EMLSAG00000005667, EMLSAG00000005667-688433 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005667
Unique NameEMLSAG00000005667-688433
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
RNAi_AA 5667 both
  1. PreAdult1 female
  2. PreAdult2 male
-Missing-
-Missing-
08.09.2015 - 11:05
15.10.2015 - 00:00
RNAi_AA 3422+5667+6012 both
  1. PreAdult1 females
  2. PreAdult2 males
-Missing-
-Missing-
08.09.2015 - 14:33
15.10.2015 - 00:00
Nauplii I 5667 unknown
  1. Nauplius I
-Missing-
-Missing-
01.02.2016 - 14:36
10.02.2016 - 01:38
RNAi_AE 5667 both
  1. preadult I male
  2. preadult I and II female
-Missing-
-Missing-
22.02.2016 - 10:11
RNAi_AH 3422+5667+6012 female
  1. PreAdult2
-Missing-
-Missing-
08.11.2016 - 09:43
13.12.2016 - 09:44
Homology
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:MsR1 "Myosuppressin receptor 1" species:7227 "Drosophila melanogaster" [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0035013 "myosuppressin receptor activity" evidence=IDA;NAS;IPI] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0045932 "negative regulation of muscle contraction" evidence=NAS] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0007193 "adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0008344 "adult locomotory behavior" evidence=IMP] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE014296 GO:GO:0005887 GO:GO:0007193 GO:GO:0008344 GO:GO:0008188 InterPro:IPR019427 Pfam:PF10324 GO:GO:0035013 RefSeq:NP_001261324.1 UniGene:Dm.15826 GeneID:38298 KEGG:dme:Dmel_CG8985 CTD:38298 FlyBase:FBgn0035331 OMA:NSIPMTQ Uniprot:M9PEC0)

HSP 1 Score: 251.521 bits (641), Expect = 6.465e-75
Identity = 160/415 (38.55%), Postives = 237/415 (57.11%), Query Frame = 0
Query:   54 LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTG---RSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPN-YIATTINKKTNQ----GKII-------YVLDW-SEIATAHNKL--------------------------------------------LYRINIWLY-------TFL-----LKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSR----RVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            +  F+  Y+ +HG++SL VCI GTIAN LNI+VLTR+EM  SP N ILTG+A+AD+ VM+EYIP+T+H  +LT    R ++  YSW  + F+  HS F+ V+H +SIWLT++LAVWR+I + +   + ++C ++   + +  AY++ V +  P+ Y+ T I +  +Q    GK+I       YV+D+ +E+ +A                                                LY  ++ L+       TFL     +KLIPCI LTI++  LI  L +A+ R  +L ++      +N TK + +NG      R       +++ TDRTTR+L+ +L+LFL+TEFPQGI+G+L+A+ GD F+  CYL L D+MD +AL NS+INFILYC MSKQFR TF   F  K
Sbjct:   17 MDNFHTSYKNMHGYVSLVVCILGTIANTLNIIVLTRREMR-SPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREEKLSYSW--ACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALNATPTSAPLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQNATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTK-SPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLFRPK 427          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:CG13229 species:7227 "Drosophila melanogaster" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA;ISS] [GO:0016021 "integral component of membrane" evidence=IEA;ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE013599 GO:GO:0016021 GO:GO:0008188 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R eggNOG:NOG147428 EMBL:AY099098 EMBL:AY118700 EMBL:BT081415 RefSeq:NP_001260880.1 RefSeq:NP_001260881.1 RefSeq:NP_610637.1 UniGene:Dm.33758 STRING:7227.FBpp0087301 EnsemblMetazoa:FBtr0088206 EnsemblMetazoa:FBtr0330602 EnsemblMetazoa:FBtr0330603 GeneID:36168 KEGG:dme:Dmel_CG13229 UCSC:CG13229-RA FlyBase:FBgn0033579 InParanoid:Q7JVS8 OMA:CLANIVN GenomeRNAi:36168 NextBio:797153 Uniprot:Q7JVS8)

HSP 1 Score: 241.506 bits (615), Expect = 1.509e-72
Identity = 142/345 (41.16%), Postives = 204/345 (59.13%), Query Frame = 0
Query:   59 KGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRS-KEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAH-----NKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSR-KRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISS 396
            + Y  IHG++SL +CIFGTIANILNI+VLTRKEM  +PIN IL  +A+ADM VM+EYIP+T ++ +  G   K+  Y+W   L V  H +F+ ++H +SI LT++LAVWR++ IR          L   +  + L +I+   LC+P Y    + +  +  K+      +  A  H     + +LYR N W+++ L+KL+PC +L +I+  L+ VL +A  R      R++L   NN  K  I             R  R  DRTT LLV +L+LFL+TEFPQG+LG+LS +    FF  CY P G++MD +AL N+A+ F+LY +MSKQFR TF   F  +   S
Sbjct:   70 RAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLV--HMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKV------NSEAMYHVYFDKDSVLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRR------RLKLRDYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFMKRHFGS 400          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-7 "Protein DMSR-7" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R EMBL:FO080664 PIR:C89048 PIR:T31931 RefSeq:NP_504431.2 UniGene:Cel.4587 ProteinModelPortal:O16548 SMR:O16548 STRING:6239.C35A11.1 PaxDb:O16548 EnsemblMetazoa:C35A11.1 GeneID:178922 KEGG:cel:CELE_C35A11.1 UCSC:C35A11.1 CTD:178922 WormBase:C35A11.1 eggNOG:NOG148155 HOGENOM:HOG000016210 InParanoid:O16548 OMA:ATINNCR NextBio:903134 Uniprot:O16548)

HSP 1 Score: 191.815 bits (486), Expect = 1.188e-53
Identity = 114/350 (32.57%), Postives = 190/350 (54.29%), Query Frame = 0
Query:   54 LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLA---YIIPVFLCIPNYIATTINK---------------KTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTF 385
            L  F + Y+ IHG++ + +C+FG   N +++ VL+R  M  S +N ILT +A+ D+  M  Y+ + +H  L    S    ++  +  F+  H   S+ +H  S+WL +++A  R + +R   L+  +   QR K    L    Y++   LCIPN +   I +                +N  + +Y    S  AT +N  L++ NIW+   L K+IPCI+L  ++  L+  +  AE+   +L + V  +A+ +S  +   NG+             +DRTT +LVVIL++FL+TEFPQGI+ +L AI+     +  Y  +GDV+D ++L NS++NF+LYCVMS ++R+TF
Sbjct:   24 LAHFQRWYQPIHGYVCVLICVFGIFTNFVHVAVLSRPNMRNSAVNCILTAVAVCDIGTMASYLIYIIHFVLRRNNSCTPTFTHSWLQFLLWHVVLSITLHTTSLWLAVAMAFIRRMTLRVTALNSQW---QRPKFAWKLCLGIYMVVFVLCIPNMLVHEIARVEGNDWRPGKTCQKFASNYSEPVYTFMVSHAATINNCRLFKWNIWMIGILFKIIPCILLIFLSFGLVSKIRDAEKHRRKLTS-VPSNASTDSKPLKKKNGT-------------SDRTTLMLVVILLVFLITEFPQGIISILCAIFTTDVHRYLYFYIGDVLDLLSLVNSSVNFVLYCVMSSRYRQTF 356          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-1 "Protein DMSR-1, isoform b" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z74037 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 CTD:38298 UniGene:Cel.8974 GeneID:186437 KEGG:cel:CELE_F57B7.1 UCSC:F57B7.1a HOGENOM:HOG000022530 NextBio:931836 RefSeq:NP_741630.1 ProteinModelPortal:Q8MQ19 SMR:Q8MQ19 EnsemblMetazoa:F57B7.1b WormBase:F57B7.1b ArrayExpress:Q8MQ19 Uniprot:Q8MQ19)

HSP 1 Score: 182.956 bits (463), Expect = 2.567e-50
Identity = 119/369 (32.25%), Postives = 205/369 (55.56%), Query Frame = 0
Query:   58 YKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGR---SKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH-TLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKK------TNQGKII-----YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNST-----KVTIS-NGSRRVA--GSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF-----SCKSISSPG 398
            Y  Y  IH +LS+ +C+ GTIAN  NIVVLTR+ M  +P+N+ILT +A  D +V+   + +T H + +  +    K   YSW  +LF+ +H++ SLV H+ S+WL++ LA+ R++ +R    +  +  TL+     + +   +   L  PN++   IN++      T+   +      Y+   ++IA A++ L++R++ W+   + K++PC +L++    L+++L +  E   RL    Q    N +T     +++IS  G+ ++   GS+  R    DRTT +L+ I+ + L+TE PQGI+ +LS +  ++F    Y  LGD++D  +L  S  +FI+YC MS QFR  F + F      C  +SSP 
Sbjct:   27 YNFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMR-TPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYSW--ALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPNQTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFVPAKVRCLRMSSPS 392          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-1 "Protein DMSR-1, isoform a" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z74037 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R CTD:38298 PIR:T22835 RefSeq:NP_741629.1 UniGene:Cel.8974 ProteinModelPortal:Q20929 SMR:Q20929 STRING:6239.F57B7.1a PaxDb:Q20929 PRIDE:Q20929 EnsemblMetazoa:F57B7.1a GeneID:186437 KEGG:cel:CELE_F57B7.1 UCSC:F57B7.1a WormBase:F57B7.1a eggNOG:NOG147428 HOGENOM:HOG000022530 InParanoid:Q20929 OMA:IIKLLPC NextBio:931836 ArrayExpress:Q20929 Uniprot:Q20929)

HSP 1 Score: 184.496 bits (467), Expect = 2.759e-50
Identity = 119/368 (32.34%), Postives = 205/368 (55.71%), Query Frame = 0
Query:   58 YKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGR---SKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH-TLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKK------TNQGKII-----YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNST-----KVTIS-NGSRRVA--GSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF-----SCKSISSP 397
            Y  Y  IH +LS+ +C+ GTIAN  NIVVLTR+ M  +P+N+ILT +A  D +V+   + +T H + +  +    K   YSW  +LF+ +H++ SLV H+ S+WL++ LA+ R++ +R    +  +  TL+     + +   +   L  PN++   IN++      T+   +      Y+   ++IA A++ L++R++ W+   + K++PC +L++    L+++L +  E   RL    Q    N +T     +++IS  G+ ++   GS+  R    DRTT +L+ I+ + L+TE PQGI+ +LS +  ++F    Y  LGD++D  +L  S  +FI+YC MS QFR  F + F      C  +SSP
Sbjct:   27 YNFYHPIHAYLSIFLCVLGTIANFCNIVVLTRRTMR-TPVNMILTAMASCDTVVLFSNLIYTTHYSFVAFKFCHPKHWSYSW--ALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGMQVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANSCLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPPNQTTTRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEFRIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFVPAKVRCLRMSSP 391          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-8 "Protein DMSR-8" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z71185 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R PIR:T19743 RefSeq:NP_505697.2 UniGene:Cel.4589 ProteinModelPortal:Q18475 SMR:Q18475 PRIDE:Q18475 EnsemblMetazoa:C35A5.7 GeneID:183225 KEGG:cel:CELE_C35A5.7 UCSC:C35A5.7 CTD:183225 WormBase:C35A5.7 eggNOG:NOG244561 HOGENOM:HOG000018866 InParanoid:Q18475 OMA:QCKANET NextBio:920374 Uniprot:Q18475)

HSP 1 Score: 166.392 bits (420), Expect = 5.752e-44
Identity = 111/347 (31.99%), Postives = 176/347 (50.72%), Query Frame = 0
Query:   60 GYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTG-RSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHT-LSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTI-------------NKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKR-STDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKD-CYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
             Y  IH ++S+ +C+ GT  NI+ ++VLTR  M  S +N +L  IA+ D+LVM   + F  H  L  G R    +Y+  ++ F++ HS  +++ HA SIWLT+ LA  R   IR  T ++    T Q   ++    +I+   L +PN +   I             N+      ++Y++  S+    H  LL  I  W    L K++PC++LT     L+ ++    +R                         R+    + ++KR   D TT +LV +L +FL  E PQG+L + +AI+  + F D  Y+ LGDVMD ++L NSA+NFI+YC MS++FR  F+Q F
Sbjct:   22 AYAHIHPYVSVILCLAGTAMNIVTVIVLTRPSMR-SAVNSLLCAIALCDILVMTSVLVFVTHFLLFAGYRCDPTDYNIYWAYFLYYHSQATVIFHATSIWLTVLLAQIRVFSIRRATSVAGESVTNQMTCIIAVTTFIVVCLLNVPNMLTFEIIETPASLWLQCKANETAEDDMLVYLVAPSD----HCGLL-NIAFWTNGVLFKVVPCLLLTFSIVALVSIIRDVGKR-------------------------RKQLAQVMNKKRMPRDHTTPMLVAVLSIFLFAELPQGVLHVFNAIFTKETFYDKIYIHLGDVMDVLSLLNSAVNFIIYCAMSRKFRAVFIQIF 337          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-2 "Protein DMSR-2" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 BRENDA:2.7.4.3 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 CTD:38296 EMBL:FO080963 RefSeq:NP_490992.2 UniGene:Cel.20317 ProteinModelPortal:Q9N476 SMR:Q9N476 PaxDb:Q9N476 PRIDE:Q9N476 EnsemblMetazoa:Y23H5B.4 GeneID:189527 KEGG:cel:CELE_Y23H5B.4 UCSC:Y23H5B.4 WormBase:Y23H5B.4 eggNOG:NOG277481 HOGENOM:HOG000017270 InParanoid:Q9N476 OMA:AIFLITE OrthoDB:EOG7Z3F89 NextBio:942726 Uniprot:Q9N476)

HSP 1 Score: 148.288 bits (373), Expect = 4.848e-38
Identity = 115/386 (29.79%), Postives = 177/386 (45.85%), Query Frame = 0
Query:   54 LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWS-----HSNFSLVIHAVSIWLTLSLAVWRFIMI----RFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYI--------ATTINKKTNQGKIIYVLDWS-----EIATAHNKLLY-----RINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDS 412
            L  F   +   H ++ + +C+ G  ANI  +VVL R  M  SP NL L  IA+ D  +M  Y         LT +  E  + W FS F W+     ++ FS+ +H+ S+WLT+++A+ RF+++    R  T  P         V + LA+ I    C+P +I           +     +GK  Y  DW      +       L +     RIN W+   +LKLIPC++LTI    L+++L +A ER +RL                         G + +     +RTT +L  I+ +FL+TE PQG+L   +       F    L + +V D ++L NSA+NF+L  +MS  FR+ F+QTF      S    +   +NK  N S
Sbjct:   22 LLPFTASFTMFHNYIYVFLCVIGVFANISIVVVLLRPAMRKSPFNLFLVVIAVCDASLMATY---------LTYKHVELCHPWYFS-FPWAIYTKFYAIFSVFVHSCSLWLTVNMAILRFLVLYRGSRSETRIPQCNGFGAAFVAIVLAFAIACIGCLPIFIRYRIIEGEVGAVPDLCLEGK--YSTDWQPNDMIQFYGLSQPLWWNCDWERINYWMAALILKLIPCLLLTIFMTLLVRMLIEARERRSRL------------------------CGGMGNGNSQAERTTAMLTGIVAIFLITELPQGVLTFAAGANPRLTFLT--LQMNNVFDLLSLINSAVNFVLCALMSHVFRREFLQTFGVCCPQSSENHSGAPINKTSNRS 369          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-6 "Protein DMSR-6" species:6239 "Caenorhabditis elegans" [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 GO:GO:0016021 GO:GO:0004930 EMBL:Z81468 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 EMBL:AL021181 PIR:T19228 RefSeq:NP_497004.1 UniGene:Cel.13905 ProteinModelPortal:G5EGR5 SMR:G5EGR5 EnsemblMetazoa:Y54G11B.1 GeneID:190297 KEGG:cel:CELE_Y54G11B.1 CTD:190297 WormBase:Y54G11B.1 OMA:INCYVAF OrthoDB:EOG793B7R NextBio:945292 Uniprot:G5EGR5)

