EMLSAT00000001502, EMLSAT00000001502-697349 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000001502
Unique NameEMLSAT00000001502-697349
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
M-F114 female
  1. PreAdult2
No visible phenotype
-Missing-
14.05.2013 - 09:00
02.07.2013 (All day)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1258supercontigLSalAtl2s1258:70737..78110 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000001502 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000001502EMLSAG00000001502-684268Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000006541EMLSAE00000006541-715469Lepeophtheirus salmonisexon
EMLSAE00000006542EMLSAE00000006542-715470Lepeophtheirus salmonisexon
EMLSAE00000006543EMLSAE00000006543-715471Lepeophtheirus salmonisexon
EMLSAE00000006544EMLSAE00000006544-715472Lepeophtheirus salmonisexon
EMLSAE00000006545EMLSAE00000006545-715473Lepeophtheirus salmonisexon
EMLSAE00000006546EMLSAE00000006546-715474Lepeophtheirus salmonisexon
EMLSAE00000006547EMLSAE00000006547-715475Lepeophtheirus salmonisexon
EMLSAE00000006548EMLSAE00000006548-715476Lepeophtheirus salmonisexon
EMLSAE00000006549EMLSAE00000006549-715477Lepeophtheirus salmonisexon
EMLSAE00000006550EMLSAE00000006550-715478Lepeophtheirus salmonisexon
EMLSAE00000006551EMLSAE00000006551-715479Lepeophtheirus salmonisexon
EMLSAE00000006552EMLSAE00000006552-715480Lepeophtheirus salmonisexon
EMLSAE00000006553EMLSAE00000006553-715481Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto771394auto771394Lepeophtheirus salmonispolypeptide
EMLSAP00000001502EMLSAP00000001502Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000001502

>EMLSAP00000001502 ID=EMLSAP00000001502|Name=EMLSAP00000001502|organism=Lepeophtheirus salmonis|type=polypeptide|length=915bp
MVRVTVKTALMNNCVKLNVRKQSTFVMMDPASILPRGAMESTTVQTRVMR
HFAPCKYVVYNCRSIPIPVLTILSIFSAQCNSTIEFACNDGKCIDKALLC
DGTPHCHDSTDEISCKSSNNCDGDDEWKCLSGDVCIDKRKRCDGYPDCHD
LSDEDIDQCPERDCNEEWQFKCWDRKRCIDSRRLCDGYTDCLDGSDEVDC
LSVVCQYWQFKCLLDGXCVDSRRKCDGYNDCNDGSDETNCKGLSTQTYIF
EHSPKTIPVKLFSNVILDCNVVNPSGKWTYEGQNVHDSTSAGLEGRLGTA
FKNGSLLIRNFQKEDVGYYTCASSGGNEVSSVYVVLDASSCKKECKDDEF
