EMLSAT00000003607, EMLSAT00000003607-699454 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000003607
Unique NameEMLSAT00000003607-699454
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
T F178 3607 female
  1. PreAdult2
  2. Adult
A few slightly abnormal
-Missing-
30.10.2014 - 13:10
09.12.2014 (All day)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s197supercontigLSalAtl2s197:416553..488599 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000003607 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000003607EMLSAG00000003607-686373Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000015711EMLSAE00000015711-724639Lepeophtheirus salmonisexon
EMLSAE00000015712EMLSAE00000015712-724640Lepeophtheirus salmonisexon
EMLSAE00000015713EMLSAE00000015713-724641Lepeophtheirus salmonisexon
EMLSAE00000015714EMLSAE00000015714-724642Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto777453auto777453Lepeophtheirus salmonispolypeptide
EMLSAP00000003607EMLSAP00000003607Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000003607

>EMLSAP00000003607 ID=EMLSAP00000003607|Name=EMLSAP00000003607|organism=Lepeophtheirus salmonis|type=polypeptide|length=168bp
YPNNYRLNITNVKKSDAGRYVCQISTFPPKGLFTYLKVEDALLELIDSNY
EAMMEQFYNPGSEIALTCIIRSREDWATDVIIGMQVEAEHVLSRLWIREA
SLSDSGNYSCIIQRKENIQFPRAKVNVHVVEGNLHAAIHSNISYILNPNV
ILTYFLILLHFTIYNEKN
back to top

mRNA from alignment at LSalAtl2s197:416553..488599-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000003607-699454 ID=EMLSAT00000003607-699454|Name=EMLSAT00000003607|organism=Lepeophtheirus salmonis|type=mRNA|length=72047bp|location=Sequence derived from alignment at LSalAtl2s197:416553..488599- (Lepeophtheirus salmonis)
TATCCTAATAATTATCGTTTGAATATTACAAATGTAAAAAAATCTGATGC TGGACGTTATGTGTGTCAAATATCTACCTTTCCGCCGAAGGGACTCTTTA CATATCTAAAAGTTGAAGGTAAATATTTATTAGAATTGTCAATTTCATCT ATAATATATATAATTTTTCAAAAAGAACTTATTATTATATAATTATGAAC TTAAAAGAATGTTATTAATTCTTTGGTGTTAACTTTTTATTTACTCCAAA TCAGCTTTTAAGTGAGAGATAAATCATTTTTTCATTGAAATAATAACTTG TAAGTGATATATTTATTGAGCCAATTTTACCGATAGCTTGACCTTTTTCT CAAAGAGTACCATTTCTCTCTTTTTAAATGAAATTTAGACAGTCAGTTTC AAAAAGAAATTAAACAAAATAAATACTTTTTTTTATTTTCACAAAACTTC TTCGGGTGGACAGACGAGCGGTGAACAAAAATCACAACCACTAAACCACC