HSP 1 Score: 147.517 bits (371), Expect = 5.797e-38
Identity = 114/394 (28.93%), Postives = 196/394 (49.75%), Query Frame = 0
Query:   54 LQEFYKG---YREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-----NQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPG---RQTNLIVNKCGNDSTTVRIRGNTIP-SQRRSALNLKSS 435
            +++FY+    Y  +H +LS  +C+ G  AN ++I VLTR  M  S ++ +L  IAI+DM  M  Y+ +      L   S +  YS+ ++LF+  H+  S+ +HA++++L + +A  R   ++  T   +  T +     +F+A  + + +C+P  +A  I++ T     N     Y + +S +   +   L + N+WL    LK IPC++L   T  LI              NR  L  NN   K+ I     +  G         D TT +L++++ +FL TE PQGI+ +L+A++  QF +  YL L DV+D ++L N  + F++Y   S ++R+T         IS  G   RQ  L  ++     T V+ R N++  +  RS L  K++
Sbjct:   20 IEQFYRFRYLYSNVHPFLSFILCVLGLAANAIHITVLTRPRMRHSSVHTVLVCIAISDMGTMTSYLMYISRFEFL---SDKEGYSYFWALFLKCHAMLSIALHAITLYLVVLMAFIRLSAMKLTTSRWLDHT-RALTSAIFIALFVFI-MCVPTLLAHQIDETTRGVTMNGMYYKYSVGFSTLMMQNGCSLMKGNLWLTGIFLKAIPCLLLLTFTIALI--------------NR--LRENNEKRKILIKEERAKKRG---------DFTTYMLLLMVTVFLFTELPQGIMAILNALFTTQFHQMVYLNLADVLDLLSLINCYVAFLVYSFTSSRYRQTLFSLLPLTKISYSGISTRQGTLKSHQHPGAKTLVQ-RANSVEVASARSPLVDKAA 382          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:MsR2 "Myosuppressin receptor 2" species:7227 "Drosophila melanogaster" [GO:0004930 "G-protein coupled receptor activity" evidence=ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0008188 "neuropeptide receptor activity" evidence=ISS] [GO:0035013 "myosuppressin receptor activity" evidence=IDA;NAS;IPI] [GO:0007218 "neuropeptide signaling pathway" evidence=IDA] [GO:0045932 "negative regulation of muscle contraction" evidence=NAS] [GO:0007193 "adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0008345 "larval locomotory behavior" evidence=IMP] [GO:0002209 "behavioral defense response" evidence=IMP] [GO:0008344 "adult locomotory behavior" evidence=IMP] InterPro:IPR000276 InterPro:IPR017452 PRINTS:PR00237 PROSITE:PS50262 EMBL:AE014296 GO:GO:0005887 GO:GO:0007193 GO:GO:0008344 GO:GO:0008345 GO:GO:0008188 GO:GO:0002209 InterPro:IPR019427 Pfam:PF10324 RefSeq:NP_001261323.1 UniGene:Dm.22163 GeneID:38296 KEGG:dme:Dmel_CG43745 CTD:38296 FlyBase:FBgn0264002 GO:GO:0035013 Uniprot:M9PDT9)

HSP 1 Score: 146.362 bits (368), Expect = 1.207e-36
Identity = 72/162 (44.44%), Postives = 110/162 (67.90%), Query Frame = 0
Query:   53 NLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGR-SKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIP-NYIATTINK 212
             + +F+  Y+  HG+ SL VCI GTIAN LNI+VLTR+EM  SP N ILTG+A+AD+ VM+EYIP+T+H  +L+ R  +E + S+ ++ F+  HS F  V+H +SIWLT++LAVWR+I + +   + I+C ++   + +  AY++ V +  P  Y+ T I K
Sbjct:   14 GIDDFHTNYKYFHGYFSLIVCILGTIANTLNIIVLTRREMR-SPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAK 174          

HSP 2 Score: 121.709 bits (304), Expect = 2.866e-28
Identity = 71/151 (47.02%), Postives = 99/151 (65.56%), Query Frame = 0
Query:  243 LYTFLLKLIPCIVLTIITGWLIKVLYKAEER----SARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            +Y+ L+KLIPC  LTI++  LI  L +A+ R    +    N +Q   N    KV I    +  +  +  +++ TDRTTR+L+ +L+LFL+TEFPQGI+G+L+ + GD FF  CYL L D+MD +AL NS+INFILYC MS+QFR TF   F
Sbjct:  283 IYSVLIKLIPCFALTILSVRLIGALLEAKRRRKILACHAANDMQPIVNG---KVVIPTQPK--SCKLLEKEKQTDRTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFFLQCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLF 428          
BLAST of EMLSAG00000005667 vs. GO
Match: - (symbol:dmsr-5 "Protein DMSR-5" species:6239 "Caenorhabditis elegans" [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR017452 PROSITE:PS50262 GO:GO:0016021 EMBL:AL023844 InterPro:IPR019427 Pfam:PF10324 GeneTree:ENSGT00530000064517 OrthoDB:EOG793B7R HOGENOM:HOG000016210 PIR:T26979 RefSeq:NP_499413.1 UniGene:Cel.9764 ProteinModelPortal:Q9XXD5 EnsemblMetazoa:Y48A6B.1 GeneID:190009 KEGG:cel:CELE_Y48A6B.1 UCSC:Y48A6B.1 CTD:190009 WormBase:Y48A6B.1 eggNOG:NOG257406 InParanoid:Q9XXD5 OMA:VIMAYIR NextBio:944370 Uniprot:Q9XXD5)

HSP 1 Score: 140.969 bits (354), Expect = 1.253e-35
Identity = 115/382 (30.10%), Postives = 195/382 (51.05%), Query Frame = 0
Query:   53 NLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMI-RFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTN---------------QGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNR------VQLSANNNSTKVTISNGS----RRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSIS--SPGRQTNLIVN 406
             L  F + Y  +H +L L VC FG + N L+  VLTRK M    IN +L  ++I D++ M  Y  + L   +    S    YS+ + +F+ +H   S+ +H  S++L++ +A  R+  + R       +  L+  ++++F A I+ V + IP  +   I   T                 G     LD ++I   +   L+R+N+W+   + K +PC+++   T  LI  L +  E+   L+         QL A + +   T  N +    R+V+    SR  S DRTT +L+++L++FL TE PQG+L +LSAIY        Y+ +G+V+D M+L N   +FI+YCVMS  +R T V++  C+S S  +  + T+L+++
Sbjct:   22 QLIAFNQVYTVLHRYLCLFVCFFGVLLNSLHFYVLTRKAMRVYIINALLCAMSICDIITMTSYFIYILRFRIFDTPSTIIGYSYPWLIFLITHVTSSIALHTTSLYLSVIMAYIRWTALDRLDAKWINHGALK--QILIFTALIVSV-ISIPTVMVHKIVPVTEVLGMNETDLLEGAKFDGLYTVQLDETKI---NGCALFRVNLWITGIMFKALPCLLILWFTIALIYKLVQMSEKRKILRGEKRENVEFQLLATSATPTTTTRNEASPRLRKVSQC--SRNVSIDRTTLMLIIMLVVFLCTEMPQGLLSILSAIYPTHVHTMIYVNVGEVLDLMSLINCLTSFIVYCVMSTTYRAT-VKSVLCRSTSRRTVFKNTHLLLD 394          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592886276|gb|GAXK01072099.1| (TSA: Calanus finmarchicus comp2379194_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 308.916 bits (790), Expect = 5.328e-98
Identity = 175/341 (51.32%), Postives = 235/341 (68.91%), Query Frame = 0
Query:   51 ICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAE----YSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTN---QGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKT 384
            +CN   F   Y  +HG+LS+ VCI GT  NILNIVVL+ K+M  +PINLILTGIA+ADML+M+EYIPFT+H  ++  +++E E    Y WG  + V  H NFSL+IH VSIWLTLSLAVWR+IMI+FH L+  +CTL+RCK++L L Y++P FL +PNY++ ++         G+ I V  W       N+ LYRIN+W Y+  LKLIPCI+LT++T  L++ + +A +R+ RL+N      N +  +V I    +R       R++ TDRTTRLL+ IL LFLLTEFPQG+LG L+A+  + FF DCY PLG++MD MAL N  INFILYC+MS+ FR T
Sbjct:  140 LCNFGGFQAAYTPLHGYLSILVCILGTFFNILNIVVLSHKDMRDNPINLILTGIAVADMLMMVEYIPFTVHMYMMDNKNREREERLGYVWG--MVVLFHVNFSLMIHTVSIWLTLSLAVWRYIMIKFHALAVSWCTLRRCKIVLVLGYVVPAFLTLPNYLSLSLTPSPEINTSGENITV--WR--LQMSNEHLYRINVWFYSCFLKLIPCIILTLVTALLVRAMIQAVKRAQRLRN----IGNRSEKRVLIHGEGKRTVS----RQKKTDRTTRLLIAILFLFLLTEFPQGVLGFLAAVLDETFFFDCYTPLGELMDMMALINCTINFILYCLMSRLFRTT 1120          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592763353|gb|GAXK01191214.1| (TSA: Calanus finmarchicus comp691290_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 285.419 bits (729), Expect = 9.216e-90
Identity = 171/366 (46.72%), Postives = 227/366 (62.02%), Query Frame = 0
Query:   44 TSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLT--GRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT---NQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLK-NRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNL 403
            TS  P A+CNL+     Y   HG L++ VC  GT+ N+LNI+VLT K+M  +PINLILTGIA+AD LV IEYIPFT H  L+   GR  E  YS  + +F+  H+NF+++IH VSIWLTLSLA WR IMI+F TL+   CTL RCK +L L + +P+ L IPN ++  +       + G  + +     I    NK ++ +N+WLY+F LKL+PC+VLTI+T  LI+ LYK EE S  L+    QL+ ++ +T  T                        LL +ILI FL+ E PQGILGMLSAI G QFF +CY P+G++MD MAL NSA NFILY +MS +F+KT  +   C  I    R+TN+
Sbjct:  219 TSMGP-ALCNLESVKDSYLPYHGVLAMVVCGMGTVFNLLNIMVLTHKDMKSNPINLILTGIAVADCLVSIEYIPFTFHMYLMNDEGRDPEEMYSLAWGIFLLFHTNFTIMIHTVSIWLTLSLAFWRLIMIKFSTLAITMCTLSRCKAVLTLGFAVPLLLTIPNLLSIQLGSHQAMKDDGSCVTIYTLQII----NKSVFSLNMWLYSFFLKLLPCLVLTILTTCLIRALYKVEENSHNLRLAGSQLNIHSKNTDKTTK----------------------LLSIILIFFLVAELPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANFILYFIMSCEFKKTLKRI--C-GIKPKQRKTNV 1226          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592763352|gb|GAXK01191215.1| (TSA: Calanus finmarchicus comp691290_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 270.396 bits (690), Expect = 8.484e-85
Identity = 154/322 (47.83%), Postives = 204/322 (63.35%), Query Frame = 0
Query:   70 LCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLT--GRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT---NQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLK-NRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTF 385
            + VC  GT+ N+LNI+VLT K+M  +PINLILTGIA+AD LV IEYIPFT H  L+   GR  E  YS  + +F+  H+NF+++IH VSIWLTLSLA WR IMI+F TL+   CTL RCK +L L + +P+ L IPN ++  +       + G  + +     I    NK ++ +N+WLY+F LKL+PC+VLTI+T  LI+ LYK EE S  L+    QL+ ++ +T  T    S                      +ILI FL+ E PQGILGMLSAI G QFF +CY P+G++MD MAL NSA N+ILYC+MS  FR+T 
Sbjct:  183 MVVCGMGTVFNLLNIMVLTHKDMKSNPINLILTGIAVADCLVSIEYIPFTFHMYLMNDEGRDPEEMYSLAWGIFLLFHTNFTIMIHTVSIWLTLSLAFWRLIMIKFSTLAITMCTLSRCKAVLTLGFAVPLLLTIPNLLSIQLGSHQAMKDDGSCVTIYTLQII----NKSVFSLNMWLYSFFLKLLPCLVLTILTTCLIRALYKVEENSHNLRLAGSQLNIHSKNTDKTTKLLS----------------------IILIFFLVAELPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANYILYCLMSSDFRQTL 1070          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592869847|gb|GAXK01087715.1| (TSA: Calanus finmarchicus comp1849926_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 235.343 bits (599), Expect = 2.039e-71
Identity = 135/286 (47.20%), Postives = 188/286 (65.73%), Query Frame = 0
Query:  111 VMIEYIPFTLHRNLLTGRSK--EAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-----NQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            VM+EYIPF +H  L+ G S+  E ++S+ + LF+  H NFS+++H VSIW TL LAVWR IMI+FHT++  YCT+ RC V+L L YI+ + L IPN++A ++N  T     +  + +Y + WS +A +H++LLY+IN+W Y+F LKL+PC +L+IIT  LI+ LY       R ++R      N  +K       R++          TDRTTRLL+VIL LFL++EFPQGILG+LS + G++FF  CY PLG++MD MAL N A NFI YC+MS QF  T    F
Sbjct:    2 VMVEYIPFAIHMYLIQGNSRTLEEKFSYNWGLFLLFHVNFSMILHTVSIWYTLVLAVWRLIMIKFHTMAVTYCTMHRCCVLLVLGYIVALVLTIPNFLAMSVNGTTSAVNNSSNQTLYSITWSTLAESHSRLLYKINVWFYSFFLKLVPCTLLSIITCLLIRALYMFSSLEDRKRSR------NMDSKRMKQITIRKIR---------TDRTTRLLIVILCLFLISEFPQGILGVLSGMLGNEFFISCYTPLGEMMDMMALINGAANFIPYCLMSSQFWNTLCTMF 814          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592869846|gb|GAXK01087716.1| (TSA: Calanus finmarchicus comp1849926_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 231.876 bits (590), Expect = 4.201e-70
Identity = 135/291 (46.39%), Postives = 190/291 (65.29%), Query Frame = 0
Query:  111 VMIEYIPFTLHRNLLTGRSK--EAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTI-------NKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            VM+EYIPF +H  L+ G S+  E ++S+ + LF+  H NFS+++H VSIW TL LAVWR IMI+FHT++  YCT  RC V+L L Y++P+ L +PN++A ++       +K TNQ   +Y + WS +A ++N+LLY++N+W Y+F LKL+PC +L+IIT  LI+ LY       R ++R      N  +K       R++          TDRTTRLL+VIL LFL++EFPQGILG+LS + G++FF  CY PLG++MD MAL N A NFI YC+MS QF  T    F  +
Sbjct:    2 VMVEYIPFAIHMYLIQGNSRTLEEKFSYNWGLFLLFHVNFSMILHTVSIWYTLVLAVWRLIMIKFHTMAVTYCTRGRCSVLLVLGYVLPIILTVPNFMAMSVKGTTTVSSKGTNQT--LYSITWSPLAESNNRLLYKLNVWFYSFFLKLVPCTLLSIITCLLIRALYMFSSLEDRKRSR------NMDSKRMKQITIRKIR---------TDRTTRLLIVILCLFLISEFPQGILGVLSGMLGNEFFISCYTPLGEMMDMMALINGAANFIPYCLMSSQFWNTLCTMFGIQ 823          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592840835|gb|GAXK01116709.1| (TSA: Calanus finmarchicus comp1076838_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 181.03 bits (458), Expect = 1.016e-51
Identity = 88/182 (48.35%), Postives = 126/182 (69.23%), Query Frame = 0
Query:   51 ICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLT--GRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK----KTNQGKIIYVLDWS 226
            +C+L++  + Y  IHG L++ VCIFGT+ N+ NI+VLT ++M  +PIN+ILTGIA+AD LVM+EYIPFT+H  LL    R +E E+S  +  F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F T +   CTL RC+ +L L Y++   L +PN++   ++     K   G+ I  L +S
Sbjct:  205 LCSLEDLKEDYLNIHGQLAMVVCIFGTLFNVANILVLTHRDMKMNPINMILTGIAVADCLVMVEYIPFTIHMYLLKNWDRDQEEEFSLAWGYFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 750          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592840834|gb|GAXK01116710.1| (TSA: Calanus finmarchicus comp1076838_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 176.407 bits (446), Expect = 3.779e-50
Identity = 92/200 (46.00%), Postives = 129/200 (64.50%), Query Frame = 0
Query:   37 TTPEGILTSYEPEA----ICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLT--GRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK----KTNQGKIIYVLDWS 226
            TT    L S E E     +C+L+     Y  IHG L++ VC+ GT+ N+ NI+VLT ++M  +PIN+ILTGIA+AD LVM+EYIPFT+H  LL    R +E E+S  +  F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F T +   CTL RC+ +L L Y++   L +PN++   ++     K   G+ I  L +S
Sbjct:  132 TTYNSELGSLETEGEVGQLCSLEHIKDDYLHIHGELAMVVCVLGTLFNVANILVLTHRDMKMNPINMILTGIAVADCLVMVEYIPFTIHMYLLKNWDRDQEEEFSLAWGYFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 731          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592840833|gb|GAXK01116711.1| (TSA: Calanus finmarchicus comp1076838_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 174.481 bits (441), Expect = 9.750e-50
Identity = 92/207 (44.44%), Postives = 133/207 (64.25%), Query Frame = 0
Query:   27 NMTS-NYSYLTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTG--RSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK----KTNQGKIIYVLDWS 226
            N++S N +    T  G     +   +C+L      Y  IHG+L+L VC+ GT  N++N++VLT K+M  +PIN+ILTGIA+AD LVM+EYIPF LH  LL    R KE ++S  +++F+  H+NFS++IH VSIWLTLSLA+WRFIMI+F T +   CTL RC+ +L L Y++   L +PN++   ++     K   G+ I  L +S
Sbjct:   12 NLSSLNITQCGVTSLGSHVGQQDGELCSLGRVKAAYLPIHGYLALAVCLLGTAFNMVNMLVLTHKDMRLNPINIILTGIAVADCLVMVEYIPFNLHMYLLDDQMREKEEKFSHTWAIFLLFHTNFSIMIHTVSIWLTLSLAIWRFIMIKFSTHAVTLCTLSRCRAVLVLGYVVSFVLTVPNFLLFHVHSEDATKEENGECITFLLYS 632          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592763350|gb|GAXK01191217.1| (TSA: Calanus finmarchicus comp691290_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 174.866 bits (442), Expect = 1.647e-49
Identity = 110/230 (47.83%), Postives = 149/230 (64.78%), Query Frame = 0
Query:  161 LSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAH-----NKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTF 385
            LSLA+WR +MI+F T++   CTL RCK +L L Y++P  L  PN ++  I  K  + K     D S  AT +     N+ ++ +N+WLY+F+LKL+PC+VLTI+T  LIK LYK +E S +++        +NS    +   SR  +         TD+TT+LL VILILFL+ EFPQGILGMLSAI G QFF +CY P+G++MD MAL NSA N+ILYC+MS  FR+T 
Sbjct:  183 LSLAIWRLLMIQFPTIASNLCTLSRCKTVLALGYVLPFILTAPNLLSIQIGFKQEKRK-----DGS-CATLYMLQIINQSIFSLNMWLYSFILKLVPCVVLTILTACLIKALYKVDENSQKMRT------GSNSEISVLRQNSRSKS---------TDKTTKLLAVILILFLVAEFPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANYILYCLMSSDFRQTL 809          
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Match: gi|592763351|gb|GAXK01191216.1| (TSA: Calanus finmarchicus comp691290_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 171.4 bits (433), Expect = 5.748e-48
Identity = 113/248 (45.56%), Postives = 156/248 (62.90%), Query Frame = 0
Query:  161 LSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGK-----IIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGXXXXXXXXXXXXXXXXXXXXXXXXXTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNL 403
            LSLA+WR +MI+F T++   CTL RCK +L L Y++P  L  PN ++  I  K  + K      +Y+L         N+ ++ +N+WLY+F+LKL+PC+VLTI+T  LIK LYK +E S +++        +NS    +   SR  +         TD+TT+LL VILILFL+ EFPQGILGMLSAI G QFF +CY P+G++MD MAL NSA NFILY +MS +F+KT  +   C  I    R+TN+
Sbjct:  219 LSLAIWRLLMIQFPTIASNLCTLSRCKTVLALGYVLPFILTAPNLLSIQIGFKQEKRKDGSCATLYMLQ------IINQSIFSLNMWLYSFILKLVPCVVLTILTACLIKALYKVDENSQKMRT------GSNSEISVLRQNSRSKS---------TDKTTKLLAVILILFLVAEFPQGILGMLSAILGQQFFLECYNPVGEMMDMMALINSAANFILYFIMSCEFKKTLKRI--C-GIKPKQRKTNV 890          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000005667 (pep:novel supercontig:LSalAtl2s:LSalAtl2s307:216793:221090:-1 gene:EMLSAG00000005667 transcript:EMLSAT00000005667 description:"maker-LSalAtl2s307-snap-gene-2.6")

