EMLSAT00000000480, EMLSAT00000000480-696327 (mRNA) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Cross References
External references for this mRNA
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of EMLSAP00000000480 >EMLSAP00000000480 ID=EMLSAP00000000480|Name=EMLSAP00000000480|organism=Lepeophtheirus salmonis|type=polypeptide|length=193bp MFFERVQKEQKGQLDLLVNNAYSGVGIINECQGKPFYECQTPDLWDKINGback to top mRNA from alignment at LSalAtl2s1072:100611..101341- Legend: polypeptideexon Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAT00000000480-696327 ID=EMLSAT00000000480-696327|Name=EMLSAT00000000480|organism=Lepeophtheirus salmonis|type=mRNA|length=731bp|location=Sequence derived from alignment at LSalAtl2s1072:100611..101341- (Lepeophtheirus salmonis)back to top Add to Basket
|