EMLSAG00000006086, EMLSAG00000006086-688852 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000006086 vs. C. finmarchicus
Match: gi|592955745|gb|GAXK01002811.1| (TSA: Calanus finmarchicus comp834515_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.953e-1 Identity = 17/41 (41.46%), Postives = 24/41 (58.54%), Query Frame = 0 Query: 16 CSSNLIDQLIFIFSNHVKVVTLNDLPALNYFEIKCLMNHKV 56 C SN++ ++ FIFS + L+D ALNY I C N K+ Sbjct: 819 CLSNIVLKVAFIFSKLFTLDILDDYHALNYSTILCFQNCKI 941
BLAST of EMLSAG00000006086 vs. C. finmarchicus
Match: gi|592751210|gb|GAXK01203203.1| (TSA: Calanus finmarchicus comp521855_c3_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.877e+0 Identity = 15/42 (35.71%), Postives = 27/42 (64.29%), Query Frame = 0 Query: 9 NNDCILICSSN--LIDQLIFIFSNHVKVVTLNDLPALNYFEI 48 NN C+ +CSS +I ++FI + H K++T+N+ Y+E+ Sbjct: 1089 NNVCLKLCSSQKLIIFAVVFIINLHYKLLTMNNF----YWEV 1202
BLAST of EMLSAG00000006086 vs. C. finmarchicus
Match: gi|592751209|gb|GAXK01203204.1| (TSA: Calanus finmarchicus comp521855_c3_seq2 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 9.411e+0 Identity = 15/42 (35.71%), Postives = 27/42 (64.29%), Query Frame = 0 Query: 9 NNDCILICSSN--LIDQLIFIFSNHVKVVTLNDLPALNYFEI 48 NN C+ +CSS +I ++FI + H K++T+N+ Y+E+ Sbjct: 1089 NNVCLKLCSSQKLIIFAVVFIINLHYKLLTMNNF----YWEV 1202
BLAST of EMLSAG00000006086 vs. L. salmonis peptides
Match: EMLSAP00000006086 (pep:novel supercontig:LSalAtl2s:LSalAtl2s32:276170:276608:-1 gene:EMLSAG00000006086 transcript:EMLSAT00000006086 description:"maker-LSalAtl2s32-snap-gene-4.24") HSP 1 Score: 135.961 bits (341), Expect = 4.827e-43 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0 Query: 1 MSETKLLQNNDCILICSSNLIDQLIFIFSNHVKVVTLNDLPALNYFEIKCLMNHKVKFSLSISIIRVKL 69 MSETKLLQNNDCILICSSNLIDQLIFIFSNHVKVVTLNDLPALNYFEIKCLMNHKVKFSLSISIIRVKL Sbjct: 1 MSETKLLQNNDCILICSSNLIDQLIFIFSNHVKVVTLNDLPALNYFEIKCLMNHKVKFSLSISIIRVKL 69 The following BLAST results are available for this feature:
BLAST of EMLSAG00000006086 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000006086 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000006086 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000006086 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000006086 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000006086 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000006086 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s32:276170..276608- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000006086-688852 ID=EMLSAG00000006086-688852|Name=EMLSAG00000006086|organism=Lepeophtheirus salmonis|type=gene|length=439bp|location=Sequence derived from alignment at LSalAtl2s32:276170..276608- (Lepeophtheirus salmonis)back to top Add to Basket
|