AACTTCATCAACGGTCAATTTAGCTTAAAATACGGGAATATATATTATTT TTTTTCACACTATAGATATAATTTGTAGGAGGATAGCCTCCTTAGACCTC AAGATAATATATCTAGAAAAATATACCTAGTATGTATAGTGTTTTCATGC AATGTCAACATTGTTAATATCGGTCAATTTGAGGGTCTTAAACAAGCAAG TTTTATAACAATGAAAACTATTTTTTTTCTTCATAAATGTGAATAAAAAT TGAAAGAACTATTGGATGTCAAAATGAAACCAACAAATATAAGGACTTAA ATGTTACTGGCAATCGTTATATCGGTATAAAATCTGATTGATTTATTATC TTCACGCCAATGGAGTTCAATTAAAGCGTAAATAATTTAAATTTCATTTA CATCAGGCAATTTTATTTCTAAAAGGTATATTTGAGCTTGATCGAAAAAA ATCAATGATAGGTTGATATATGATAACTCTATTATTTATTTACTTATCTA TACTTTTTATTATTATAATATAATATTATGACCAGAATTCAAAAATTTCA AAACATAACCCTTGAGATACTTTTACTTAAAATAAATTAGAATCAAACAG TATTACTGAAAAATTAGACTTATTAGAGCCAAATACTCTTTTGTAAATAT ACCAGTTATTTACGCTTAAAATATATTATTTTGCTGTAAAACAAATATAA ATTGAGGTGTTATTATTTTCTTAACTTTAAATCGAATATTCTCAGGATTA ATTGATCCTTTATAAAATATAACAACAATTCGAAATTAAAATAGATTTTT GTGAAGAAAATGCCCATTCTTTTTTTGTGGGTTATTAGGGTTTTTCTTAC TCAAAAGTTGGCTAAAATCTATAAAAGTGTAAAAAAAATTGAATAAAAAT TATGGAATATTGTATTTCATAAGAAAAAACTAATTACATTTTAGTCATTC TGCGTATTACTTCTAAAATTAAATATGGAAGTTAAAGATTTCTTTAAGGT TACAAATGTAGTCTTTAAAAAATATGATTTTCACAGAATTACCGCTAAAA TCTCTAATGTTTAAAAAAACAACCACCGACTTTTTCAGCTTAACATATTT TATCTATATTTATAAAGCAAAGTTTATCTGCATATACATAGTATTAATCA ATAAATGTATGTAGGAATGAGTCATTTTTTTTATCCAAGAAATAACAATG TAGTCATATTAATAAAATTTTGCATTGTTTTGTATGTAGAATTTGTTGTA TTATAATAATATAAAGAGATATCGGGAGAATAATTTTAATCAACAAAGAA AAAAAGGGCTATTATATGCATCCACGCTACGCAGGTTGCAACAAGAGAAT TAATATAAACAGGAACAGATAATATATAAGGACAACTATATATATAAAAC TCTAAACATATATACACAGATCAGTATTGAAATAATAATAATACTAACKC CTCCACTTCAATGCAGATTATTCAGCCTAATAATTCCTACAAGCTTTAAC AATTTAACATTAGACAGTCCTTTTGCTAGCATARCAGCCTCTATATCTTC ACTCCCACAGTAGACGAGTGTAATCTTGTTTGCCTTAACTAGTTTTCTGG TGAAATGATATTTTATATCAATATGTTTGGCTCTACCATGATATTGGGGA TTCTTAGTTAAGCTTATGGTCGATTGATTATCTTCAAAAATCACTGTAGC GCTATCAAAAGGTATATATTGCACAATAAATTTTGAATCGAAATACATTA TTGTGATACAGCAGAAGGGGCAAATATTCGGCCTCTACAATCGATAACTC GACCGACTTTTGATTTTGACTTTTTCAAGAGATAGGTCCTTTCATTGTAT AGGAAAATATAACCACTTGTTGACTTCCTATCGTCATGATCTCCAGCCCA ATCAGAATCCGAAAATCCTACGAGCTCTCCTTTATCACTTTTGCGATAAC AAAGACCAAGATTCCTTGTGTTCTTCAAATAACGAAGGATTCTTTTCAGA GCAACCTAATGTTCGGATCCAGGAGCATCCCAATAACGGGCAAGAGCTCC AACTGCGAATGCTAAACCTGGTCTGGTTCGAGTTGGTTTTGACTACCAAC AATTGATCGATATTCAACAGGTTTTACTATTTCTTCATCCACACCTTTTG