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 0
Query:    1 MEGIKNQKVNIFSPIFNSTLNSTDGFNMTSNYSYLTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFPEEIPMIITRGFENSTIKDDRIIKEEEENT 467
            MEGIKNQKVNIFSPIFNSTLNSTDGFNMTSNYSYLTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFPEEIPMIITRGFENSTIKDDRIIKEEEENT
Sbjct:    1 MEGIKNQKVNIFSPIFNSTLNSTDGFNMTSNYSYLTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFPEEIPMIITRGFENSTIKDDRIIKEEEENT 467          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000003422 (pep:novel supercontig:LSalAtl2s:LSalAtl2s188:1709:12916:1 gene:EMLSAG00000003422 transcript:EMLSAT00000003422 description:"maker-LSalAtl2s188-snap-gene-0.5")

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 301/378 (79.63%), Postives = 333/378 (88.10%), Query Frame = 0
Query:   47 EPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPS 424
            E EA+CNL +FYKGYR +HGWLSLCVCIFGTIANILNI+VLTRKEMNGSPINLILTGIA+ADMLVMIEYIPFTLHRNLLTGRSKE EYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFH+LSPIYCTL RCK+MLFLAY+IPVFLCIPNYIATTINKKTNQGK+IYVLDWS+IATAHNKLLYRINIWLYTF+LKLIPCI+LTIITGWLIK LYK EERSARL++R      +++TK  + NG+ + +  + SRK+S DRTTRLLVVIL+LFLLTEFPQGILGMLSAIYGD+FFKDCYLPLGDVMDAMAL NSAINFI YC MSKQFRKTFV+TF C+S++    Q  +  N   N     + R + IPS
Sbjct:   33 EEEAMCNLTDFYKGYRNVHGWLSLCVCIFGTIANILNIIVLTRKEMNGSPINLILTGIAVADMLVMIEYIPFTLHRNLLTGRSKEIEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHSLSPIYCTLGRCKIMLFLAYVIPVFLCIPNYIATTINKKTNQGKVIYVLDWSDIATAHNKLLYRINIWLYTFILKLIPCIILTIITGWLIKALYKVEERSARLRSR----HYDSNTKSKLRNGNGQTSVIVNSRKKSADRTTRLLVVILVLFLLTEFPQGILGMLSAIYGDKFFKDCYLPLGDVMDAMALINSAINFIFYCFMSKQFRKTFVETFGCRSLNMSSNQVQM-KNGQNNGLAARKRRSSPIPS 405          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000006012 (pep:novel supercontig:LSalAtl2s:LSalAtl2s326:50134:54814:1 gene:EMLSAG00000006012 transcript:EMLSAT00000006012 description:"maker-LSalAtl2s326-augustus-gene-0.7")

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 297/385 (77.14%), Postives = 332/385 (86.23%), Query Frame = 0
Query:   24 DGFNMTSNYSYLTTTPEGILTSY--EPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSC---KSISSPG-RQTN 402
            D  ++ SN+   T   +   + Y  E E +CNL  FYK YR+IHGWLS+CVCIFGTIAN+LNI +LTRKEMN SPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSW FSLFVWSHSNFSLVIHAVSIWLTLSLAVWR IMI+F+TLSPIYCT++RCK++L LAYIIP+F+C+PNY+ATTINKK N GK+IYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPC++LTIITGWLIK LY AEERSARLK +V    + N+  VTI N S +  GS+ SRKR TDRTTRLLVVILILFLLTEFPQGILGMLSA+YGDQFF+DCYLPLGDVMDAMAL NS+INFILYC MS+QFRKTF+QTF+C   K I+SP  R TN
Sbjct:   40 DLIHLFSNFPDKTYLGDNFSSYYIDEKEYMCNLTGFYKSYRKIHGWLSICVCIFGTIANLLNIAILTRKEMNSSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWEFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRLIMIQFYTLSPIYCTIKRCKILLTLAYIIPIFICVPNYMATTINKKKNDGKVIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCVILTIITGWLIKALYIAEERSARLKEKVHTGGSRNNIIVTILNESGKAKGSLTSRKRDTDRTTRLLVVILILFLLTEFPQGILGMLSAVYGDQFFRDCYLPLGDVMDAMALINSSINFILYCAMSQQFRKTFIQTFNCFSSKVINSPNIRLTN 424          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000003457 (pep:novel supercontig:LSalAtl2s:LSalAtl2s189:199228:350969:1 gene:EMLSAG00000003457 transcript:EMLSAT00000003457 description:"maker-LSalAtl2s189-augustus-gene-3.6")

HSP 1 Score: 117.857 bits (294), Expect = 6.118e-29
Identity = 104/360 (28.89%), Postives = 177/360 (49.17%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLH----RNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKV----MLFLAYI---------------IPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFL-LKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGML----SAIYGDQFFKDCYLPLGDVMDAMALTNSAI------NFILYCVMSKQFRKTFVQTF 389
            I+G++   +     ++NIL I+VL++K+M  SP NL+L  +AI+D+L +I   P+ L+     N+ T  +KE  Y++   L          + H  SIWLTL+LA+ R+I +   +++ ++CTL++ K     + F+A++               I   +C  NYI+          K+ +  DW     + N   Y I  W +  L + LIPC+ L I+   L + + +AE++  RL +  Q +A+   +K +              + R ++ TT +L+V++ +FL  E P GI+ +L    S IY        +L  G V   + + N  I      NF +YC MS+QFR+TF + F
Sbjct:   82 IYGYIMPIILAVTFLSNILIIIVLSKKQMK-SPTNLVLMSMAISDLLTVIFPAPWYLYIYTMGNVETFNNKETGYAYETML-----ETMPQIFHTASIWLTLALALQRYIYVCHASIARVWCTLEKTKKAIAGIFFVAFLHQTTRFFDKKFEDMTIEYPVCSNNYISIC--------KVSFA-DWVVQDVSLNG--YFITFWWFRVLFVHLIPCVSLVILNILLFRTMKEAEKKRERLXHCKQKAASKGESKES-------------KKLRDSNCTTLMLIVVITVFLAVELPLGIITILHTMSSTIYD-------FLDYGFVKSIVLIVNLCICLSYPLNFGIYCGMSRQFRETFKELF 404          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000008367 (pep:novel supercontig:LSalAtl2s:LSalAtl2s510:291080:292438:1 gene:EMLSAG00000008367 transcript:EMLSAT00000008367 description:"maker-LSalAtl2s510-snap-gene-1.3")

HSP 1 Score: 62.3882 bits (150), Expect = 8.423e-11
Identity = 76/335 (22.69%), Postives = 141/335 (42.09%), Query Frame = 0
Query:   65 HGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLV--IHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIP-NYIATTINKKTNQGKIIYVLDW--SEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVIL----ILFLLTEFPQGILGMLSAI-YGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            + +++  +   G I NILN+VVL+R  + G  + + L G+A++++  +I  IP     NL+ G+S  + Y   +  F  +H    L+    A S+++ + + V R+I I   T      T +  ++ +  +++    L IP  +    ++  TN   I+    W   +     ++ L+++ +++   LL+  P I L I+   +I                                          +R R   R  R+LV++L    ILF+    P G L +   I  G+      +       + + L N A+NF +YC+ S + RK FV  F
Sbjct:   39 YNFIAYIIVSIGIIGNILNLVVLSRPNLKGV-MYVYLLGLAVSNLAXLISAIPAL--ANLVNGKSDNSNY---YGAFFQAHMEIPLLNSFMASSVYIIICMTVNRYISIYKPTHFQRIHTYKNARIAITCSFLGGTLLHIPLCFEKQVLSNCTNLTGIMEHCTWKSEDNKAVTDEQLFQVYLYISETLLRFGPIITLAILNILII------------------------------------------TRFRRIARKQRMLVIVLIAIVILFVCCTTPAGFLSIFINIRRGNNL---GFAVFRATANNLELLNFALNFYIYCLCSAEIRKAFVSLF 322          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000002622 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1528:6379:33986:-1 gene:EMLSAG00000002622 transcript:EMLSAT00000002622 description:"maker-LSalAtl2s1528-augustus-gene-0.6")

HSP 1 Score: 55.8398 bits (133), Expect = 9.103e-9
Identity = 86/393 (21.88%), Postives = 172/393 (43.77%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSL-VIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATA--HNKLLYRINI-WLYTFLLKLIPCIVLTIITGWLIKVLYKAEE--RSAR----LKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGI--LGMLSAIYGDQFFKDCY-LPLGDVM----DAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFPE 439
            + G++   V +FG I  ++ + VL +  +  S  +++L G+A+ D   +   I       L+ G  K +++    S+++    N  + +    S++LT+S+ + R+    F  + P++    + K +L  +    +   IP ++      +  Q    +  +   +AT+   N++   + + WL    ++LIP +V+ I+   ++  + K+++  +S R    L  RV+ S N+ +     S      A    SR+         LV + ILF+  +  + I  L  L     D     CY  P  D +    + +   NSA NF++Y +  K+FR  F++T+ C+     G+ TN       +      ++ N +  +  +     SSN PE
Sbjct:    9 VDGFVLTIVSLFGLIGTLMAVRVLLKTNLRNS-FSVLLIGLALCDAHFLALAI-------LIFGLPKASDWFSTISIYMSPFCNGLIGIARTGSVYLTMSVTLERY----FAIVRPLHHFYAK-KYLLPASLTFAILYNIPKFL------ELKQAVFPFTNETMIVATSLRENRIYQTVYVFWLKVIFMELIPYLVIIILNTLIVTKIRKSKKFRKSIRQQQLLSKRVESSPNSRNFLRMASQNPAPTAQP-YSRQEQEISLAITLVFVSILFISCQSLKIIPDLYELFCQKDDSSNMKCYSTPFIDTIVSLSNVLTCFNSAANFLVYMLRGKKFRDAFLETYGCR-----GKPTNDHXATASSLXAITVVQKNRLSKKYSNDTLSSSSNEPE 376          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000012081 (pep:novel supercontig:LSalAtl2s:LSalAtl2s863:198955:217784:-1 gene:EMLSAG00000012081 transcript:EMLSAT00000012081 description:"maker-LSalAtl2s863-augustus-gene-1.25")

HSP 1 Score: 54.6842 bits (130), Expect = 2.833e-8
Identity = 78/352 (22.16%), Postives = 151/352 (42.90%), Query Frame = 0
Query:   70 LCVCIFGTIANILNIVVL---TRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHR----NLLTGRS--KEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTI-----NKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARL-------KNRVQLSANNNSTKVT-------ISNGSRRVAGSIXSRKRSTD------RTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQ 387
            +C+ I G   N+  ++V+    RK  N +  NL L  +A+AD+L++    P  L         +G S  K AEYS   S                SI   LS+ + RFI+I F   S   CT+   + +L   + + + L +P     ++            K+ Y  D+ +       L +  +I+    +  ++P  ++ I   ++I+ L+K+ +R A +        NR + SA+ NS  +        I N ++R      + ++  D      +  ++L+ +++LF L   P+ I+ ++        F      +  ++  +   ++ +N I+Y +MSK FR + V+
Sbjct:   68 ICI-ILGVFWNLFTLLVMIKGDRKSRNAT--NLFLISLAVADLLLVTVAAPMELVHYFAPQFGSGGSGCKIAEYSRVLSA-------------VASILNLLSVTLERFIVIVFPMRSRSLCTMTNSRRVLGAVWGLSLILTLPVLYTKSVYDVYYANNVTIVKVTYCNDYDD------SLGFAFSIYQLVVVF-IVPGNIILICYSFVIRELWKSTKRMASMTNHNSYTANRKRSSAHENSVYINQHHDDGGIGNDNKRSRHFHGNHRKREDVGAQRKQVIKMLICVVVLFFLCWGPRFIMEIIIKSKTQNLFYPSIYWIRVLLFLLPFVHACVNPIIYIIMSKTFRSSIVK 396          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000006807 (pep:novel supercontig:LSalAtl2s:LSalAtl2s382:146876:192943:-1 gene:EMLSAG00000006807 transcript:EMLSAT00000006807 description:"maker-LSalAtl2s382-augustus-gene-2.10")