AQRVCGSNGLIYSSLCDLTKASCNLKIKIRPVAMSKCNRLTTSKCAIDER
ECVNPSGKCIKETSFCDGIPDCEDKGDEKFCFRKDMKSVIIGKNISVAIK
NELEPKVVRIKCHLSGENFLWWFRDNLIQSNSAHATDEKGHVLIITDLRK
GDAGWYSCRNRAMEEYTTYLNVEYPAIAKGGPAELSFLAGQRGVIPCRVD
ANPSISYIVWHKNGSPIGSTKGSLVLDSVTSSKDRGDYTCTPYNLRGTMG
PSTKVSVRVRTRFYECPVYCSTEIYDPVCGIDGRTYDNECFLILESCNNI
RMKDLYAVHSGRCEKNSYGNMGRPQMTTSTILEILRATTTMVPYMDFNLM
ETTMLPPLDIFAYPTTTLCATTTETITTKPIYYPWTTSRPYETTQTPLDS
DISCKDHEWTCDDGHCIPFVNQCNGVSDCPGGEDEKYCADLKNDFICGDM
LIDKSLVCDGYPHCLNGEDEGDCPVEKEDDLKWTCPDSDNEYICDDYGKC
ICASLAPGATLPSALDSQSYTTTTLSPLLTTSPTFLSYDDEYIDNNFFGS
GHFPMKEELDTQTFE
back to top

mRNA from alignment at LSalAtl2s1258:70737..78110+

Legend: exonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000001502-697349 ID=EMLSAT00000001502-697349|Name=EMLSAT00000001502|organism=Lepeophtheirus salmonis|type=mRNA|length=7374bp|location=Sequence derived from alignment at LSalAtl2s1258:70737..78110+ (Lepeophtheirus salmonis)
TTGTTTATGTTACATGCTTCAAACATATCTATAGTCTCATAAAATTGATC TGTGAGTTCAGTCTAGCCAGAGTCATATAGCTTCTTAACTTCTATGCTCG AGGACTTGAGTACAAATTTAACTATACATCGTATATTCATCATTTAAGAC ATTGTATTAAGTGTTGGTTGCAAATCCGTTCTGCATGATTCGCCTATCCG TTAAAAACATCGTACTTACGGTATTTGTATATAATTTATATTTCTTTCTC TCTCTTTTTTTTAAGGATGTGAGGGTTGAAATTTTAAGTTCAAGTATAAC TTAAGTATTAAGTCATTAAAAGTTGTGTAATGATGTGATGTTAGATTTAC TTTTTATAAAATAAATTCAATATGAATACGTTTCAGTTATTCTTGGGACT TTTCATCATAAATGAAGCCTTTTCGAGGAGAGCGAATGGTTGGTTTCGTT TACCGGATCATCTTCAACAAAAACGTCGGAGAATCAATGGATCTCGTAAG AATTTTCATTTATACATTCATATATATTTTTAGCAAAGGATGACCTTAAA TTATTATTCCTTTAAACACAAAATAGCTAGGCAACCAATACAAAGTGGGC AACCATCCTTTGATATGAATTCAATGATTCCTCCGCCACCGCCCATCAAT TACCCCCTKCCTCCACCTCCAAATGAACCAATTCTCGAAGATAGAATATA CTACGGGCGGCCCCTTTTTATCCAAAACTATCCATTCAGAAACATTCCGC CTCCACTAAATCCTTCTCCTCAAGAATATGAAAACTACATGCCAAATAAT GACTTTGAAGTAAATGATATTTTCAATAATTATGGATCCATGATTCCCAA TCATCCACCCAATTACAGTCCATCCATCGATGAGGGAATATTACCACAGA GTAACAACTACCCAATGGACCCATATTATTCTGAACCAAATTCTGGATCA CCAAATGGACTTTCCAGTCCAATACAGCCTGGTATTTAAAAAATCAAATT TAATTTAATATGATTAATTATTATCCATTTAATCAGTTGTCCCTAAACCT ATGAGACCCTGCAAGAACGCCCCTTTCCCTCCAATTCAGGAAGCAAATAA ATATTGTAGATTCATGAGTCCCAATTCTGATCAATACTACTATGATCCCA