TCACCTTTGTTTCTTAAGCTACAGGGGTTTCCAACGTTTAACTATCCTCA AATCCAGTTCTTTCTAGTATGCTCAGGCAAAATGTTGACTGACCAATCGA TATTTACCCATTTTTCATATCTTGTAATATATTTATTCCAAGAAAATATC GCACATGTTCTCCATCAGTATTCATGAACTTAGAGTTAATCTTCTTCTTT ATATCAATCAATTTGTCTTCAGAACCAATGAGTAAAATATTATCTACATG CACAGCAACAAATATTTTCCTTTGATAGTAAACAGACATAGATCTTCTTT TGTTTGCTCAAACCCCATTTGTTTTAAATGTTGACCAAGTGTAAAATTCC AATATCTAGGGGCTTGCTTTAATCCATAAAAACTTTTTTTCAATTTACAG ACCAATTTTTCATTTAGAGGTTCACTGAATCCCTCAGGTTATTCAATATA CACGTTTTCAGTTATTTTACCATTAAGAAAGGCAGTTTTCACATCAAGCT GATGTAATTGAAGCCCTTCTCCAGCAGCTATTGCTTAGAGCAATCGTACA GTTTCAAAGTTTTTTATCTTGAAGAATAKCCTTGCGCCACTAGCCGTGCC TTGAATCTTACAGGCTTATTTTCTTCATCTTTCTTCTTTTCTAATACCCA TTTTGTTTTTATAACACTTCTATTATCAGAACGTTCTACCAAAATCCCGA ACATTATTTTTATTCAAGGACATAAGTTCCATAAGGACATAAGGACACTT CCTCCCTTCTTCCACTCTGAACACATATGAACTTTGTAGAGCCTCTTCAA GTGGCTTTGGATCTTCGTGAAACACATATGCTTTTTCTCCAAAACGATCT GGTTGTTTCTTTTCTCTTGTAGATCTTCTTAGTTCTTGCACACTATTCTC AATCTTATGAGGAGAACGATAACCGATATCGTCCTTTGAATTTGCTTCAT CATTTGAGTTCTCAAACACTATCACTTTCTTGACAAGCTCAGGATTACAA TCATTTTCATTTAAACCTATGACATTTTCATCAAAAATAATATTTCTACT AAAAATAAATTTTTCCACTTTTAGGTTCTTATAATTTATTGCCTCTTATT TGTTCGGCATCTCCCAATAACACCATTCTTTTACTCTTGAAGTCCAGCTT TTGACAACTCTCTCTCGGTATAAAAACATGACTACAACATCCAATTTTTC TTAGATGTGCCAAATCAGCTTTTTACCGTTCCAAACTTCATAAGGGGTCT TCCTTTGAACTGCTTTAGTAGGACATCGATTTCGAATATAAGCAGCATTC AGAATTCAGCCCAGAATTTCTTGTCTACACCACTATTAGATAACATTGCA CGCACTGACTCTTAATGTTCTATTGATTCTTTCTGATACACCATTCTGTT GAGGATTCCTTAGTACAGTGAGTCCTCTCTTCTCGCTTACCAAATATTAA CTGAATTATTTAGATATATACTCTCCTCCATTATCAGAACGTAGGCATTT CACCCTTTTTCCAGTTTTTTTATCCACTATTACTTTCCAGTTTTTGAATT TTATGAAGGCTTCATCTTTATTCTTCAGAATATATACCCTAGTACGTCTC GATTTGTCATCATTGAAGGTAATAAAGTAATGACATCCACTCAACGAAAG AGTCTTTATGCGTCCAGATAAATCTGAATAAATTAATTGTAAAAAATCTT AGCTTTTCTCATGGATGATTGGTGTGGAAATGGTCTCTTACTAAGTTTNC CCCCCCCCCCCCCAAAAAAAAATGCAAGTCTCACACAAGTGATGGGTTAA CTAGGTATTTTTGAACTATAACGCCCATGTGTCCAAGGTGTCGATGCCAC TTTTCAAAATCGGTCCCTTTGGACATATTAACTCAATTTTTCCTTTTTCG ACATATTAGATAATACAGACCATCATTCCTGATGCCTCGTCCAACTACTT TATCTTATTTATATATACAACATTGATCTCCTTTGAAAGAAATTGAAACT CCTCTTTCAGATGCTTTTGAAATACTTAAAAGGTTGAATGATAATTCTGG TACACATCATGAGGTGTGCATGGTCTATCCAAAGTATCAGTCGTAATATT AACATTACCAATTCGAATTACTCTCAACGACCTTCCATCTCCAAGTGTGA