EMLSAG00000010333, EMLSAG00000010333-693099 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592846673|gb|GAXK01110871.1| (TSA: Calanus finmarchicus comp331813_c3_seq7 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.254e+0 Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 0 Query: 2 EFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSR 48 E +LP+ LL PQE Q + P +GF LL +VY + R R Sbjct: 101 ETWLPL---LLVPQEEQ----QPRPVVGFRLLFTIVYSNSLWKRM*R 220
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592846659|gb|GAXK01110885.1| (TSA: Calanus finmarchicus comp331813_c4_seq8 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.877e+0 Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 0 Query: 2 EFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSR 48 E +LP+ LL PQE Q + P +GF LL +VY + R R Sbjct: 111 ETWLPL---LLVPQEEQ----QPRPVVGFRLLFTIVYSNSLWKRM*R 230
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592846678|gb|GAXK01110866.1| (TSA: Calanus finmarchicus comp331813_c3_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.938e+0 Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 0 Query: 2 EFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSR 48 E +LP+ LL PQE Q + P +GF LL +VY + R R Sbjct: 101 ETWLPL---LLVPQEEQ----QPRPVVGFRLLFTIVYSNSLWKRM*R 220
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592846661|gb|GAXK01110883.1| (TSA: Calanus finmarchicus comp331813_c4_seq6 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.964e+0 Identity = 18/47 (38.30%), Postives = 24/47 (51.06%), Query Frame = 0 Query: 2 EFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSR 48 E +LP+ LL PQE Q + P +GF LL +VY + R R Sbjct: 151 ETWLPL---LLVPQEEQ----QPRPVVGFRLLFTIVYSNSLWKRM*R 270
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592956271|gb|GAXK01002285.1| (TSA: Calanus finmarchicus comp90865_c7_seq4 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.421e+0 Identity = 13/50 (26.00%), Postives = 29/50 (58.00%), Query Frame = 0 Query: 1 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRIL 50 + FLP S LL P + +++ +PA+ +++ L+Y+ +++ S +L Sbjct: 211 INLFLPPSQLLLHPFCKFYSTSPRSPALHYAIAKQLIYYNILLITSSILL 360
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592956272|gb|GAXK01002284.1| (TSA: Calanus finmarchicus comp90865_c7_seq3 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.432e+0 Identity = 13/50 (26.00%), Postives = 29/50 (58.00%), Query Frame = 0 Query: 1 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRIL 50 + FLP S LL P + +++ +PA+ +++ L+Y+ +++ S +L Sbjct: 211 INLFLPPSQLLLHPFCKFYSTSPRSPALHYAIAKQLIYYNILLITSSILL 360
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Match: gi|592956260|gb|GAXK01002296.1| (TSA: Calanus finmarchicus comp90865_c10_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 5.488e+0 Identity = 13/50 (26.00%), Postives = 29/50 (58.00%), Query Frame = 0 Query: 1 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRIL 50 + FLP S LL P + +++ +PA+ +++ L+Y+ +++ S +L Sbjct: 1103 INLFLPPSQLLLHPFCKFYSTSPRSPALHYAIAKQLIYYNILLITSSILL 1252
BLAST of EMLSAG00000010333 vs. L. salmonis peptides
Match: EMLSAP00000010333 (pep:novel supercontig:LSalAtl2s:LSalAtl2s684:348623:348819:1 gene:EMLSAG00000010333 transcript:EMLSAT00000010333 description:"maker-LSalAtl2s684-snap-gene-3.0") HSP 1 Score: 120.553 bits (301), Expect = 2.336e-37 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0 Query: 1 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRILTDPDSSKNI 59 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRILTDPDSSKNI Sbjct: 1 MEFFLPISVCLLSPQERQINSNRINPAIGFSLLHNLVYHGEIIVRRSRILTDPDSSKNI 59 The following BLAST results are available for this feature:
BLAST of EMLSAG00000010333 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000010333 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 7
BLAST of EMLSAG00000010333 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000010333 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000010333 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000010333 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000010333 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s684:348623..348819+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000010333-693099 ID=EMLSAG00000010333-693099|Name=EMLSAG00000010333|organism=Lepeophtheirus salmonis|type=gene|length=197bp|location=Sequence derived from alignment at LSalAtl2s684:348623..348819+ (Lepeophtheirus salmonis)back to top Add to Basket
|