CTTCGAAAATGTGTCGTAAATATACAAGTTGTCTTCCGCCATCTTTTGAT CCCAGAATGAATGTTTTACGAAATTCCTTTGATACCTACGAAGAGTGTTT AAATTCATGTTATATGACTGGATCATGCTGTAGTCGTGGAGCTTCCTCTA CAAATCTTATTCCAGGTGATGGATCTATTTCTTTCAATATAATATCCATG TTATAATTAATTTGTATACTCTATAGACTCCAATCTCAATGACAAAGAAA TAGAAAAAAGTTTCTTCAGATGCTTGAATGGACGTTTAATTCCAAGGAGT GATATGTGCAATGGAATCATTGAGTGTTCGGAAGGGGAAGATGAAATGGA TTGCTTCCCTAAGACAACAACTCCGCCCATGTTCAATTCTTCACTGTACT TCCAATGCAGTAATGGAGCATACATAAAAAAAATCTTATTTGTGTGACGG AATAGCTCACTGCACTGAGAAGGAAGATGAACAAAACTGCTCTCTAAGAC GTATGAGACCTGAAACACGAAAGATCATAACATTGAATTCTAGAAACTTT GATGAAATTGTCTTTGGAAACACAAAGACGCATTTCGTCATGGTGTATTT CTTTGCACCTTGGTGTCCCGCATGTAATAGGTTTAAACCGAAGTATAAAA AAGTTTACAAAGACTATTATAAGAGGAATATAACGTTTTATGATGTCGAT TTGGATAGAGATCCCTTATTTTTAGATAGATTTATGATTGATACGTTTCC AAAAATTCTTTTCTGGAACTTGATGCTTCCCGGATCTCCCTTTGAGTATT ACAAGGATTTTGGTCTCACAAGTGAAGGATTTGGCCTCTGGATTGAAAAA GTCACAAAAATCCAATCTCAGAATTATTGCGGATTGAGAGAATTTCCTTG CCATGGAAATATGCAATGTTTGCCTAAGGAATTGGTTTGTGATTATGTAA CAAACTGCCAGGATGGAAGTGACGAAAGGTTATGTGCAAAGAATAGAAAA TCAGGGAGAAATAATTTTAATAATAAGAAGAAGAATAGACCCAATGTTAA AACAACTTCGACAACTTCAGTAACTGTTAAAACAACTACGACAACTTTAG TGATTATTAAAACAACACCGACAACTTCAGTGACTATTAAAACAACTCAT ACCAGTTTAATGGATAGTAGCAAAATAAAGAAATCATCCACATCCAACCC CAGATTTACGACTTCAACCCCTCCTCCCCGTTATTCAACAACAACTAAAA AGAGGAAATTCATCCCAAGGAGAACTAAAGCTCCCTACACTAAAAAACCC CCCATCATCACCACAACACTTTCGATTAGAACGACAACGCCAAAAAGATC AATTGTCAGAGTAACTCCCTTCGTACCATGGGCAATCAATACAACATCAA CTGAAAATTATGAATACTACGATGGAAACGAAATTCTAGATTATGGAATC ACCAGTTCCATTCTCCCCATTAATCCCTTTATACCAAAAACTGGCAAAAA TATGTCAATCCCCAAAAAAACTTTGAATTGTGAATTAAAATGCCGAGATG GAACATGCATACGATTCAACGAGAGATGTAATGGCATTCGAGAATGTTCT GACGGTGTGGATGAGCAGGACTGTGGTAATTGTAAGAGAACACAATTTAC TTGTAAGAGCAATAAGGAATGCATCGATTACATGAGACGTTGTGATGGTG AGAGTGACTGTGAAGACGGCTCTGATGAACAATTGTGTGAAGTTAAATGT AAGAAAACAGAGTACATTTGTGATGATGGATCCTGCATCAATTTTGCCAA GAGGTGCAATGGAGTCTACAACTGTGCAGACAAGAGTGATGAGGCATTTT GCCCCNTGTAAGTATGTTGTCTATAATTGTCGAAGCATTCCCATCCCCGT GCTGACAATTCTTTCTATTTTTTCAGCTCAATGTAATTCGACGATAGAGT TTGCGTGTAATGATGGAAAATGTATTGATAAGGCATTGCTCTGCGATGGA ACTCCTCATTGTCATGATTCAACAGATGAAATTTCATGCAAATCATCTAG TAGATAATAAAAATATACTATTTTTTAAAATAAAAACCAGTCTTTAAATG