TCTTCATGGACCCTTTCTTCATTGTTTTTATCTCTTCAAAAATACTTTTA TCGTGACACATATGACTCATTGCAGCTGAATCATTAATCCACTCCTTTGA ATTTAATTTATCTAACAAGGCAAATTGCTTTATTATAAGTCTGTAATCTT CTAATCCAGAGCCTTCACACGTTGCCACTTTGTTTATTTTATGGCATTTC TTCAACCCATTGGTAAACTGATCGTAAATTTTTTTATTTGGTGAGAATCC CTTTTCTTGTAACCAGGTTTGCCACAAACAAACCATTGAAGTAAGCGTCC GCTCCCATTAGCTAAACCCTTTTCAGGTTCTCTTGAAGTATTATCTTCAA GCTTCCTCTTTGTGTTCAGGATCCGCTCCACGACTTTTTCCCATTTAGGT ATCTCAGAATGAGCCTCCAATTCCGTGACAAATTTGTTAAAATATATAAG AAGKCTCGCTAACAGACACACTTGAACACTCTCACCGCCTTTCAACTCAC AAGCAACCAGCTTCTTCTGTAATTTTAGTTTGTTCGCCCAAGTTTGCTTT TGAAATTGACTCCAAACTACTGAGGGATCCGTTGCTTCACCGACTAAGTA TAGTAGAGTTGTATCTATTGCTAATACTATGTATAATAGCAAGGGCTTTG TGAATTCTAAATGCAACATGCGCAGTCAACTTCTCAGTCGGTATCTTAGG CTCCGTTTCTTCTCCCGTAACAATTTTCCAAGGATTCTCCTTCATGAGTG CCATGCGACACTAAAATTTCCACGTGTGGTAGTTAGATCCTTTAAAGGGA ACGATGGACATTCCGTCTACAGATATATCCCTCGATATACACTTCACTAC TCAATTCAAGCACAACAGAAAGGTATCTGGTCCCATAACCTGTTAGATTG TAATAATATAAAGAGATATCGGGAGAACAGTTGTTTGTACTGAGACTTCC CTTAATCAACTAAGACAAAAGAGTGATTATATACGACACGTAGGTAGCAA CAAGATAATTAATATAAGCACAAACAGATAATATATAAGGACAACTACAT ATATAAAACTGTAAACATATATACACAGATCAGAGTTGACATAATAATAA TAACAGAATTGAGCATGTATACAGGGTGCACTGTATATCTTTCTCCCTAA TGTATWTTTTATACATATTTTTGATCTCCGAATGAACAATGTAGCCGTAT TAATGATATGGTACTCGTAGACTAAAGTACTCCCTAGCTCAACAGTCATC TATTATTTTTTTTCTCAAACTGTTATAACTATTATTACAGTCTTGAGAAG ATAACTTTTAAGTATTGCGTATCTACGTGTGAGTGTGCTAAAGAACGACA AGTAACACTGAGAATTTCCTGGAGAGTTATTTTCTGAATTATTCAAGGAA AATTTGTCTTTTATTCAACTCCCAATTAATCTGAGCAATTGCGGGTATTA CTGCAACTTGCTAATAATTTCACCAACAAATTTTTACACTCAAGAAGACT TGTTGTTATTTACATTTAAAAAAGGGATCAAGGATACAGATTAAATTCAC GTATTGACTCAATATATGACGTCCCAACAATATTTTTCAAACTTCAATAC GTATATAGCTGAGTTTATCTCTCGGGGTCCTGTTTTCGCAGGGATTTACA CATATGGAAAAATCACAAGAAATCTCATATGTAATTATTTCATACTATAA GTTTAATTCAATTATGAGTTCAACGATTGAAAAATCAAAAGGTTTTAAGT TTTTACGATATATGCTTTGCTGTGTATGCATTGATCATATAAGTAATGTA GAACGAAGTGTTTCAAATTATATAACTTTACAAGAACAATAATCATGTAC GTCCGGAGTCCTTTTTTTCAAAATATCTCATACGGTGACAGTGAAAAATT GGCAGTGGAAAAAATAACAGGCAAAAAAGGAAAAGWCACGAAGTAGAAAA AGGGGACCATTCTTTTAAGCAGGTGTAATACCTATCTACAATATATAATA ATAAATACAATAAAAAAATAATTAGCAAACACGACAGTGATTCAAATGGA ATAATGACTTTTTTGTTATCTATTATCATTCGATCGGAAAAATTATTCAT