+0 Identity = 10/24 (41.67%), Postives = 17/24 (70.83%), Query Frame = 0 Query: 6 FYLYTLNILIIKVRYLALKGCEME 29 F+L ++L++KVRYL+L C + Sbjct: 3 FFLGLDSLLLVKVRYLSLSACRLS 74
BLAST of EMLSAG00000004551 vs. L. salmonis peptides
Match: EMLSAP00000004551 (pep:novel supercontig:LSalAtl2s:LSalAtl2s237:121229:122973:1 gene:EMLSAG00000004551 transcript:EMLSAT00000004551 description:"snap-LSalAtl2s237-processed-gene-4.88") HSP 1 Score: 117.087 bits (292), Expect = 5.101e-36 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0 Query: 1 MKKLIFYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFDIDDCISDLKKTQIP 59 MKKLIFYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFDIDDCISDLKKTQIP Sbjct: 1 MKKLIFYLYTLNILIIKVRYLALKGCEMEIFNPIIVYVYIDMSFDIDDCISDLKKTQIP 59 The following BLAST results are available for this feature:
BLAST of EMLSAG00000004551 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000004551 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 7
BLAST of EMLSAG00000004551 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000004551 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000004551 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000004551 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000004551 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s237:121229..122973+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000004551-687317 ID=EMLSAG00000004551-687317|Name=EMLSAG00000004551|organism=Lepeophtheirus salmonis|type=gene|length=1745bp|location=Sequence derived from alignment at LSalAtl2s237:121229..122973+ (Lepeophtheirus salmonis)back to top Add to Basket
|