TTGTGCATTTTTAGATAATTGTGATGGAGACGATGAATGGAAATGCTTGA GCGGAGATGTTTGTATTGACAAACGAAAAAGATGTGATGGATATCCTGAT TGTCATGACTTATCTGATGAAGACATTGATCAATGCCCAGAAAGTATAAC AATTACGTATATAATAAAAACTACTTAACAAAAATTTATTTTCTATAAGG GGATTGTAATGAAGAATGGCAGTTTAAATGCTGGGATAGAAAGAGATGCA TTGATTCTAGGCGTCTTTGCGATGGATACACAGATTGTTTGGACGGATCA GATGAAGTAGACTGTTTGAGTGGTACGTGAGATTGTTTTATTCATTCTAA ATTATTTATCGAATTGTATATACTTTATGCAAATATAGTTGTATGCCAAT ATTGGCAGTTCAAATGTTTATTAGACGGAGMCTGTGTTGACTCTCGTCGC AAATGTGATGGATATAATGACTGTAACGATGGCTCTGACGAGACTAATTG TAAGGGACTAAGTACTCAAACATATATCTTTGAACATTCTCCAAAAACAA TCCCAGTTAAACTTTTTTCAAATGTGATTTTGGACTGTAATGTTGTGAAT CCATCTGGAAAATGGACATATGAAGGGCAGAACGTACATGATAGTACTTC AGCGGGACTTGAGGGTAAAATGATTTACATCAATCAATAGTTTATGATTT TTTTATCAATCAATAAACAGGACGATTGGGAACTGCGTTTAAAAATGGAA GTCTTTTGATTCGAAATTTCCAAAAGGAGGACGTTGGATATTACACTTGT GCTTCTTCTGGAGGAAACGAAGTATCTTCAGTTTACGTAGTCTTAGATGC ATCCTCATGTAAAAAGGAATGTAAGGACGATGAGTTTGCACAGCGTGTAT GTGGGAGCAATGGTCTCATTTACTCAAGTCTTTGTGACCTCACCAAAGCC AGTTGTAATCTAAAGATTAAAATTAGACCTGTCGCCATGTCTAAATGCAA TCGTTTGACAACATCTAAATGTGCAATTGATGAAAGGGAATGCGTCAATC CATCTGGGAAATGCATTAAGGTATAAAAATTACATCACACTAGTACCCAT GAATCCTTAAACTAAATTATTTATCACTTCAGGAAACATCTTTTTGCGAT GGTATTCCAGATTGTGAGGACAAAGGAGACGAGAAGTTTTGCTTTCGAAA GGATATGAAGAGTGTTATTATCGGGAAGAATATTAGTGTGGCAATTAAAA ATGAATTAGAGCCAAAAGTGGTACGCATTAAATGCCATCTATCTGGAGAA AACTTTTTATGGTGGTTCAGAGACAACCTTATACAATCGAATTCAGCTCA TGCTACCGATGAAAAGGGGCATGTCCTGATTATCACTGATCTTCGAAAGG GGGATGCAGGGTGGTACAGTTGCAGAAATAGAGCAATGGAGGAATATACC ACTTACCTAAATGTTGAATGTACTGTCACACACTGGAAAACTGATCTACA TTTAATGAATTTATCTCTCTCTTTTTTTCAGATCCAGCGATAGCAAAAGG AGGTCCGGCTGAACTTTCTTTTCTTGCTGGGCAAAGAGGAGTAATCCCGT GTAGAGTTGATGCTAATCCATCTATTAGTTACATAGTTTGGCATAAGAAT GGAAGTCCAATAGGCAGTACAAAAGGCTCTCTAGTTTTGGACAGTGTAAC ATCATCAAAGGATAGGGGAGATTACACATGTACACCCTATAATCTCCGTG GAACCATGGGTCCTTCCACTAAAGTATCTGTAAGAGTGAGAACCAGGTTT TATGAGTGTCCTGTGTATTGCTCAACGGAAATCTATGATCCTGTTTGTGG TATTGATGGGAGGACATATGACAACGAATGCTTCCTCATACTCGAGTCCT GTAACAATATCCGAATGAAAGATTTATATGCTGTTCATTCTGGAAGATGT GAAAAAAATTCTTATGGAAACATGGGAAGACCTCAAATGACCACATCAAC GATTTTAGAAATCTTGAGAGCCACGACAACAATGGTTCCATATATGGATT