EMLSAG00000004868, EMLSAG00000004868-687634 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Match: gi|592898677|gb|GAXK01059698.1| (TSA: Calanus finmarchicus comp929551_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 3.624e-2 Identity = 18/58 (31.03%), Postives = 31/58 (53.45%), Query Frame = 0 Query: 3 FWCPFGNVFSFFIVIAESGFFTLSTHGSTSQGLAFRLD------WSNSFHLGRVFSST 54 F+CP N+F+ I+ +S FT+ H S + RL+ WS+ + +G++F T Sbjct: 84 FYCPKNNLFAL*IITTDSLLFTIQHHS*QSCSIKARLETKYFPHWSHLYFIGQLFLRT 257
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Match: gi|592754710|gb|GAXK01199703.1| (TSA: Calanus finmarchicus comp181228_c0_seq2 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 3.866e-2 Identity = 24/79 (30.38%), Postives = 37/79 (46.84%), Query Frame = 0 Query: 23 FTLSTHGSTSQGLAFRLDWSNSFHLGRVFSSTAESFHELRASLRSWIDFDVSIRTIVSRANTFKEEFTRGHLLRSNFMT 101 + LS H +T+ +L + L V A + E A L V + ++ A++F+E F RGH LR NF+T Sbjct: 2002 WALSPHPATATS-PVKLRAGHHVPLLAVRPVAAVALQEGLADLSLGRHLHVEVGAVLLAADSFQEIFARGHFLRGNFVT 2235
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Match: gi|592754711|gb|GAXK01199702.1| (TSA: Calanus finmarchicus comp181228_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.2686 bits (77), Expect = 3.867e-2 Identity = 24/79 (30.38%), Postives = 37/79 (46.84%), Query Frame = 0 Query: 23 FTLSTHGSTSQGLAFRLDWSNSFHLGRVFSSTAESFHELRASLRSWIDFDVSIRTIVSRANTFKEEFTRGHLLRSNFMT 101 + LS H +T+ +L + L V A + E A L V + ++ A++F+E F RGH LR NF+T Sbjct: 2014 WALSPHPATATS-PVKLRAGHHVPLLAVRPVAAVALQEGLADLSLGRHLHVEVGAVLLAADSFQEIFARGHFLRGNFVT 2247
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Match: gi|592859916|gb|GAXK01097646.1| (TSA: Calanus finmarchicus comp39804_c3_seq2 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 7.782e+0 Identity = 11/32 (34.38%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 26 STHGSTSQGLAFRLDWSNSFHLGRVFSSTAES 57 +TH +G+++ WSN+FH+ S ES Sbjct: 3591 ATHNLQQEGVSWSCFWSNTFHIYFTAGSAGES 3686
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Match: gi|592859917|gb|GAXK01097645.1| (TSA: Calanus finmarchicus comp39804_c3_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 7.816e+0 Identity = 11/32 (34.38%), Postives = 18/32 (56.25%), Query Frame = 0 Query: 26 STHGSTSQGLAFRLDWSNSFHLGRVFSSTAES 57 +TH +G+++ WSN+FH+ S ES Sbjct: 4407 ATHNLQQEGVSWSCFWSNTFHIYFTAGSAGES 4502
BLAST of EMLSAG00000004868 vs. L. salmonis peptides
Match: EMLSAP00000004868 (pep:novel supercontig:LSalAtl2s:LSalAtl2s256:581570:581992:-1 gene:EMLSAG00000004868 transcript:EMLSAT00000004868 description:"snap_masked-LSalAtl2s256-processed-gene-5.18") HSP 1 Score: 201.83 bits (512), Expect = 4.496e-68 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0 Query: 1 MEFWCPFGNVFSFFIVIAESGFFTLSTHGSTSQGLAFRLDWSNSFHLGRVFSSTAESFHELRASLRSWIDFDVSIRTIVSRANTFKEEFTRGHLLRSNFMT 101 MEFWCPFGNVFSFFIVIAESGFFTLSTHGSTSQGLAFRLDWSNSFHLGRVFSSTAESFHELRASLRSWIDFDVSIRTIVSRANTFKEEFTRGHLLRSNFMT Sbjct: 1 MEFWCPFGNVFSFFIVIAESGFFTLSTHGSTSQGLAFRLDWSNSFHLGRVFSSTAESFHELRASLRSWIDFDVSIRTIVSRANTFKEEFTRGHLLRSNFMT 101 The following BLAST results are available for this feature:
BLAST of EMLSAG00000004868 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000004868 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000004868 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000004868 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000004868 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000004868 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000004868 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s256:581570..581992- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000004868-687634 ID=EMLSAG00000004868-687634|Name=EMLSAG00000004868|organism=Lepeophtheirus salmonis|type=gene|length=423bp|location=Sequence derived from alignment at LSalAtl2s256:581570..581992- (Lepeophtheirus salmonis)back to top Add to Basket
|