TGTTGATAAGATTCATAGATTGATGAACAAACATAATTAGAGTGAAAGGG AGTGATTTCCAATTTTTGATCCAGGATGAGTCAAAAGAAGAGGCGATTGT TTGTGGTGAGGCAAATAACTAAGAGAATTCTGAACTCAATTGTTGGATCG ACACCTGAAATCTTTCAAGAGCCTTAAATCTCCTGATAGAGTAAACTCCA ACTGTACGTACCGCAATTAAACAAAAATAAGAGAAATACCTGAATTTTCA AATAATTTTGTTAGAGCAATTTCTGTCGTCATTATATTATTCACATTTAT TCAATAAAGGAAGTAATTGATGAAATTAAAGAATTACAAAGGAATTCATA TTTATTTTACAAATTAATGGAATTATAGCCGGATTCTTATTCTAAATAGG ACTCAATAAACACATAGAGTTGTAATATTCAGATTCTGTGATGAATACCA CAACTATACAAACAAAGTTAAGTATTCAAATGATAAAAATTCGTTGAAAA AACCTATAAGAAACTTATTATGCATTACATAAATTGGTTTGATATCTATT GGAAATATTAATTTACTGGATATTCATCTCTAAGGATAAGGTCTATTTTG TACTCTTTGGACAATAAATAAAGTCAGTGGAGAGACGAAGATCAACGTTT TTATCACTCTTCCTCTATTTTTCCTTCGACATCTTTGGATGTGGTTATCT TGTTTCCCCTGTTTGATTAAAATAAATTAGAATAATGTCGGTTACTCTAG CTAGTAAAAAAATTAAATCTATATTTGACATATCAGAGTGTGAAAAACTT TTTGTTAAAGGACAATTTTAGTTTAATAAGCTACAAATTGATAAATAAAT TACTGACACATAGTTTAACTATTATTAGATTGGATATTGAATCTTCCTTT TAGTATTTAGTAGTGTTGGGTTTCGGTTTGGAAATCCTACACTGGTCTGA GACCGTTATATTTTTTGTTGGACCGAATTAGCTTGGTCAAAAAAAACCTC GGTCTGGACTGGTTTCATATAAAAATTCAGTCTAGATTGATGCAAAGGAA AAGTTCGGTCTAGTTCGGTCACAAAAAATTGGTCTAGACCGATTTTACAG ATAAATTGTTTATAATATGACATCATGTATTTTTTCAAGTACAATGACAT TATACGAAGTTTAAACAGAGACAGCTTAGATTAATTTTCATACTGCCGTT TCCTGCATACAGTATTTGTTTCAGAACCTATCGAGTACTTATGAAATTTT TTTGAAAAAAATAAATGACTGTTTAGAAAAACAAATTGGTCTCTCATAAT ATATGAGACCGAAAATAATCGGTCCATAAATTGATACCGAAAAAAATTCG GTGTATGAAGTGAGACCGAAAAAAATCGACCCACGGTCTGGACGGAAAAA TTGGTCTAGAAAAAATCACTTTAGACCGAACAAAAAAATGAACTTAAAAT GAAATATTGGATACGTATATAAAATAAAGTATGTAAAAATTTGTCTCAAG GTTCGTTTGTTAATAAATTTTACACATAAAAATTGGTTTTTAACTGAAAT ATGTGTTATTTTCTGAATAATTTTTAATTTTTTTTAATTTTGCTATTTTT TTTAACAAACTTCAATTTTCAATTTTGTAAAAGAAATGTTTCAAAACGAT GCATTTTGTACATATCCCCATTTCATTAATTATTTTTTGCATTATTTGCA AAAACGAACCAGTTATTTTTTTGAGAACATTATTTTCCATAACTTTTTTT TTTAGTACGGAATTTTTTTTGGTAGGTTTGTGTTTCTCTGTGCCATGCCA ATAAATGCTATTTTTTTGCAAAATTAGTACGAAATAGTTTTTGCACATTT TGATTGGGCTTTTTTTTTGACAAAAATAAAAGAACTACTTCTTATCCAGA TAATTTTTTTGTCGCATATATGTTCGTATGTTATTTGAAGTTTATAAGAC AATTCATAAAAATACTACTAAGGTTACAAGAGCCTTGACAATGATAAAAG TATTTAGGGAGGAGGGGAGGGGTCTGCTATGACTTTGTGGATTACCTTAC CTCACTTAGGCGGATGAATATATTGCAATTAATATATATATTATAAAAGA GAGTCAATTTTCCTCTTCATCGTTATATTCAGCTTGAGAATTATAATTAT