TTAACTTGATGGAGACAACAATGTTACCTCCATTGGACATATTTGCTTAT CCCACAACAACACTCTGTGCAACGACAACTGAAACGATAACCACTAAACC TATTTATTACCCATGGACCACTAGTAGGCCTTACGAAACAACACAAGTAC ATTTTAATCATTCCGTCAAAATTTTTAAATAATACCCCTTACATATTTTT AAAACTTTTATCATCATGGATGAATTTGCTTCATATTTAAAATTATGTTA CAGACGCCATTGGATTCTGATATATCTTGCAAAGATCATGAATGGACTTG CGATGATGGGCATTGTATTCCATTTGTCAATCAATGCAATGGAGTTTCTG ATTGTCCGGGTGGTGAGGATGAGAAATATTGTGCAGATTTGAAGAATGAT TTTATCTGCGGGGATATGTTAATTGACAAGTCCTTAGTTTGTGACGGATA TCCACATTGTTTGAATGGAGAAGACGAGGGGGATTGTCCCGTAGAAAAAG AAGATGACCTTAAGTGGAGTAAGTACGATTAACAAGTAATTGGATGTCCT CACTATTTTTCTTCTTCTCATAGCTTGTCCAGATTCAGATAATGAATACA TATGTGACGACTATGGTAAGTGTATATGTGCAAGTTTGGCTCCAGGAGCA ACATTACCAAGTGCCCTTGATTCTCAGTCGTACACCACAACGACCCTTTC GCCGTTGCTAACAACAAGTCCTACATTTTTATCATATGATGATGAGTACA TTGATAATAACTTTTTTGGGAGTGGACACTTTCCGATGAAAGAGGAGCTA GACACGCAAACGTTTGAGTAAACCTATTCATGCCATTCACCACAATATTT ATAATATATTAATCCAAGTTACGTCCATTAATATTTAACTTATTTTGAAC TCTCTCCTATTATTTTTTTTTCTTGTGGACAGAAGTTAAGTAAAAGCTGA TATGAAATAAACTGAATTATAAGACGCTTCCGTATGATCGACTATTATGA GATATATTTATTATCCATAATTAATTTATTCATACTCAATAATAATAATA AATAGGAAGATANTTTTAAGGCAAATTTCTTATTAACAGAAAAATAAACT ATGTATAATTAGCTATTGTAATAAAATAAGCTACATCCTTGATTTGTTGA AGGACAGAGTTGTCGCTCTTAGCCATAAATAACCCGAAAAAATCAAGGTT CCTATTCTAATAGGACCAAGAACAGCCAAAAGTCCATATGACGAATAAAA AATTACTATATAAATAAATTGAATCAACATGAAAACGACCCACCCAGATT CCCCATATAAAAATTTGAGAAACTTAGTAGAGCGTTCTCTCATCAAAGAA TTACTTAATAGAATGATGAGGGGAATTTCACACAGTATTGCATGGAAAAT AGTAAAAAGGTAAGTCGTATCAGCCGGCAAAAATGATCCGTCTATAATCA TTCCCCAAGCAAAGAGAACGCCAATTCGGTCAGATATAAAGTATCCAAAC GCCCATGGCCCAAATTGAATGTACAAAATATATATTACTAAGGGATATAA AAGCTCGTTATAAGAGCTTAAAATCAATAAATTCTTTAAAAAATTAAAGA AAAATCCTCGGTTCTTCAACCATCGAAGGTTGTTCTTTTGAGAATATAGA ACACGAGCCATACAGAGTATGGCAGTGAGGCCAAATGTTAAAAGTCCAGA TATAAGCTGGGTCACGGTAATCCAGTTAGACATCAAAAGTATCCTCTCTA CAATTCCGAAATATTTACCGGATCCATCGAATGAAAATAGATGTGATGCG GTAAAGACTTTGTCCTTTGAGTTCTTTGCTTTGACAGTGATCAAGTGAGC TCCATGCTTGAAATCTTTTGTGGAAGTCCAATTCCCAATAAATAAGGGAC TATCTGCGTTCTTTCGATGGAGAGGAACTGTTATTTTAATGTTTGTTTCG CGATTTTCTATAACGGCAAATATATCTCTAGCATCGCCAAATACAAGAGC CTAAGAATAAAGTATGATAATATCATTAGTGAAAAAAAATCAATTTATAC GAACCCTTATTTGATCAATGTCTC
back to top
Add to Basket