HSP 1 Score: 53.5286 bits (127), Expect = 6.824e-8
Identity = 92/408 (22.55%), Postives = 168/408 (41.18%), Query Frame = 0
Query:   56 EFYKGYREIHGWLSLCVC------IFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMI-RFHTLS-PIYCTLQRCKVMLFLAYI--IPVFLCIPNYIATTINKKTNQGKIIYVLDWSEI--ATAHNKLLYRINIWLYTFLLKLI-----PCIVLTIITGWLIKVLYKAEERSA-------RLKNRVQLSA-------NNNSTKVTISNGSRRVAGSIXS------------------RKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQ---------FFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSI---SSPGRQTN 402
            + Y+ Y  +  + ++ +C      I G I N L  + +T  +   S  N+ +  +A+ADMLVMI  +P T+  ++          +W F   +       +V++   I +++S+    FI   R++ +  P+  + ++ K  + +A I  I   + IPN I+       +  +    L   EI    +  K  +  N+     LLK +     P I ++I    ++K L++    +        R+  R  LS        N ++T   I + SR  AG++ S                  + R+  +  ++L+ ++I+F +  FP   L +   I   Q         +F    +  G     M   NSAIN I+Y  MS QF+  + +  SC+     SSP   +N
Sbjct:   50 DVYQSYISVDKFETVLICLIALVFICGIIGNALVFIAVTTTKSMQSVTNIFIVNLAMADMLVMIFCVPPTVIWDVTN--------TWIFGSLMC-----RIVLYIQDISVSVSVLTLTFIAYDRYYAICRPLQFSSRKTKAAVXIAAIWTISAIIGIPNAISLEAVTPFDDEEQFPCLARDEIFFDLSSCKPKWGENVDFTITLLKAVVLYSLPIIFMSIAYYHIVKTLWRRNNMTGSQVTSDNRINRRTLLSKTASSMHRNGSATASFIESSSR--AGTLESPGRIHCKRNISANKNLDNQLRTRRKVAKMLIAVVIIFTINSFPVHCLPIAQYILRKQNPTVYERINWF---IIQAGIFTHCMFYLNSAINPIIYYFMSAQFKAQYRRILSCRCTGXSSSPIGHSN 439          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6")

HSP 1 Score: 53.5286 bits (127), Expect = 9.025e-8
Identity = 34/141 (24.11%), Postives = 71/141 (50.35%), Query Frame = 0
Query:  256 LTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSI--XSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLP--LGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            L + +GW+ + + K  +           S + ++T   ++ G ++  G +   + K+   +  + L  IL+ F++T  P  +L +L+A+ G +   D Y+P  L D    +   NS +N +LY + +  FR+T+V+  +C+
Sbjct:  501 LPLDSGWVGRQMIKRSQSGGS-------SYSPHNTLQRLTGGGKKNPGKVKKTNEKKQXRKAAKTLSAILLAFIVTWTPYSVLTVLNAVLGKET-ADVYIPPTLWDFAYYLCYINSTVNPVLYALCNAAFRRTYVRILTCR 633          
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Match: EMLSAP00000010699 (pep:novel supercontig:LSalAtl2s:LSalAtl2s709:733744:748518:1 gene:EMLSAG00000010699 transcript:EMLSAT00000010699 description:"maker-LSalAtl2s709-augustus-gene-7.5")

HSP 1 Score: 52.7582 bits (125), Expect = 1.442e-7
Identity = 72/351 (20.51%), Postives = 144/351 (41.03%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYS-WGFSLFVWSHSNF--------SLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATT------INKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGR 399
            I G L   + I G   N+++IV+L+R +M  S IN IL G+A  D ++++  I       L+ G      Y+ + F+ + W+   +         L+    S +LTL + + R++ +     +   CT  R +  +    +  +   +P +   T          TN  +++     +E+ +    +   I  W+Y   +   P + L      +   + KA    ARL +R+Q                          ++     T L+VV+++ F+       +L ++  I   +  K     L    + +   NS++NFI+YC+  ++F++ F + F C  + + G+
Sbjct:   23 IPGVLLNAIGILGLFGNVISIVILSRPQMRSS-INCILIGLASYDSILILTGI-------LMFGLPSLYNYTRYLFNYYYWNIFPYITPIIYPVGLIAQTGSAYLTLCVTIERYVAVCIPLRARSLCTYGRARSYVIFIGVFAIVYNLPRFWEVTWETTYYTEFDTNYTEVV----ATELRSDPTYISIYIT-WMYLVFMYFFPFLCLAAFNLRIYFQVRKANSERARL-SRLQ--------------------------RKEIGLATMLMVVVIVFFVCN-----VLALVVNIL--EVMKISINALTQTSNLLITFNSSVNFIIYCIFGEKFKRIFYRLF-CPILKNAGQ 325          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|75017612|sp|Q8SWR3.1|SPR_DROME (RecName: Full=Sex peptide receptor)

HSP 1 Score: 88.1965 bits (217), Expect = 1.100e-17
Identity = 96/372 (25.81%), Postives = 168/372 (45.16%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKE---AEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCK------VMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFL-LKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTN------SAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNL-IVN---KCGNDSTTV 415
            ++G+    + I   I+N L ++VL++K M  +P N +L G+AI DML +I   P   +        K          +S+F   +     + H +S+WLTL+LAV R+I +    ++  +CT+ R +       +L   + +P F     Y+   I    +  ++ ++     +       LY  + +L+  L + L+PCI+L  +   L   + +A+ER      R  L   N   +                + R T+ TT +L+V++ +FLL E P   + +++A++        +L  G     + LTN        INF +YC MS+QFR+TF + F  + ++     T   IVN    C N + TV
Sbjct:   91 LYGYCMPFLLIITIISNSLIVLVLSKKSM-ATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF---NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFF-DRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQER------RKLLFRENRKKEC--------------KKLRETNCTTLMLIVVVSVFLLAEIP---IAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGRLMAKKDSSTKYSIVNGARTCTNTNETV 434          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|464921|sp|P34981.1|TRFR_HUMAN (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 76.2554 bits (186), Expect = 7.337e-14
Identity = 80/356 (22.47%), Postives = 170/356 (47.75%), Query Frame = 0
Query:   44 TSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            T  +P A+  L+     Y+ +   L L +C  G + NI+ ++V+ R +   +P N  L  +A+AD++V++   +P     N+         Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  I+    + +I+  +   +Y ++  ++     ++P I+ T++ G++ ++L+        +E S   KN     + + +T + ++  +R    ++ SRK+     T++L V++ILF L   P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +CK
Sbjct:   12 TQLQPRAVVALE-----YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITDSIYGSWVYGYVGCLCI-TYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCGY-KISRNYYSPIYLMDFGVF----YVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKN----DSTHQNTNLNVNTSNRCFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNCK 338          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|9910884|sp|O46639.1|TRFR_BOVIN (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 73.1738 bits (178), Expect = 8.249e-13
Identity = 81/356 (22.75%), Postives = 168/356 (47.19%), Query Frame = 0
Query:   44 TSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            T  +P A+  L+     Y+ +   L L +C  G + NI+ ++V+ R +   +P N  L  +A+AD++V++   +P     N+         Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  I+    + +I+  +   +Y ++  ++     ++P I+ T++ G++ ++L+        +E S   KN       N ++K +    +R    ++ SRK+     T++L V++ILF L   P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +CK
Sbjct:   12 TQLQPRAVVALE-----YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITDSIYGSWVYGYVGCLCI-TYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGY-KISRNYYSPIYLMDFGVF----YVVPMILATVLYGFIARILFLNPIPSDPKENSNMWKNDSTHQNKNLNSKTS----NRYFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNCK 338          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|2495022|sp|Q28596.1|TRFR_SHEEP (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 73.1738 bits (178), Expect = 9.274e-13
Identity = 81/356 (22.75%), Postives = 168/356 (47.19%), Query Frame = 0
Query:   44 TSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            T  +P A+  L+     Y+ +   L L +C  G + NI+ ++V+ R +   +P N  L  +A+AD++V++   +P     N+         Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  I+    + +I+  +   +Y ++  ++     ++P I+ T++ G++ ++L+        +E S   KN       N ++K +    +R    ++ SRK+     T++L V++ILF L   P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +CK
Sbjct:   12 TQLQPRAVVALE-----YQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITDSIYGSWVYGYVGCLCI-TYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGY-KISRNYYSPIYLMDFGVF----YVVPMILATVLYGFIARILFLSPIPSDPKENSNTWKNDSTHQNKNLNSKTS----NRYFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNCK 338          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|21264552|sp|Q11082.2|YT66_CAEEL (RecName: Full=Probable G-protein coupled receptor B0563.6)

HSP 1 Score: 70.4774 bits (171), Expect = 7.538e-12
Identity = 85/390 (21.79%), Postives = 164/390 (42.05%), Query Frame = 0
Query:   71 CVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVS--IWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTN---QGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKD--CYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSC--------KSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQR--RSALNLKSSNFPEEIPM 443
            C+C  G + NI N++VL  + +      + L  +A+AD+L M+  + F     L    S   +Y   + ++   H   +L+  A+   +++ ++L++ R+I I F      + + QR    + +A++IP    +P  I     K+     Q   IY +D   I T     +Y+   W    +L+ +P I+LT++   ++    K ++   +L N+                  R+  G+     +  D    +L   +++ L+   P  I  +L     D+  K    Y     V + + +TN A  F ++C  S  +R TF+Q F C          + S  R+T  ++ K G+   T   +   +   +  R +L+  S  F   +P+
Sbjct:   33 CICAIGIVGNITNLMVLASRRLRAVSY-MYLRALAVADLLCMLFVLVFVSTEYLAKNGSSINQYKL-YQIY-QCHLMLTLINWALGAGVYVVVALSLERYISIVFPMHFRTWNSPQRATRAIVIAFLIPAIFYVPYAITRYKGKQRFDLLQNVTIYSMDDHPIYTTFYWQIYK---WTREAILRFLPIIILTVLNIQIMIAFRKRQKMFQQLTNK------------------RKEQGT-----QKDDTLMYMLGGTVLMSLVCNIPAAINLLLI----DETLKKRLDYQIFRAVANILEITNHASQFYVFCACSTDYRTTFLQKFPCFKTDYANRDRLRSFVRRTQSVIQKQGSVEHTTNSKVWIMFKNKFQRDSLSHHSRKFSRHMPI 389          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|136205|sp|P21761.1|TRFR_MOUSE (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 69.707 bits (169), Expect = 9.815e-12
Identity = 81/363 (22.31%), Postives = 171/363 (47.11%), Query Frame = 0
Query:   37 TTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            T  E   T  +P+A   L+     Y+ +   L + +C  G + NI+ ++V+ R +   +P N  L  +A+AD++V++   +P     N+         Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  ++    + +I+  +   +Y ++  ++     ++P I+ T++ G++ ++L+        +E S   KN   +  N N   + ++  +R    ++ SRK+     T++L V++ILF L   P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +CK
Sbjct:    5 TVSEMNQTELQPQAAVALE-----YQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITDSIYGSWVYGYVGCLCI-TYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCGY-KISRNYYSPIYLMDFGVF----YVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKND-SIHQNKN---LNLNATNRCFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNCK 338          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|56749105|sp|Q9VZW5.1|FMAR_DROME (RecName: Full=FMRFamide receptor; Short=DFR; Short=DrmFMRFa-R; AltName: Full=Larval opioid receptor)

HSP 1 Score: 67.0106 bits (162), Expect = 1.370e-10
Identity = 71/334 (21.26%), Postives = 150/334 (44.91%), Query Frame = 0
Query:   72 VCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYS---WGFSLFVW---SHSNF--SLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNY--IATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSIS 395
            V + G + NI+++++L+R +M  S IN +LTG+A  D +++I  I       LL G      Y+   +G+  +V+   S + F   ++    SI++T ++ + R++ +     +   CT  R K+   +     +   +P +  + T    +  +  I++ +  S +  +   +   I+ W Y  +  +IP + L I+      ++Y+  +R+ R + R+                         S KR     T LL V+++ F+L   P  +L +  A Y     K     +  + + +   NS++NF++Y +  ++F++ F+  F  + +S
Sbjct:  123 VGVLGILGNIISMIILSRPQMRSS-INYLLTGLARCDTVLIITSI-------LLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIH-WCYLIVNYIIPFLTLAILNC----LIYRQVKRANRERQRLS-----------------------RSEKREIGLATMLLCVVIVFFMLNFLPL-VLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLS 414          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|6226254|sp|O93603.1|TRFR_CHICK (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 65.4698 bits (158), Expect = 2.424e-10
Identity = 75/345 (21.74%), Postives = 161/345 (46.67%), Query Frame = 0
Query:   55 QEFYKG-YREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSC 391
            QEF    Y+ +   L L +C  G + NI+ ++V+ R +   +P N  L  +A+AD++V++   +P     N+     K   Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N    +   +    + +++ ++   +Y ++  ++  L    P ++ T++ G + ++L+        +E S   KN   ++  N +    ++N S     +I SR+    + T++L V+++LF     P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +C
Sbjct:   19 QEFVTAEYQVVTILLVLLICGLGIVGNIMVVLVVLRTKHMRTPTNCYLVSLAVADLMVLVAAGLP-----NITESLYKSWVYGYVGCLCI-TYLQY-LGINASSFSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDTTVVSCGY-KVSRSYYSPIYMMDFGIFYVL----PMVLATVLYGLIARILFLNPIPSDPKENSNTWKN--DMAQQNKTVNSKMTNKSFN--STIASRR----QVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNC 339          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|267163|sp|Q01717.1|TRFR_RAT (RecName: Full=Thyrotropin-releasing hormone receptor; Short=TRH-R; AltName: Full=Thyroliberin receptor)

HSP 1 Score: 63.929 bits (154), Expect = 8.286e-10
Identity = 71/327 (21.71%), Postives = 155/327 (47.40%), Query Frame = 0
Query:   73 CIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEY-IPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLY------KAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
            C  G + NI+ ++V+ R +   +  N  L  +A+AD++V++   +P     N+         Y +   L + ++  + L I+A S  +T +  + R+I I     +   CT  R K ++   +      C+  +    +N  T +  I+    + +I+  +   +Y ++  ++     ++P I+ T++ G++ ++L+        +E S   KN     + + +  + ++  +R    ++ SRK+     T++L V++ILF L   P   L ++++     F ++ +L    +   +   NSAIN ++Y +MS++FR  F +  +CK
Sbjct:   36 CGLGIVGNIMVVLVVMRTKHMRTATNCYLVSLAVADLMVLVAAGLP-----NITDSIYGSWVYGYVGCLCI-TYLQY-LGINASSCSIT-AFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCGY-KISRNYYSPIYLMDFGVF----YVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKN----DSTHQNKNMNLNTTNRCFNSTVSSRKQ----VTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYL---NSAINPVIYNLMSQKFRAAFRKLCNCK 338          
BLAST of EMLSAG00000005667 vs. SwissProt
Match: gi|74966839|sp|Q23497.1|NPR9_CAEEL (RecName: Full=Galanin-like G-protein coupled receptor npr-9; AltName: Full=Probable neuropeptide receptor 9)