CAGGATCCGTCTTGACAACAACGAAACATTCATTTTTGTAATTATTAGTA TGATAGAATAATTTTATATATAGAATTATTTTTCAATTATTTTCAACATT GTCAATGTGATGTACCACTCCATCCTCAACCGAAAAACCCCAGATAACCC TTTGATACATAGTAAATTATAAAATTAATATTATTTAGTTTAATTAAAAT GAAATTAAATATTGTTTACATGAAAATGAAATAAACTTTCGTATGCATTA TGTATGTAAATTTTTCATATAATCCTTGCTTTGTTTTAATTAGTAGGATT TTTGTTGAGAGTTATTTACATTAAGTAATTTCAAACGTAATATATCTTGA GTTATCTTCTTTGAACTAGCTTAAATAAACGACTATTGCTAGGACTATTG GAAGGGCTTTATACAGGGATAAGTTCTTCTAGTCTAAAAGAACAAAATAA TCAATCGATAAAGGCAAATTGAAAATTCAATCTTTAAACAAATATGTACA ATTGAAAAAGTTAGAAAGTTGATTTGAATAAAAAGAAAATGCCATTCTAT AAAAAAACATACCAAAACCACAATTGGTTATTGGCAAAAAAAAAAACCCA CAAATTAGTTAACCAAGTTACTTGAATTGGTGATACTTATTAACACCTAC GATCTATCAAGCTTTTAACAATTATGTTACTACATTTAAGGTTGCAGAGC CGTTATTATAATAAGCGTTCTATTGAAAGATACCATTCTTTAATAAAAAG TAGCCATGATTAAATATAAATAAGAGAAGATTTAGAAATTGGAGGTAGTA TTTATAATTTGGTTTTATATAATAGTATTTATTGGGAGCACTTTCATTTA GGCATTTAACAGGAAACGACATAATTGTCTCATAATAATAAATTCTGTCT TTTTACTTTAAAAAAATATGAAGTTCTTCCTTTCTATCCCTCTAACTTTT AAATATTCATAATCTTGTCATATATGTATTGTATCATTAATCATATTTAT CAAAATAAAATATTTGGATTATTAAAAAAAAAAAAATCAAGTTTTTTTTT AGTGATATAATTATAGAATACAGAAGTTTTGATTTTATTACTTTGCTAGA ACAGAATCATGCATTAAGATACTGTAATTTTCAAAAAAGTCTCCAATTAC AAACAATCCACCTTCCATAATTTTTGACTTTTTTATTAAAAAAATTACTT TATGCCATAGTAATGATGTTTGCCAACTTTTATGGTTTATCATTAAATGT TTCTGCAAAATTTTGGATTGGAAGTACTATACTAGTAAACTCTGAACTTT CGATTGATATCCAAGGTTGATATAGTTTTATAACCTTTATATACCTTGGT GCCTGCAAATCTAAATAGGTATTGTAGTTTATACAAAGTGAAGACAAGCT ACAGAGAAAATAGTATACTTTTCAACAAATAGCAAAATGATTCTCGAATT TACAATCTCAGGCACACTCTACAACTTAAACTAAATGGGAGACCTCTCTG ATTATAGATTTTTCAAGACTAACTTAATAACTACTTAAAATGTAAGTACT CCCTACCGAAGAAAGCTTTTCGTAGTTGCTTACATCGAAGTTTTTAAGTC ATTTGTCTACAAAGTGGCTTAGTAGGGGCAAATGTTTCTTGAAAACATCA TTTTTATACATTTTTGGAAATGTTTTTTTAGGGTAGTACGACATAAAATT GGTACAAGCTTACCTTGAACAAGTTGAATTTTATCACTTTTTTTTTGCTA GCAAAAAGAATATATTATGAAATATCAAGTGAAAGGAGGGGAATCAATAC CTGACTACAAAATACATGGTATTTTTGTGTAAGCGAGACTGAGAAAAAAA ATATATATAAGTTGTAGCACATACATAAAACTACAATTTAAAATAAAATA AAATATTTTTACACAGTCCCACACAAAAATTTATGATTTATTTGAATTAA AGATACTATTATTATGCCCATAGAAATAAAGCATTAAATATTGCATAGAT GGTAAAAAGCTTTATACAATTTTCATAAATGATTATGAAATAGTTTGGTT TAGTATTTTATTTTTTTAAATTAAATATTTAAAATAAAAAATAAAAAATT GTATACTTATTAAAAAATATCAGCCTTATTTTGGAAAAAAGTCAAAAGTA