EMLSAG00000009031, EMLSAG00000009031-691797 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000009031 vs. C. finmarchicus
Match: gi|592807352|gb|GAXK01147216.1| (TSA: Calanus finmarchicus comp43384_c1_seq1 transcribed RNA sequence) HSP 1 Score: 33.8834 bits (76), Expect = 3.485e-2 Identity = 28/76 (36.84%), Postives = 37/76 (48.68%), Query Frame = 0 Query: 1 MRSHFSSHFDTHFRSHAEATGDQGFA---FPDFFN------DDSDIFSLNEDSMFQGVNS-RTMKKMEVVLVVVIQ 66 ++ HF++HF +H +H A G FA F +FFN DDSD+F + D MF N RT K V Q Sbjct: 801 LKGHFANHFGSHKMNHESAGGHFDFADVKFEEFFNSPFGAHDDSDMFGRDMD-MFGSSNKVRTETKNGQKCKTVTQ 1025
BLAST of EMLSAG00000009031 vs. L. salmonis peptides
Match: EMLSAP00000009031 (pep:novel supercontig:LSalAtl2s:LSalAtl2s566:264621:264896:1 gene:EMLSAG00000009031 transcript:EMLSAT00000009031 description:"snap_masked-LSalAtl2s566-processed-gene-2.24") HSP 1 Score: 151.369 bits (381), Expect = 4.717e-49 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0 Query: 1 MRSHFSSHFDTHFRSHAEATGDQGFAFPDFFNDDSDIFSLNEDSMFQGVNSRTMKKMEVVLVVVIQLRNRLEIL 74 MRSHFSSHFDTHFRSHAEATGDQGFAFPDFFNDDSDIFSLNEDSMFQGVNSRTMKKMEVVLVVVIQLRNRLEIL Sbjct: 1 MRSHFSSHFDTHFRSHAEATGDQGFAFPDFFNDDSDIFSLNEDSMFQGVNSRTMKKMEVVLVVVIQLRNRLEIL 74
BLAST of EMLSAG00000009031 vs. nr
Match: gi|225717556|gb|ACO14624.1| (DnaJ homolog subfamily B member 9 [Caligus clemensi]) HSP 1 Score: 62.3882 bits (150), Expect = 3.630e-10 Identity = 36/73 (49.32%), Postives = 45/73 (61.64%), Query Frame = 0 Query: 1 MRSHFSSHFDTHFRSHAEATGDQGFAFPDFFNDDSDIFSLNEDSMFQGVNSRTMK--KMEVVLVVVIQLRNRL 71 M+SHFSSHFD HFRSHAEATG GF F DF NDD D+F L + +F + MK + E V ++ N + Sbjct: 122 MKSHFSSHFDNHFRSHAEATG-GGFDFEDFLNDD-DMFGLRGEDLFAKGSGPAMKNSRSESCHTVTQRVGNTI 192 The following BLAST results are available for this feature:
BLAST of EMLSAG00000009031 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000009031 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 1
BLAST of EMLSAG00000009031 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000009031 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000009031 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000009031 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000009031 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s566:264621..264896+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000009031-691797 ID=EMLSAG00000009031-691797|Name=EMLSAG00000009031|organism=Lepeophtheirus salmonis|type=gene|length=276bp|location=Sequence derived from alignment at LSalAtl2s566:264621..264896+ (Lepeophtheirus salmonis)back to top Add to Basket
|