HSP 1 Score: 61.2326 bits (147), Expect = 7.078e-9
Identity = 89/406 (21.92%), Postives = 168/406 (41.38%), Query Frame = 0
Query:   72 VCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHA-VSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFL------AYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVM-------DAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNF------PEEIPMIITRGFENSTIKDD 457
            + + G + N L ++V   ++M  S  N ++ G+AI+D++ ++  +PFT            A  +W F  +  S  NF     A  S+W    +A+ R++ + +   S    T +   + L        A  IPV      Y+   I +K +   I+ +       T         N++ Y     ++P  +  ++ G +++ L+       R  N   +   N + + + S+  RR   +   RK      TRL++ +LI + L   P  +   +S   G  + +   +  G +M         +A TNS +N ILY +MS+ FR+ F+            R   +++NK          RG    + RRSAL  + +++      P    + ++ G  +S +KD+
Sbjct:   53 IILVGLVGNALVVIVAFGRQMRNS-TNTLIIGLAISDLMFLLLCVPFT--------AVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIYVYDFIMEKRSTCAILTIATAEATPTMARTYFMTFNVFGY-----VLPLGISVVLYGLMLRKLWDMP----RPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRK-----VTRLVLCVLITWALCWLPLNVCFFMS---GLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFI------------RVMKMLINKLS--------RGRFCTNYRRSALRTELTHYNQTPAHPANTVVQVSNGERSSLLKDN 412          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: EEB14579.1 (class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis])

HSP 1 Score: 325.865 bits (834), Expect = 6.922e-107
Identity = 170/350 (48.57%), Postives = 243/350 (69.43%), Query Frame = 0
Query:   46 YEPEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNY----IATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            Y+P+  C+  L+ F  GY+++HG+LSL VC+FGTIAN++N+ VLTR+EM  +PIN ILTG+A+AD+LVM+EYIPF+++  L+    +   YSW  ++F+  H +FS +IH +SI LTL+LAVWR+I IR+   S  +CT  RC+V +  ++++P+ LCIP+Y    I TT   + +    +Y LD S++A  +++LL  +  W Y  L+KL+PC++LT+I+  LIK LY+  +R+  LK       N NS +       RRV   I +++R TDRTTR+LV ILILFLLTE PQGILG+LS I G  FF++CY   G++MD +AL NSAINFILYC MS+QFR+TF + F
Sbjct:   67 YDPDKYCDGTLKAFANGYKDVHGYLSLMVCLFGTIANLINVAVLTRREMATNPINRILTGLAVADVLVMLEYIPFSVYMYLIFPGQRNFPYSW--AVFILFHVHFSQIIHTISICLTLALAVWRYIAIRYPHKSITWCTGPRCRVAIGTSFVLPLILCIPSYFVFYIKTTRITENSAEIYLYHLDLSDVAKENDQLLCNVTFWTYGVLIKLLPCVILTVISIRLIKALYEINKRNKLLKTANSTHHNENSVE-------RRV---ILAKER-TDRTTRMLVAILILFLLTELPQGILGLLSGILGTCFFRNCYNLFGEIMDILALVNSAINFILYCFMSRQFRQTFEKVF 403          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: gb|KFM66935.1| (putative G-protein coupled receptor, partial [Stegodyphus mimosarum])

HSP 1 Score: 296.975 bits (759), Expect = 3.320e-96
Identity = 165/383 (43.08%), Postives = 243/383 (63.45%), Query Frame = 0
Query:   17 NSTLNSTDGF--NM-TSNYSY--LTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK-KTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF--SC 391
            N+++N  DGF  NM T NYS+  L    E I   Y  +    L +F +GY  +HG+LS  VC+FG  AN+LNI+VLTRK M  SP N ILTG+A+ADMLVM  Y+PFT H  + +   ++ ++S+ +++F   H++F++V H +S WLT+++A+WRFI + F   + ++C++ R K  +   YI+    C+P Y+  T++K +   G+I+Y +D+S+IA  HN+LL ++N W+++ + KL+PC+ LT ++  LIKVLY+  +R  RLKNR ++                          R  DRTTR+L+ +L+LFLLTEFP G+L +LS I G  FF + YL  G+ MDA+AL NSAINFI+YC MS+QFR TF   F  SC
Sbjct:   12 NASMN--DGFQPNMSTGNYSHNTLFGMQEEIDYPYFGDY---LAQFQRGYGSVHGYLSFAVCLFGITANVLNIIVLTRKNMV-SPTNAILTGLAVADMLVMFSYLPFTFHNYIRSDLDEKDKFSYSWTVFTLFHAHFTVVNHTISTWLTVTVAIWRFIAVSFPANTAVWCSMARAKCAIVATYIMCALFCLPVYLTFTVSKFRGEDGQIMYRVDFSQIAQRHNRLLEKMNFWIFSVITKLVPCVALTGLSLGLIKVLYETNKRRQRLKNRTEV-------------------------DRVHDRTTRMLLAVLLLFLLTEFPSGLLALLSGILGTDFFNNVYLNFGETMDALALVNSAINFIIYCSMSQQFRITFAYLFLPSC 363          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: gb|KFM68983.1| (FMRFamide receptor, partial [Stegodyphus mimosarum])

HSP 1 Score: 288.5 bits (737), Expect = 2.333e-92
Identity = 164/405 (40.49%), Postives = 243/405 (60.00%), Query Frame = 0
Query:    3 GIKNQKVNIFSPIFNSTLNSTD------------GFNMTSNYSYLTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSIS 395
            G  NQ  ++F P F S+ N +D              N TS++ +  T+      S  P    + + F   Y  +HG+L + VCIFG  AN+LNI+VLTRK+M  SP N ILTG+A+ADMLVM+ Y+PF +H  +   +  E ++S+ +++F   H++F++V H +S WLT++LAVWRF+ + F   S  +C++ R K  +   Y+     C+P Y+  TI +  +  K+ Y + +SEIA ++++ L ++N W+++ L KLIPCI LT ++  LIKVLY+A +R  RLKNRV+                           ++ DRTTR+L+ IL+LFL+TEFP GI+ +LS I G  FF + YL LG+ +D +AL NSAINFILYC MS+QFR TF   F+ K +S
Sbjct:   31 GYPNQ--DVFDPFF-SSFNISDYSWLGDIDTLDFTINATSDHMFRDTS------SPRPYYGDHFRTFRSQYLAVHGYLGVIVCIFGIFANVLNIIVLTRKDM-ISPTNAILTGLAVADMLVMVSYLPFCIHNYIRINQPPEQKFSYAWAVFTLFHAHFTVVCHTISTWLTVTLAVWRFLAVSFPAASKTWCSMPRAKCAILCTYLNCALFCLPVYLTFTIIEVAHNEKLFYRVSFSEIAQSNHQALEKVNFWIFSVLTKLIPCIALTGLSLGLIKVLYEANKRKQRLKNRVE-------------------------NDKTHDRTTRMLLAILLLFLITEFPSGIVALLSGILGKTFFDNVYLNLGEAVDLLALVNSAINFILYCSMSRQFRDTFASLFTPKIVS 400          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_396970.5 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767544.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767543.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767542.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767541.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767540.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Match: XP_016767539.1 (PREDICTED: neuromedin-U receptor 1-like isoform X1 [Apis mellifera])

HSP 1 Score: 282.722 bits (722), Expect = 4.391e-90
Identity = 157/350 (44.86%), Postives = 231/350 (66.00%), Query Frame = 0
Query:   49 EAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT-NQGKII---YVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNG--SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
            +  CN  +++    Y+  HG+++L VC+FGT+AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM+EYIPF ++  ++  + +   Y W  ++FV  H +F+ ++H +SI +TL+LAVWR+I IRF   +  +CT  RCK+ L+ +++ P   C P+Y+   I K+T N+  I+   Y++D     + H    Y++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   LK     S N       + NG   +R + S    +R  DRTT++LV +L+LFL+TE PQGILG+LS + GD FF++CY   G+VMD +AL N AINFILYC MS+QFR TF Q F 
Sbjct:   71 DCYCNGTVRDLAIEYKNYHGYVALMVCLFGTLANMLNIVVLTRKDMVATPINRILTGLATADMLVMLEYIPFAIYMYIVLPKRQIFPYGW--AVFVLFHMHFTQLLHTISIAITLTLAVWRYIAIRFPQYN-TWCTAARCKMALWSSFLAPFIACAPSYLVFGIRKQTVNENGILEIAYIVDADY--SQHKDFFYQLNFWILGVVVKLLPCVILTVISCWLIKALYRAKGRKQALK-----SYNQCKNISVMGNGLIPKRPSKS----ERRADRTTKMLVAVLLLFLVTEIPQGILGLLSGVLGDCFFRNCYHNFGEVMDILALLNGAINFILYCSMSRQFRTTFGQLFK 406          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|242013230|ref|XP_002427317.1| (class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis] >gi|212511662|gb|EEB14579.1| class A rhodopsin-like G-protein coupled receptor GPRmys, putative [Pediculus humanus corporis])

HSP 1 Score: 325.865 bits (834), Expect = 3.387e-104
Identity = 170/350 (48.57%), Postives = 243/350 (69.43%), Query Frame = 0
Query:   46 YEPEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNY----IATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            Y+P+  C+  L+ F  GY+++HG+LSL VC+FGTIAN++N+ VLTR+EM  +PIN ILTG+A+AD+LVM+EYIPF+++  L+    +   YSW  ++F+  H +FS +IH +SI LTL+LAVWR+I IR+   S  +CT  RC+V +  ++++P+ LCIP+Y    I TT   + +    +Y LD S++A  +++LL  +  W Y  L+KL+PC++LT+I+  LIK LY+  +R+  LK       N NS +       RRV   I +++R TDRTTR+LV ILILFLLTE PQGILG+LS I G  FF++CY   G++MD +AL NSAINFILYC MS+QFR+TF + F
Sbjct:   67 YDPDKYCDGTLKAFANGYKDVHGYLSLMVCLFGTIANLINVAVLTRREMATNPINRILTGLAVADVLVMLEYIPFSVYMYLIFPGQRNFPYSW--AVFILFHVHFSQIIHTISICLTLALAVWRYIAIRYPHKSITWCTGPRCRVAIGTSFVLPLILCIPSYFVFYIKTTRITENSAEIYLYHLDLSDVAKENDQLLCNVTFWTYGVLIKLLPCVILTVISIRLIKALYEINKRNKLLKTANSTHHNENSVE-------RRV---ILAKER-TDRTTRMLVAILILFLLTELPQGILGLLSGILGTCFFRNCYNLFGEIMDILALVNSAINFILYCFMSRQFRQTFEKVF 403          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|998500008|ref|XP_015509921.1| (PREDICTED: sex peptide receptor [Neodiprion lecontei])

HSP 1 Score: 318.161 bits (814), Expect = 2.254e-101
Identity = 169/392 (43.11%), Postives = 252/392 (64.29%), Query Frame = 0
Query:    6 NQKVNIFSPIFNSTLNSTDGFNMTSNYSY--LTTTPEGILTSYEPEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKK----TNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            N+  NI S ++     + +  +  +N+S+  L TT   I ++ E    CN  +++    Y+  HG+++L VCIFG++AN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM EY+PF +++ L+    K   Y W  ++FV  H +F+  +H +SI LTL+LAVWR+I IRF   +  +CT  RC+V L+ +++ P   C P+Y+   I ++      + +I+Y +D  +  T     L ++N W+   ++KL+PC++LT+I+ WLIK LYKA+ R   L++      N  +     + GSRR + S    +R TDRTTR++V +L+LFL+TEFPQGILG+LS + GD FF++CY  LG++MD +AL N AINFILYC MS+QFR TF Q F
Sbjct:    3 NRHENI-SDLYKKLNITEEDIDYLNNFSFPNLPTTRTTISSTEEKYCYCNGVVRDLALSYKVYHGYVALIVCIFGSVANMLNIVVLTRKDMASAPINRILTGLATADMLVMFEYVPFAVYKYLILPGHKVFPYGW--AVFVLFHMHFAQALHTISIGLTLTLAVWRYIAIRFPQHNHAWCTAARCRVALWSSFLAPFIACAPSYLVFGIREERLEENGRVEILYYVDAMDADTTGKGFLIQLNFWVLAVVVKLLPCLILTVISCWLIKALYKAKGRKQALRDY-----NPCAINTMKNGGSRRASKS----ERRTDRTTRMMVAVLLLFLVTEFPQGILGLLSGVLGDCFFRNCYHNLGEIMDILALLNGAINFILYCSMSRQFRTTFGQLF 382          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|1058158370|gb|JAS82833.1| (hypothetical protein g.12391 [Homalodisca liturata])

HSP 1 Score: 312.383 bits (799), Expect = 5.437e-99
Identity = 165/383 (43.08%), Postives = 243/383 (63.45%), Query Frame = 0
Query:   44 TSYEPE----AICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK----KTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVR 416
            TS +PE    A C   L+E   GYR+IHG+ SL VC+FGTIAN+LNI+VLTRKE+ G+PIN ILTGIA+ADMLVM+EYIPF+ +  +L       + +   ++F+  H +FS ++H VSI LTL+LA+WR++ I+F   S   C+ +RC + +  A+ +PV +CIP+Y+  ++      + NQ   +Y LD S++A   ++ LY  + WLY  ++KL+PC VLT+++ WL+ +L++  ER  RL+  V  + +   T                  ++  DRTT++LV +L+LFL+TE PQG+LG+LS I G  FFK+CY  LG++MD +AL N AINFILYC MS+QFR+TF + F  K           ++ KC   +T V+
Sbjct:   64 TSRDPEPVVPAYCEGTLREVAAGYRQIHGYASLLVCVFGTIANLLNIIVLTRKELAGTPINRILTGIAVADMLVMLEYIPFSTYMYVLMPPGVR-QLTHAEAVFILVHMHFSQLMHTVSICLTLTLALWRYLAIQFPHRSHTMCSDKRCTLAIMGAFTLPVLICIPSYLVFSVRATQVTENNQVVTLYHLDLSDLAKRDDEFLYIASFWLYAVVVKLLPCAVLTVVSYWLVALLWQVNERKQRLRCDVFPTPDAPRT---------------YKPEKRVDRTTKMLVAVLLLFLITEIPQGVLGLLSGILGRCFFKNCYHQLGEMMDILALINGAINFILYCSMSRQFRETFGKMFKPK-----------LLAKCAPPNTEVQ 419          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|913313756|ref|XP_013187671.1| (PREDICTED: sex peptide receptor-like [Amyelois transitella])

HSP 1 Score: 309.301 bits (791), Expect = 1.473e-97
Identity = 158/367 (43.05%), Postives = 237/367 (64.58%), Query Frame = 0
Query:   53 NLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKK---TNQGKI---IYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRK--------RSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF--SCKSISSPGRQTNL 403
             +++    Y  IHG++SL VC+FG++ANILN+ VLTR+++  +PIN +L  +A+AD+ VMIEY+PF ++R LL    ++  YSW  ++++  H +F+ ++H  SI+LTLSLA+WR+I I++ + SP  CT +RC + +  ++++P  LCIP+Y   TI+K      +G I   +Y +D     + ++  LY++N W++  L+KL+PC++LT+I+ WLI+ LY+A  R   LK      A+      T+ NG+    G+I +RK        R TDRTT++LV +L+LFL+TEFPQGILG+LS I G  FFK CY   G++MDA+AL N AINF+LYC MS+QFR TF Q     C      G  T L
Sbjct:   77 EIRDLILAYNGIHGYVSLLVCLFGSLANILNVAVLTRRDLAAAPINRLLKWLAVADVFVMIEYVPFAIYRYLLLPGQEDWPYSW--AVYMLFHMHFTQILHTASIFLTLSLAIWRYIAIKYPSYSPALCTDRRCSLAILFSFMLPPILCIPSYFVFTIHKDFTVDRRGNIPTKVYYVD-----SDYDGTLYQVNFWVHAVLIKLLPCLILTLISAWLIRALYRANSRKKALKGYSACPAD------TVVNGN----GNIFTRKSTKRSKAERRTDRTTKMLVAVLLLFLMTEFPQGILGLLSGILGRCFFKRCYDLFGELMDALALLNGAINFVLYCSMSRQFRTTFGQLIWNRCAPTPRAGSHTEL 426          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|549137403|dbj|BAO01052.1| (neuropeptide GPCR A3 [Nilaparvata lugens])

HSP 1 Score: 306.99 bits (785), Expect = 4.444e-97
Identity = 155/348 (44.54%), Postives = 226/348 (64.94%), Query Frame = 0
Query:   53 NLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGK----IIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLK----NRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK 392
             +++  K YR +HG++SL VC FGTIAN+LN++VLTRKE+   PIN ILTGIAIADMLVM+EY+PF  +  L    S  +E+++  ++F+  H++FS V+H +SI LTL+LA+WR++ IR+   S I C+ QRC+  L  A+++P+ +C P+Y+  +I       K    ++Y +D S++A   + LLY +N+W+Y  L+K+ PC++LT+I+ WLI VLY+   +   LK    N     A  +  K  +    +R+           DR  R+LV + +LFL+T+FPQGILG+LS I G  FFK+CY   G++MD +AL N AINFILYC MS+QFR TF Q F  K
Sbjct:   51 GIRDLAKSYRSVHGYVSLIVCAFGTIANLLNVIVLTRKELCSVPINRILTGIAIADMLVMLEYVPFACYMYLRP--SILSEFTYTGAVFILFHTHFSQVLHTISICLTLTLAIWRYVAIRYPQQSHILCSEQRCQQALSAAFLLPLLICAPSYLNFSIRSTKVLEKSGVVVLYHIDLSQVAKEDDGLLYIVNLWVYAVLIKIFPCLLLTVISYWLINVLYRVNRKKQELKSNTFNMTGAGAEASGGKPKLDRAGKRI-----------DRGARMLVGVFLLFLITDFPQGILGLLSGILGRCFFKNCYHLFGEIMDILALLNGAINFILYCSMSRQFRTTFNQLFKPK 385          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|817073375|ref|XP_012258823.1| (PREDICTED: probable G-protein coupled receptor 139 [Athalia rosae] >gi|817073377|ref|XP_012258825.1| PREDICTED: probable G-protein coupled receptor 139 [Athalia rosae])

HSP 1 Score: 303.523 bits (776), Expect = 2.724e-95
Identity = 169/397 (42.57%), Postives = 253/397 (63.73%), Query Frame = 0
Query:    4 IKNQKVNIFSPIFNSTLNSTDGFNMTSNYSY-----LTTTPEGILTSYEPEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKK----TNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            + N+  N+ S +F     + +  +  +N+S+     + TT   +  + E    CN  +++F   Y+  HG+++L VCIFGTIAN+LNIVVLTRK+M  +PIN ILTG+A ADMLVM EY+PF ++  L+    +   Y W  ++FV  H +F+  +H +SI LTL+LAVWR+I IRF   +  +CT  RC+V L+ + + P+  C P+Y+   I ++      Q +I+Y +D  +  +     LY++N W+   ++KL+PC++LT+I+ WLIK LY+A+ R   L++    + N+       + GSRR + S    +R TDRTTR+LV +L+LFL+TEFPQGILG+LS + GD FF++CY   G++MD +AL N AINFILYC MS+QFR TF Q F
Sbjct:   30 VMNRHENM-SDLFKKLNITEEDIDYMNNFSFPNLPTIHTTSSSVDNNPEKFCYCNGVVRDFALSYKVYHGYVALIVCIFGTIANMLNIVVLTRKDMVSAPINRILTGLATADMLVMFEYVPFAVYEYLILPEKQVFPYGW--AVFVLFHMHFAQALHTISIGLTLTLAVWRYIAIRFPQHNHSWCTAARCRVALWSSLLAPLVACAPSYLVFGIREERFEENGQVEILYYVDAMDANSTGKGFLYQLNFWVLAVVVKLLPCLILTVISCWLIKALYRAKGRKQALRDYNPCAVNSMK-----NGGSRRASKS----ERRTDRTTRMLVAVLLLFLVTEFPQGILGLLSGVLGDCFFRNCYHNFGEIMDILALLNGAINFILYCSMSRQFRTTFGQLF 414          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|529515091|gb|AGT02812.1| (myosuppressin receptor [Rhodnius prolixus])

HSP 1 Score: 299.671 bits (766), Expect = 9.453e-95
Identity = 165/363 (45.45%), Postives = 236/363 (65.01%), Query Frame = 0
Query:   43 LTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKT--------NQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSP 397
            L  ++P        F   YRE+HG+LSL VC+FG++AN+LNIVVLTR+EM  SP N ILTG+A+AD+LVM+EYIPF +    L+  S+   Y++G+S FV  HSNF+ V H +SIWLT++LAVWR+I + +   +  +C +QR  V +FL Y+I   LCIP Y+A  I  K+         Q + +Y++ +SE+ +A++ LL  +N W+Y+ ++K+IPCI LT+++  LI  L  A+ R      R  L++ +  T   + N            +R TDRTT++L+ +L+LFL+TEFPQGILGM++ I G  FFKDCY  LGDVMD +AL NSAINF++YC MS+QFR TF   F  + +  P
Sbjct:    9 LPEHQPYCGEGFDTFRNVYREVHGYLSLWVCLFGSVANLLNIVVLTRREMT-SPTNAILTGLAVADLLVMLEYIPF-VWLMYLSPSSRSDRYTYGWSFFVLFHSNFTQVCHTISIWLTVTLAVWRYIAVAYPQRNREWCGMQRTIVAIFLGYVICPILCIPLYLAFNIQSKSPPLDDNTWTQNQTLYIVHFSELGSANHNLLVDLNFWVYSVVIKIIPCIALTVLSLRLICALMDAKRR------REALTSGSKKTPRNLEN------------ERQTDRTTKMLLAVLLLFLITEFPQGILGMMTIILGRGFFKDCYGKLGDVMDILALINSAINFMIYCAMSRQFRNTFSLLFRPRWLPVP 351          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|1058041277|gb|JAS24300.1| (hypothetical protein g.32110 [Clastoptera arizonana] >gi|1058050809|gb|JAS29066.1| hypothetical protein g.32112 [Clastoptera arizonana] >gi|1058063725|gb|JAS35524.1| hypothetical protein g.32104 [Clastoptera arizonana] >gi|1058066231|gb|JAS36777.1| hypothetical protein g.32107 [Clastoptera arizonana])

HSP 1 Score: 298.13 bits (762), Expect = 4.507e-94
Identity = 165/373 (44.24%), Postives = 235/373 (63.00%), Query Frame = 0
Query:   48 PEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTI----------------NKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTN 402
            P + C   L  F+  YR++HG++SL VCIFG+IANILNI VLTR EM+ SP N ILTG+A+AD+LVMI+YIPF  H      R K   Y++G++ FV  HS+F+   H +SIWLT+SLAVWR+I + +   +  +C++QR  V +   YII   LCIP Y++  I                N  ++    +Y ++ SE+  AH++ L  +N W+Y+ ++K+IPCI LTI++  LI  L   + R  +L                 ++GSR+   +I  +++ TDRTTR+L+ +L+LFL+TEFPQGILG+LS + G+ FF +CYL LG+VMD +AL NSAINFILYC MS+QFR TF   F  K ++ P  + N
Sbjct:    9 PTSYCGQGLVSFHSAYRQVHGYVSLLVCIFGSIANILNIAVLTRPEMS-SPTNAILTGLAVADLLVMIDYIPFACHM-YFEQRPKRERYTYGWAYFVLVHSHFAQTFHTISIWLTVSLAVWRYIAVAYPQHNREWCSMQRTIVAIAGGYIICPLLCIPFYLSFNIISNVELLEDDGNSALPNSTSSYNVTLYFVNLSELGQAHDRFLADLNFWVYSVVIKIIPCIALTILSLKLICALLDTKRRREKL-----------------TSGSRKSTRAI-EKEKQTDRTTRMLLAVLLLFLITEFPQGILGLLSVMLGEPFFSNCYLKLGEVMDILALINSAINFILYCAMSRQFRTTFSVLFRPKWMAVPQVEAN 361          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|1009573768|ref|XP_015918743.1| (PREDICTED: sex peptide receptor-like [Parasteatoda tepidariorum] >gi|1009573771|ref|XP_015918744.1| PREDICTED: sex peptide receptor-like [Parasteatoda tepidariorum])

HSP 1 Score: 297.36 bits (760), Expect = 1.163e-93
Identity = 161/376 (42.82%), Postives = 235/376 (62.50%), Query Frame = 0
Query:   17 NSTLNSTDGFNMTSNYSYLTTTPEGILTSYEPEAICN--LQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK-KTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            + + N TD F    N+++L ++   +L   EP       L  +  GY  +HG+LS  VC+FG  AN+LNI+VLTRK M  SP N ILTG+A+ADMLVM  Y+PFT H  +    ++  ++S+G+++F   H++F++V H +SIWLT+++A+WRF+ + F   +   C++ + K  +   YI     CIP YI  T+++ + ++G I+Y +D+S+IA  HNKLL RIN WL++ + KL+PC+ LT ++  LI+VLY+A +R  RLKNRV+                           ++ DRTTR+L+ +L+LFLLTEFP G+L +LS I G  FF   YL  G+ MD +AL NSAINFI+YC MSKQFR TF   F
Sbjct:    5 SKSFNDTDFFG--GNFTFLNSS-GAVLDLNEPAPYYGEYLTVYRNGYGAVHGYLSFTVCLFGITANVLNIIVLTRKNM-VSPTNAILTGLAVADMLVMFSYLPFTFHNYIRQDLTEAEKFSYGWAVFTLFHAHFTVVNHTISIWLTVTVAIWRFMAVSFPASNTNLCSMPKAKCAIIATYISCALFCIPVYITFTVSEFRGDEGDIMYRVDFSKIAQQHNKLLERINFWLFSVITKLVPCVALTALSLGLIRVLYEANKRKQRLKNRVE-------------------------SDKTHDRTTRMLLAVLLLFLLTEFPAGLLALLSGILGTDFFNHVYLNFGETMDGLALINSAINFIIYCSMSKQFRDTFALLF 351          
BLAST of EMLSAG00000005667 vs. nr
Match: gi|675374033|gb|KFM66935.1| (putative G-protein coupled receptor, partial [Stegodyphus mimosarum])

HSP 1 Score: 296.975 bits (759), Expect = 1.624e-93
Identity = 165/383 (43.08%), Postives = 243/383 (63.45%), Query Frame = 0
Query:   17 NSTLNSTDGF--NM-TSNYSY--LTTTPEGILTSYEPEAICNLQEFYKGYREIHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINK-KTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF--SC 391
            N+++N  DGF  NM T NYS+  L    E I   Y  +    L +F +GY  +HG+LS  VC+FG  AN+LNI+VLTRK M  SP N ILTG+A+ADMLVM  Y+PFT H  + +   ++ ++S+ +++F   H++F++V H +S WLT+++A+WRFI + F   + ++C++ R K  +   YI+    C+P Y+  T++K +   G+I+Y +D+S+IA  HN+LL ++N W+++ + KL+PC+ LT ++  LIKVLY+  +R  RLKNR ++                          R  DRTTR+L+ +L+LFLLTEFP G+L +LS I G  FF + YL  G+ MDA+AL NSAINFI+YC MS+QFR TF   F  SC
Sbjct:   12 NASMN--DGFQPNMSTGNYSHNTLFGMQEEIDYPYFGDY---LAQFQRGYGSVHGYLSFAVCLFGITANVLNIIVLTRKNMV-SPTNAILTGLAVADMLVMFSYLPFTFHNYIRSDLDEKDKFSYSWTVFTLFHAHFTVVNHTISTWLTVTVAIWRFIAVSFPANTAVWCSMARAKCAIVATYIMCALFCLPVYLTFTVSKFRGEDGQIMYRVDFSQIAQRHNRLLEKMNFWIFSVITKLVPCVALTGLSLGLIKVLYETNKRRQRLKNRTEV-------------------------DRVHDRTTRMLLAVLLLFLLTEFPSGLLALLSGILGTDFFNNVYLNFGETMDALALVNSAINFIIYCSMSQQFRITFAYLFLPSC 363          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold101_size371023-snap-gene-1.11 (protein:Tk03063 transcript:maker-scaffold101_size371023-snap-gene-1.11-mRNA-1 annotation:"class a rhodopsin-like g-protein coupled receptor")

HSP 1 Score: 217.624 bits (553), Expect = 3.914e-68
Identity = 120/205 (58.54%), Postives = 152/205 (74.15%), Query Frame = 0
Query:  206 IATTINKKTNQGK--IIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLK----------NRVQLSANNNSTK------VTISNG---SRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            +A TI    ++G     Y+++WS++A A++KLLYR NIWLY+F+LKL+PCIVLT+ITG+LI+VLYKAEERSARLK           R      + +TK      V + NG   +++   +  SRKRS DRTTRLL+ ILILFL TEFPQGILG+LSA++G Q+F DCY+PLGDV DAMAL NSAINFILYC+MSKQFR+TFV+TF
Sbjct:    1 LAMTIKSSVHKGSNATTYLINWSDLANANDKLLYRTNIWLYSFILKLVPCIVLTVITGFLIRVLYKAEERSARLKNGGGGNNPNYRRPSEMPPSTATKHDPHGSVRLPNGYKGAQKSGPATSSRKRSIDRTTRLLIAILILFLATEFPQGILGLLSAVHGVQYFHDCYIPLGDVWDAMALINSAINFILYCIMSKQFRRTFVETF 205          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold206_size259025-processed-gene-1.14 (protein:Tk10932 transcript:snap_masked-scaffold206_size259025-processed-gene-1.14-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 79.7221 bits (195), Expect = 3.858e-16
Identity = 81/338 (23.96%), Postives = 148/338 (43.79%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYI---PFTLHRNLLTGRSKEAEYSWGFSLFVWS-HSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATA-------HNKLLYRINI-WLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTF 389
            +HG LS C+ + G   NI++I++L+R +M  S IN IL G+   D +V++  +    FT+ R   TG +    Y W    +V        ++    SI++TLS+ + R++++ +   +   CT  R K+ +F   +  V   IP +   T   +       Y+ D+ E  T         + L  ++ I W+Y   + +IP + L ++   +   + KA                 N T+  +SN            K+  +    LLVV+ I F+    P  IL ++      + F      +  V + +   NS++N ++YC+   +F+  F+Q F
Sbjct:   74 VHGVLSCCIGMGGLFGNIISIIILSRPQMKSS-INTILIGLVTCDSIVIVTSVFMFSFTVFR--YTGSAVFQFYYWQIYPYVLCVVYPIGMIAQTGSIYMTLSVTIERYLVVCWPLKARSICTNGRAKLSVFFFALFAVIYNIPRFFEVTWETQ-------YLEDFGENRTVIAVTDFRKSALYIKLYISWMYLVFMYIIPFVSLAVLNLLIFLEIRKA-----------------NVTRSILSN----------QEKKEHNLAVMLLVVVFIFFICNILPL-ILNII------ELFHKPNPQVIQVSNLLVTINSSVNILIYCIFGNKFKTIFLQIF 367          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold138_size318692-processed-gene-2.1 (protein:Tk02753 transcript:snap_masked-scaffold138_size318692-processed-gene-2.1-mRNA-1 annotation:"hypothetical protein CAPTEDRAFT_228436")

HSP 1 Score: 72.7886 bits (177), Expect = 4.486e-14
Identity = 84/346 (24.28%), Postives = 156/346 (45.09%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADM-LVMIEYIPFTL-------HRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRIN--------IWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKS 393
            +HG L L + +FG I NI+ +VVL +++M  + IN +L G+AIAD+ L+   ++ F+L        R L T  +   ++S  F   V       ++    S+ LT+++ + R++++     S   CT  R K  + L   I +   I  +       K+   +++  +D +   T       R N         W+Y   + +IP ++L     +++ V    E RSAR + R Q++             ++ V  S+            +L+VI+  F+L   P     M+S I  D  ++   + L  V + + + NS++N I+Y +  K+FR   +  F C++
Sbjct:   54 VHGLLILSIGLFGIIGNIVCLVVLCQRKMRNT-INCLLIGLAIADISLITTAWLMFSLPAFQIYFERRLFTKVTDIYQHSTPFVYPV------GMIAQTASVCLTVTITMERYLVVCMPFASRRICTYGRAKRCVMLIMTIAIVFNISRF----FEYKSETFQVLLPMDGNVTLTFLKSTPLRDNPLYISLYMTWMYMIFMYIIPFVIL-----FVLNVKIALEIRSAR-RKRSQMTT------------AQEVEQSL----------ALMLLVIVCTFMLCNAP----AMVSNIIEDLDYQA--IKLTQVSNLLIVINSSLNIIVYPIFCKKFRIILINMFHCQT 354          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold261_size233860-processed-gene-1.1 (protein:Tk10682 transcript:snap_masked-scaffold261_size233860-processed-gene-1.1-mRNA-1 annotation:"AGAP001862-PA")

HSP 1 Score: 70.0922 bits (170), Expect = 3.269e-13
Identity = 80/337 (23.74%), Postives = 146/337 (43.32%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIP-FTLHRNLL-----TGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLY---RINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSC 391
            +HG+L L V I G   NIL ++VL R  M  S IN +L G+AI DM+++   +  F+L    L      G S EA   + F+  ++     +++    S++LT+++A  R+I++    LS   CT  R +  + +     +   IP +    +  +T        L + +     +  LY    +N W+Y   + L+P  +L     + + +    E R ARL      SA  N     I                       +L++++++F+L   P     M S I     ++   + L  + + + + NS+I   +Y + S++FRK   +  +C
Sbjct:   41 VHGFLILIVSIVGITGNILCLMVLGRPTMRNS-INCLLMGVAIIDMVLITSAVALFSLPTLQLFLEENYGISTEALNLYQFTPILYP---MAMIAQTASVYLTVAIAFERYIVVCRPFLSRSLCTFGRSQRFVGVVIFFAILYNIPRFFEYELRSQTVDLAGTTTLVYLQSTDLRDDPLYIALYMN-WMYMIFMYLLPFSIL-----FYLNLRIGLELRRARLARIHMTSAQKNEEGCAI-----------------------MLIIVVVIFILANSP----AMASNIVESLGYEA--IELTQISNLLVVFNSSIYIFVYNIFSQKFRKICYRVLTC 338          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold138_size318692-processed-gene-2.2 (protein:Tk02754 transcript:snap_masked-scaffold138_size318692-processed-gene-2.2-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 66.2402 bits (160), Expect = 7.634e-12
Identity = 80/345 (23.19%), Postives = 155/345 (44.93%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADM-LVMIEYIPFTL-------HRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCT---LQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINI-WLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISS 396
            +HG L L +   G I N+L ++VL + +M  + IN +L G+AI D+ L++  ++ F+L        R LLT  S   +Y+  F   V       ++    S++LT+++ + R++++     S   CT    +RC V++  + I+        Y   T       G+ + +          N +   + + W+Y   + +IP  +L ++   +       E RSAR K           +++TI+             +++ +    +L+VI+  F+L   P  +  ++ A+   Q  K     L  V + + + NS++N I+Y +  K+FR   V+ F  K+ +S
Sbjct:   73 VHGLLILFIGFLGIIGNVLCLIVLCQPQMRNT-INCLLIGLAIIDISLIVSAWLMFSLPAFQIYFERRLLTKVSDVYQYTTPFVYPV------GMIAQTASVYLTVTITMERYLVVCMPLKSRSICTYGRAKRCVVLIMTSAIVYNISRFFEYKFETFQVLLPIGRNVTLTFLQSTHLRDNPMYISLYMTWMYMIFMYVIPFAILFVLNAKI-----ALEIRSARQKR----------SQMTIA-------------QQAEEGLAIMLLVIVCTFMLCNAPAMVSNIMEAL-AYQAVK-----LTQVSNLLIVINSSLNIIVYVIFCKKFRTILVKMFQGKTTTS 376          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1352_size45999-processed-gene-0.2 (protein:Tk11994 transcript:snap_masked-scaffold1352_size45999-processed-gene-0.2-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 61.2326 bits (147), Expect = 2.293e-10
Identity = 94/398 (23.62%), Postives = 168/398 (42.21%), Query Frame = 0
Query:   64 IHGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADM-LVMIEYIPFTL-------HRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCK--VMLFLA----YIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINI-WLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFP--EEIPMI 444
            +HG L L +   G I N+L + VL +++M  + IN +L G+AIAD+ L+   ++ F+L        R L T  +   +Y+  F   V       ++    S+ LT+++ + R++++     +   CT  R K  VML +     Y I  F     Y   T       G  + +          + L   + + W+Y   + +IP ++L     +++ V    E RSAR + R Q++             ++ V  S+            +L+VI+  F+L   P     M+S I  D  ++   + L  + +   + NS++N I+Y +  K+FR    + F C +       TN +V     D T V     T P+  +  L   +   P  +  PM+
Sbjct:   39 VHGLLILSIGFLGIIGNVLCLTVLCQRQMRNT-INCLLIGLAIADISLITTAWLMFSLPAFQIYFERRLFTKVTDIYQYTTPFVYPV------GMIAQTASVLLTVTITMERYLVVCMPLEARSICTYGRAKRCVMLIMTSAVLYNISRFF---EYKFETFEVILPIGDNVTLTFLLSTDLRDDPLYISLYMTWMYMIFMYIIPFVIL-----FVLNVKIALEIRSAR-RKRSQMTT------------AQEVEQSL----------ALMLLVIVCTFMLCNAP----AMVSNIIEDLAYQA--IKLTQLSNLFVVINSSLNIIVYPIFCKKFRTILTKMFHCHA------STNQVVIPFLYDETCV-----TTPNLHKRVLTKDTREQPWSQSFPMV 381          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold152_size304267-processed-gene-0.11 (protein:Tk10103 transcript:snap_masked-scaffold152_size304267-processed-gene-0.11-mRNA-1 annotation:"somatostatin receptor type 2")

HSP 1 Score: 57.3806 bits (137), Expect = 4.513e-9
Identity = 89/396 (22.47%), Postives = 166/396 (41.92%), Query Frame = 0
Query:   72 VCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYI-ATTINKKTNQGKIIYVLDWSEIATAHNKLLY---RINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGDVMDA--MALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQR---RSALNLKSSNFPEEIPMIITRGFENSTIKDDR 458
            VCI G   N L I V+ R     +  NL +  +A+AD   ++  IPF      L   S + ++ +G ++     +  S+     SI+LT+ ++  R+I +     SP Y T    +V+   A+     L +P ++ A TI K            + E  TA+  L     +     Y+F+L     I L +I  + I V++K +    + K+R                           +K+S  + TRL++ ++ +++L   P  I   L+ I+ +       + +  ++ A  ++ +NSA+N +LY  +S+ F+K+F++  +C +    GR  N            + +  +  P +R    SA +++  N  + I             KDDR
Sbjct:   85 VCIVGLCGNTLVIYVVLRYSKMQTVTNLYILNLALADECFLVG-IPF------LIVTSAKGDWIFGMTMCKIYLTTTSINQFTSSIFLTV-MSADRYIAVCHPISSPRYRTSVIARVVSLTAWATSALLMVPVFMYAATITKPLGGQNCNIFWPFDEEDTANGTLGVLNGQTAFTFYSFVLGF--AIPLLLILVFYILVIFKLKTVGPKNKSR--------------------------EKKKSHRKVTRLVLTVITVYILCWLPYWIT-QLALIFTEPGHTQDNVMVAVMLLAGCLSYSNSAMNPVLYAFLSENFKKSFMKACTCAT----GRDAN----------AALHVENSAFPRKRTLGASANHMERRNRLQSINGTNNHNNHTPKRKDDR 429          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold273_size229271-processed-gene-1.12 (protein:Tk00754 transcript:snap_masked-scaffold273_size229271-processed-gene-1.12-mRNA-1 annotation:"fmrfamide receptor")

HSP 1 Score: 51.9878 bits (123), Expect = 2.434e-7
Identity = 83/360 (23.06%), Postives = 152/360 (42.22%), Query Frame = 0
Query:   65 HGWLSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLA------VWRFIMIRFHTLSPIYCTLQRCKVM----LFLAYIIPVFLC-----IPNY------IATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITG---WLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFF----KDC------YLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFS 390
             G L   V   G +AN L + +L  K+MN S  N +L  +A+ D + ++  +   + ++  +G ++  EY++G+ L+     NF L     SI++TL+LA      VWR   + +H          RCK          YIIPVF+      IP +      +   I+  TN      +   +++    + +++ +N      +  +IP ++L+I+     W+IK       R   + NR            +IS   R  +     +K +  +   +L +I++LF +   P+ +L +   +  +       +DC       L    V   +   NS++NF +YC M   FR+     F+
Sbjct:   84 EGLLQTLVGTIGFLANGLAVPILCSKDMN-SIFNRLLVFLAVFDNIYIVCSVLEGIRKH--SGFNQMHEYAFGYVLY--QFHNFVL---CCSIYITLTLALERYRAVWR--PVEYHN---------RCKGANPWKRIAGYIIPVFIFSAIFNIPKFFEVEFVVRQEIDPVTNNTINQTLASPTDLRLNDSYVIFYVNA-ARLLVQGIIPFVLLSILNYRIYWVIK-------RRREMINR----------PASISQNVRSASAQ---KKANETQQAVVLFIIVLLFFICHTPRFVLNVHEFLTLESLRISIEQDCNGVSLWALIWASVSHFLMTLNSSVNFFIYCFMCATFRRILFSYFT 403          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold338_size202645-snap-gene-1.15 (protein:Tk00724 transcript:maker-scaffold338_size202645-snap-gene-1.15-mRNA-1 annotation:"allatostatin a receptor")

HSP 1 Score: 51.2174 bits (121), Expect = 4.104e-7
Identity = 83/362 (22.93%), Postives = 157/362 (43.37%), Query Frame = 0
Query:   90 KEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHA--VSIWLTLSLAVWRFIMIRFHTLSPIYCTLQRCKVMLFLAYIIPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRINIWLYTFLLKLIPCIVLTIITGWLIKVLYKAEERSARLKNRVQLSANNNSTKVTISNGSRRVAGSIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLSAIYGDQFFKDCYLPLGD--VMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCKSISSPGRQTNLIVNKCGNDSTTVRIRGNTIPSQRRSALNLKSSNFPEEIPMIITR 447
            K+M  +  NL++  +A+AD+L ++  +PFT      TG +    + +G    VW      L+     V I+  + +++ RF+ + +   S  + T   CKV++ L ++I V  C+P   A    + T      Y +           + YR + W +TF +     +   ++   LI  LY       RL N+              + G R  A SI ++K    R  ++++V++I+F L+  P  I+ ++    G + + +  L +    +   +A +NS +N ILY  +S+ FR+ F    +C   S P       V + G +   V   G      ++ A     +NF E   +++++
Sbjct:   72 KQMRNT-TNLLILNLAVADLLFVVFCVPFT-----ATGYAFPHSFPFG---DVWCKLVQFLICQTAYVGIYTLVFMSLDRFLAVVYPIESMTWRTETNCKVIIALTWVITVMSCVPLIFAH--GEITEGATNTYCMFLDNQTIPFLPIGYRWS-W-FTFQISFF--VTAYLLPLLLICGLYSVMLH--RLWNQ--------------APGGRASAESIRNKK----RVIKMVLVVVIIFALSWLPIHIILIMR---GMKLYPNTPLTVTTQIISHILAYSNSCVNPILYAWLSEPFRRGFWAVITCIKPSGPHG-----VLQNGYEMGDVMPHGRQAGHAKKCAQK-NGNNFAEATTVVVSK 389          
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold212_size255419-snap-gene-0.8 (protein:Tk00540 transcript:maker-scaffold212_size255419-snap-gene-0.8-mRNA-1 annotation:"orexin receptor type 2-like")

HSP 1 Score: 50.447 bits (119), Expect = 8.610e-7
Identity = 86/439 (19.59%), Postives = 174/439 (39.64%), Query Frame = 0
Query:   68 LSLCVCIFGTIANILNIVVLTRKEMNGSPINLILTGIAIADMLVMIEYIPFTLHRNLLTGRSKEAEYSWGFSLFVWSHSNFSLVIHAVSIWLTLSLAVWRFIMI-RFHTLS-PIYCTLQRCKVMLFLAYI--IPVFLCIPNYIATTINKKTNQGKIIYVLDWSEIATAHNKLLYRIN--------------IWLYTFLLKLIPCIVLTIITGWLIKVLYK-----------AEERSARLKNRVQLSAN----NNSTKVTISNGSRRVAG---------------SIXSRKRSTDRTTRLLVVILILFLLTEFPQGILGMLS-----------------AIYGDQFF-----------------KDCYLPLGDVMDAMALTNSAINFILYCVMSKQFRKTFVQTFSCK-SISSPGRQTN----LIVNKCGNDSTTVRIRG 419
            ++L V + G I N L  + +T  +   S  N+ +  +A+AD+LVM+   P ++  ++          +W F   +       +VI+     +++S+    FI   R+H +  P+  + Q+ K    +A I  I   + IPN +   +           V  + ++   H  +L+ ++              I +   LL  +P + +++   ++ K L++            E  S  +      S N    + + +++ SN +    G               ++ ++ ++  +  ++L+V++++F L  FP  +L +++                 A YG ++F                     +  G V   M   NSAIN I+Y  MS QF+  + +  SC+ +  SP  +TN    L  +  G++  T R  G
Sbjct:  145 INLIVFLIGVIGNSLVFIAVTTTKSMQSVTNIFIVNLALADVLVMLFCAPPSIIWDVTN--------TWIFGSLM-----CRIVIYIQDTSVSVSVLTLTFIAYDRYHAICRPLQFSSQKTKAAGVIAVIWGISCMIGIPNAVTLHL-----------VSPFKDLPCRHEDVLFDLSTCRPSWNEEFDISFIIMKAILLYSLPLLFMSVAYYYICKTLWRRNNIPGTHDTPTEGNSGHINGSTSSSVNLLTRSATLRMSKSNSTSGNPGLMATSDTRLHHCTNRTLDNQLKTRRKVAKMLIVVVVMFSLNMFPVHMLPIVNVSTVISVLELTMNILTRATYGSKWFYFVDKNMTQDSEAHERVTQVLMAAGIVTHCMCYFNSAINPIIYYFMSAQFKAQYRRILSCRCTADSPSPKTNHRTLLHQHDAGSNGNTCRKAG 559          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005667 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-6.465e-7538.55symbol:MsR1 "Myosuppressin receptor 1" species:722... [more]
-1.509e-7241.16symbol:CG13229 species:7227 "Drosophila melanogast... [more]
-1.188e-5332.57symbol:dmsr-7 "Protein DMSR-7" species:6239 "Caeno... [more]
-2.567e-5032.25symbol:dmsr-1 "Protein DMSR-1, isoform b" species:... [more]
-2.759e-5032.34symbol:dmsr-1 "Protein DMSR-1, isoform a" species:... [more]
-5.752e-4431.99symbol:dmsr-8 "Protein DMSR-8" species:6239 "Caeno... [more]
-4.848e-3829.79symbol:dmsr-2 "Protein DMSR-2" species:6239 "Caeno... [more]
-5.797e-3828.93symbol:dmsr-6 "Protein DMSR-6" species:6239 "Caeno... [more]
-1.207e-3644.44symbol:MsR2 "Myosuppressin receptor 2" species:722... [more]
-1.253e-3530.10symbol:dmsr-5 "Protein DMSR-5" species:6239 "Caeno... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592886276|gb|GAXK01072099.1|5.328e-9851.32TSA: Calanus finmarchicus comp2379194_c0_seq1 tran... [more]
gi|592763353|gb|GAXK01191214.1|9.216e-9046.72TSA: Calanus finmarchicus comp691290_c0_seq1 trans... [more]
gi|592763352|gb|GAXK01191215.1|8.484e-8547.83TSA: Calanus finmarchicus comp691290_c0_seq2 trans... [more]
gi|592869847|gb|GAXK01087715.1|2.039e-7147.20TSA: Calanus finmarchicus comp1849926_c0_seq1 tran... [more]
gi|592869846|gb|GAXK01087716.1|4.201e-7046.39TSA: Calanus finmarchicus comp1849926_c0_seq2 tran... [more]
gi|592840835|gb|GAXK01116709.1|1.016e-5148.35TSA: Calanus finmarchicus comp1076838_c0_seq1 tran... [more]
gi|592840834|gb|GAXK01116710.1|3.779e-5046.00TSA: Calanus finmarchicus comp1076838_c0_seq2 tran... [more]
gi|592840833|gb|GAXK01116711.1|9.750e-5044.44TSA: Calanus finmarchicus comp1076838_c0_seq3 tran... [more]
gi|592763350|gb|GAXK01191217.1|1.647e-4947.83TSA: Calanus finmarchicus comp691290_c0_seq4 trans... [more]
gi|592763351|gb|GAXK01191216.1|5.748e-4845.56TSA: Calanus finmarchicus comp691290_c0_seq3 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 12
Match NameE-valueIdentityDescription
EMLSAP000000056670.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s307:21679... [more]
EMLSAP000000034220.000e+079.63pep:novel supercontig:LSalAtl2s:LSalAtl2s188:1709:... [more]
EMLSAP000000060120.000e+077.14pep:novel supercontig:LSalAtl2s:LSalAtl2s326:50134... [more]
EMLSAP000000034576.118e-2928.89pep:novel supercontig:LSalAtl2s:LSalAtl2s189:19922... [more]
EMLSAP000000083678.423e-1122.69pep:novel supercontig:LSalAtl2s:LSalAtl2s510:29108... [more]
EMLSAP000000026229.103e-921.88pep:novel supercontig:LSalAtl2s:LSalAtl2s1528:6379... [more]
EMLSAP000000120812.833e-822.16pep:novel supercontig:LSalAtl2s:LSalAtl2s863:19895... [more]
EMLSAP000000068076.824e-822.55pep:novel supercontig:LSalAtl2s:LSalAtl2s382:14687... [more]
EMLSAP000000017709.025e-824.11pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316... [more]
EMLSAP000000106991.442e-720.51pep:novel supercontig:LSalAtl2s:LSalAtl2s709:73374... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
gi|75017612|sp|Q8SWR3.1|SPR_DROME1.100e-1725.81RecName: Full=Sex peptide receptor[more]
gi|464921|sp|P34981.1|TRFR_HUMAN7.337e-1422.47RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|9910884|sp|O46639.1|TRFR_BOVIN8.249e-1322.75RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|2495022|sp|Q28596.1|TRFR_SHEEP9.274e-1322.75RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|21264552|sp|Q11082.2|YT66_CAEEL7.538e-1221.79RecName: Full=Probable G-protein coupled receptor ... [more]
gi|136205|sp|P21761.1|TRFR_MOUSE9.815e-1222.31RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|56749105|sp|Q9VZW5.1|FMAR_DROME1.370e-1021.26RecName: Full=FMRFamide receptor; Short=DFR; Short... [more]
gi|6226254|sp|O93603.1|TRFR_CHICK2.424e-1021.74RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|267163|sp|Q01717.1|TRFR_RAT8.286e-1021.71RecName: Full=Thyrotropin-releasing hormone recept... [more]
gi|74966839|sp|Q23497.1|NPR9_CAEEL7.078e-921.92RecName: Full=Galanin-like G-protein coupled recep... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB14579.16.922e-10748.57class A rhodopsin-like G-protein coupled receptor ... [more]
gb|KFM66935.1|3.320e-9643.08putative G-protein coupled receptor, partial [Steg... [more]
gb|KFM68983.1|2.333e-9240.49FMRFamide receptor, partial [Stegodyphus mimosarum... [more]
XP_396970.54.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767544.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767543.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767542.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767541.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767540.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]
XP_016767539.14.391e-9044.86PREDICTED: neuromedin-U receptor 1-like isoform X1... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|242013230|ref|XP_002427317.1|3.387e-10448.57class A rhodopsin-like G-protein coupled receptor ... [more]
gi|998500008|ref|XP_015509921.1|2.254e-10143.11PREDICTED: sex peptide receptor [Neodiprion lecont... [more]
gi|1058158370|gb|JAS82833.1|5.437e-9943.08hypothetical protein g.12391 [Homalodisca liturata... [more]
gi|913313756|ref|XP_013187671.1|1.473e-9743.05PREDICTED: sex peptide receptor-like [Amyelois tra... [more]
gi|549137403|dbj|BAO01052.1|4.444e-9744.54neuropeptide GPCR A3 [Nilaparvata lugens][more]
gi|817073375|ref|XP_012258823.1|2.724e-9542.57PREDICTED: probable G-protein coupled receptor 139... [more]
gi|529515091|gb|AGT02812.1|9.453e-9545.45myosuppressin receptor [Rhodnius prolixus][more]
gi|1058041277|gb|JAS24300.1|4.507e-9444.24hypothetical protein g.32110 [Clastoptera arizonan... [more]
gi|1009573768|ref|XP_015918743.1|1.163e-9342.82PREDICTED: sex peptide receptor-like [Parasteatoda... [more]
gi|675374033|gb|KFM66935.1|1.624e-9343.08putative G-protein coupled receptor, partial [Steg... [more]

Pages

back to top
BLAST of EMLSAG00000005667 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 10
Match NameE-valueIdentityDescription
maker-scaffold101_size371023-snap-gene-1.113.914e-6858.54protein:Tk03063 transcript:maker-scaffold101_size3... [more]
snap_masked-scaffold206_size259025-processed-gene-1.143.858e-1623.96protein:Tk10932 transcript:snap_masked-scaffold206... [more]
snap_masked-scaffold138_size318692-processed-gene-2.14.486e-1424.28protein:Tk02753 transcript:snap_masked-scaffold138... [more]
snap_masked-scaffold261_size233860-processed-gene-1.13.269e-1323.74protein:Tk10682 transcript:snap_masked-scaffold261... [more]
snap_masked-scaffold138_size318692-processed-gene-2.27.634e-1223.19protein:Tk02754 transcript:snap_masked-scaffold138... [more]
snap_masked-scaffold1352_size45999-processed-gene-0.22.293e-1023.62protein:Tk11994 transcript:snap_masked-scaffold135... [more]
snap_masked-scaffold152_size304267-processed-gene-0.114.513e-922.47protein:Tk10103 transcript:snap_masked-scaffold152... [more]
snap_masked-scaffold273_size229271-processed-gene-1.122.434e-723.06protein:Tk00754 transcript:snap_masked-scaffold273... [more]
maker-scaffold338_size202645-snap-gene-1.154.104e-722.93protein:Tk00724 transcript:maker-scaffold338_size2... [more]
maker-scaffold212_size255419-snap-gene-0.88.610e-719.59protein:Tk00540 transcript:maker-scaffold212_size2... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s307supercontigLSalAtl2s307:216793..221090 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s307-snap-gene-2.6
Biotypeprotein_coding
EvidenceIEA
NoteSex peptide receptor
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005667 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005667EMLSAT00000005667-701514Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s307:216793..221090-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005667-688433 ID=EMLSAG00000005667-688433|Name=EMLSAG00000005667|organism=Lepeophtheirus salmonis|type=gene|length=4298bp|location=Sequence derived from alignment at LSalAtl2s307:216793..221090- (Lepeophtheirus salmonis)
ATGGAGGGAATTAAAAATCAAAAAGTTAGTAATTATCATTGCAATTTGGA TTTATTGTTAAAAATGATTTAACTTTATTATTCATAAATTATTTCCCGTT TATATTATTATTTTACTATATTTAAGACATATTCAGTCCAGTAAATCAGT CATTTTTCTGAGTTTTTATTATTAAATCTTAAAGTAAGTTTTTTTCTCCA GTCTCACCCAACCGAGAAGTTATATATTTGATGTTTGTGAATATGAAAGA GCGTTATAAGCACTGAGTGGCCATGATAAAAATAGTGTACATTGACAGTG AAAAAGAGTTATTAATGATATGTTCTATTAAATAAATTTTGAAAACATAT CTGTAAATTTTACTAATTTTCTTGTTAGCTACATATTTCGGAATTAATGT GAAATAAAATTGAATGTTGCTTTTATATGTACATATCGTAAATAATATCA TATTATTAATTATTGTTGCTATNGGAAAATGAACGACGTGTTTTATCCAA CTGTTAAAACAATATTTAAAGCAGCTATCATTGCACAAAACAAAGATGAA ATCGGGGAAATCGTTTACAACTCGACGGATCAAGTAAGAATATGTGAGCT AGGTACTTCTTCCTGAAACTATTTTGCCTGAGAACAATTTAGCATAAGCC ATTTTGACTCAAGCATATTTCGCCTGAGTATATATATATAGAAAATGAGG TTTATATTTCGTTATTGTTGATTTTTGTCAAAATTAATGTTTTATTTGTA TTTTTAAATACAAAAATTTAATGTTTATTACTATAAAATTGATCAAATGT TTGTATTTTTTTGAAAAAAGATGGAATTATGCCCTAAAAATTCTACGCAG ATACAAACAAAATCTCACTATATAAGGAATTTGAACCAGAGACAAAATAA TTAATAATAATAAAATTAAACAAACATAGCAACGATTCCAATAGAAGAAG TGATTAATTTTCATTAGACAGGATGAATTATTCATTGTAGGAAGGACTCA TGGATTGCCGATGTGAGCCAAGAGCATAATTTCATCATTATTCCAAAAGA AAACAAAGATTTAATGCATTTTATAGAAATAAACATTACATTTTTTAATT CAAAGGAAACATCAATTTCGACCAAAAATAAACAATAAACTACATTTATT TATATATTAAGGCGAAATATTCTTGATGCAAATTGTCCCAAGGCGAATTT GTTTATGGCGAAACGTCTTCAAGCAAAATAGTTTTTAAAAAAAAGTACCG GGCATCATGAATACCATACCTTGTAGACGTCATTCAAATATGAGAGACAC TAATATTTGAAAGCATTCCATTAGTTATATTAATTATTTTTTCTTCTTTT TAGATATTTAACTCTACACTAAATAGCACAGATGGTTTTAATATGACGTC CAACTATTCTTATCTAACAACAACGCCTGAAGGCATATTGACATCCTACG AACCTGAAGCCATATGTAACTTGCAAGAATTTTATAAAGGCTATCGTGAA ATCCATGGTTGGCTAAGTTTATGCGTTTGTATCTTTGGAACAATAGCAAA CATACTCAACATTGTTGTTTTGACACGCAAGGAAATGAATGGATCTCCCA TAAATCTAATACTGACAGGTTCGTTATCTATTTTTCTTTTCCAAGATTTA TAGCTTCAAATGACTTGAAAGATGAGTCTTCAAATGTAAAATCACAATTC ATGTATATTTGAGAAATATGAAGAAGAAATACTACATACATTTGTATTTA ACTTCTAGGGATAGCAATTGCGGATATGCTCGTTATGATTGAGTACATTC CTTTTACACTTCATCGAAACCTTCTTACGGGAAGATCTAAAGAAGCAGAG TATTCCTGGGGATTCAGTCTTTTTGTGTGGTCTCATAGTAACTTCAGTCT AGTAATTCATGCAGTCTCAATTTGGCTTACCCTCTCCCTTGCAGTATGGA GATTCATAATGATACGCTTCCATACACTTAGTCCAATTTATTGTACGTTG CAGCGTTGCAAGGTCATGCTATTTCTAGCATATAGTAAGTTATATAGTTC CCATAAATAATCAAAATCGATTGTATTCTAAATATAGTAAATAAAATATA TTTTAATTCTATACTTAACTCAACTCCACCCTTATTTAAACTACTTATTT GATAAATCAGTATGTTCTTTGGCTACCTATATACAAATAGTGAACATGAA AACCAAATTAGCAAAATATTAATCAAAGTGTAAATTTTTGTAAGATAAAT TCAAGCTATTTTGATTATTTGAGCCATAATAATTTCAATATATAAATTTT TAATTATTATATTTTTAATAGTCATCCCAGTGTTTCTTTGTATTCCAAAC TACATTGCAACAACTATCAACAAAAAAACGAATCAGGGAAAGATCATTTA TGTTCTTGATTGGAGCGAAATTGCCACAGCACATAATAAACTCCTTTATC GAATCAACATTTGGCTCTACACGTTCCTTCTTAAGCTCATTCCCTGTATC GTACTTACAATAATCACTGGATGGCTCATTAAGGTCCTTTACAAAGCAGA GGAACGTTCAGCTAGACTAAAGAACAGAGTTCAACTCAGTGCTAATAATA ACAGCACAAAAGTAACTATTTCAAATGGAAGTCGGAGAGTGGCAGGTTCA ATTAAMTCACGAAAAAGAAGTACGGATCGAACTACACGGCTCCTGGTAGT AATTTTGATTTTGTTTCTTCTAACAGAGTTTCCACAGGTTTGACAAATTT TGATCTCTCTTGATTGATGTACAACATAGTTAGATATTTTAATGAGATAT ATTTCTTACAGGGAATCCTTGGGATGCTCTCAGCAATTTATGGTGACCAA TTTTTCAAGGACTGCTACCTTCCATTGGGAGATGTAATGGATGCAATGGC TCTTACAAATTCCGCCATCAATTTCATTCTTTACTGTGTTATGTCCAAAC AGTTTAGAAAGACATTTGTTCAAACATTTAGTTGCAAGTCCATCTCCTCA CCAGGAAGACAAACTAATCTAATAGTAAACAAATGTGGTAATGATTCAAC CACAGTCAGAATAAGAGGAAATACTATTCCATCGCAGAGACGTTCTGCTC TCAACTTAAAGTCATCAAATTTCCCTGAAGAGATCCCCATGATTATAACA AGGGGCTTTGAAAATTCAACCATTAAAGATGATCGCATAATAAAAGAGGA GGAAGAAGTCGACAAACGCGATGGGGATTAATGTGCACAAAAAAAAAAAA AAAAGCTACGCGCATAATGGGTTTTTCGTTGAAAGTGCTTCATTTTTTTA TAAATAAAACATAAACAATTAAAAATTTTGAAAAATTTATTTTTTCAGTA CAATTTATAAATATATACCTGTATGTATAAAAATCAATTTCTGTAGTGTG GCCACCACGAGCACGTTTACAGAAGTAAAATTGCTGAACCCAATTTTTAC TACTTTTTCCAGTAAATGGACCAATGACTTAACGTGTCCTAAAGCAAATA ATCTAAAAATGCTAAATTGCAAAATTTAGGTGGACAATCAACTGGTCTAT TTCTCGAATTATCGCACATTGTAATTTTGCTTTAATCGATAAAATAATAT CGATTGTAACGTTTTCTGTCGGACAAGTGGTACTGTCTTGTTAAAACCAA ATGTTTGCCATGCCCATTCCTTGCAATGGGGACCCAAAAAAAAATCAATT ACCATGGTACGATAGCGATTTTCATTTACAGTAACGTGGCAATTATCACC ATCAATGATCCCTCCAGCATGAAGTCCACAACTAACAGTAACTTTTTCGC GATGCAATGATGTATCGAGAAGCACTTGTGGATTCTTGCATAACCAATAA CGCATATTTTGCTTATTAATAAAGCCATTCAGCCAAAAATAAGATTCATT ATTGAAGATAATGTTCTGATCGGAAAAACATTTGAAGCGGCCGTAATGAA AAACCGATTATGTCAATGTTGATCTTTTTCTCCTTATCACATGTATAATG ATTTTTGTGAACAAATATCAACTATGTAAAAACATTCAGTAATGTATGTG TGCGTAAAAAAAACTTAAGTTTTTTCTTTGGGGTCTCTCGGTCATACGTA AAAAAACATGGTATTTTTTTACTTTCTATATTTAAGGACAATATTTAGTA TGCTACACTCTTACGGACAAATTAAAGAGACAATAAAGTATTTGCAAGTA AAAGTTTTGTTTTGTTGAATCACTCCAAACTCAGTGTCGAAATCAAATTA TCCGTAAATAATGTTTTTCTTTCAAATTTTTATAAAAAGAATACGTAG
back to top
Add to Basket