TCACAACTATGAACCATATTGGACACTTATTTGAATTATTTAATTCAATC ACGGATGGATTAAGTACATATTTTGTAATATATGGAGAGAAAAAAAGTCA AATAAGTTAATAAATGATAATAGTAAAAATAAAGGATAATTACCGCCAAT TCAATAAATTTGATTGATTTACTACCCCCGACAATAGCTGACATGAAATG CTGCGATGACAGTACCCTTAAGCAATCTTTAGTTCTCTATGATCTAAATC AACATTCTTCTTCTTATAAAATTATTCTATTCAATCTTTTGACGCCATTT TTAGATCAATTATCATTTAAATTTCAAAACATGGAAACCTCACATTTTTT TGTGCAAATATGAAGTAGAATTGAAAAGATTCTCGGAAATTATTGTTCCT ATTCTCTTGGACCCTTTCATACATTAGAAAATAAAACTCCTTGTAGTTGA ACTTATTTGTAAGTTAATGCTTAAAAATATTGTGTATTTCTTCACATGTA TTTTGACATCTTTCTGCTTCGGATATCGAAGATCAAAAAATAAAATTCAA AATTTTGTGAGTTTGTCATAAAATGTTTTTTTTCATGATGTCTATGAAGA AAGCCAAAGTTCAGAGACCTACATGCTCATTATTTGGAAATGCATTCACC GATATACAACACATGTTGATTGGAATTCCGTCTAATAATCAACGTAATGG AAATAGAATGGGTATTAATAATTTTCTATAGAAAATAAAAACCATAAAGG TATTTTTATGCCAGGAAGAATTTTATCTCATTCGTTTCCCAAATAATTTA AATAGGGAAATTGTATATAACATGACTATACAAACATTTTTGGATCAAGG ATACTCTAAATATTGCAGGAGATCAACTTTTATTCCTCATTGGAATACTG TATGTCCCGAATTGGACATAATTGGACGGCAGAGTGGTATTCACCATATT TTGTATGATAATTCTGAAGAATTAAGCTAATTATTGAGGAAATACATAGA AAATAATCTTTTAATGGAGTGGACATTGAGTATTAAGGAGTACTTCCACC ATGGTCAAAGTAAATGGAGGGATTATAATAGCAGGGTTGAATACGCCAAA AATATTTTACGTTAATAACTTTAAGAGTTTTCCTAACCCAAATGAAATAG GAAAGCAACGTTACATTTATATTTATAAAGTTAACCTATTTTCTGTTGAG AATAAAATATTAGGAACATAAATATATATATATATATTAGCCCCAAAAAT TACCAAGACGGTTAAATAATTACAAATATAAGTAGGTTTCTTTTATTTAA ATATACACTAGCAGAGGGTTCCTGCGTTGCAGTGCTGTATAAAAAGGGAT AGAAACAAAGAGTGAAGGGGGAAGAAAAGAGATAGAGAGAGGGATGTAGA AAGAGAAGGGGAAGAGACTGAGAGAGACATAGAAAGAGAAAAGGAAGATT TTTTCAGTTAAAAACAGGCTCATGATTTCCTCGGAGGACTAAAAAAATAT AGGAACATGCTTCGTATTTTTAAACGTCTACTTGCGAAATTTCAGACCGA TATGATCGACCATTTTGGATTATATGTGTGATAATACTAAAAACAAACTT AAGATATGATAAAATACAAGGGGGTCGTTCTACTCTTTTTAGAGGGGCTG AAGACCCCCACGAAAAAGGAAGTTGCGAGGCCACTGTATATATATATATA TATATATTTGATCAGGCTAAGAGTGTACATTTATATTTCTTATGTTTTCA CTATTTTAAAATAGTTTTAGGAAACTATCAACAAAGAATCAAATTGAGTA GCATCTCTCTTATACTATGAATTGTAGTGTATAAGTTGTGTTTTGAGTCT TGAAATGCAATGTGATAATATTGGGTGAGAAAGTTAGAATAAAGTAGGAA GTTTTTTTCACATCTTATTTTCCTTTTCAGAGGCCAGAATAAAAAAAGAA AATATATAATCATGGTTATGTGTGGTGTATTTAATGAAGTTTCTTTACTA TTTCTAAAAATAAATCTTAGTCTTTGCTTTGTTGGAGTTTTCTTGTAATT TCAAAATCTTATTAGTAGTTAACACTAAATGAAATGTATAGAAGATTAAA TGTAAGTTTTTGATAAAATATCTACTAAATTCAATGACATATCCTCCAAG AAGGGTGGGTGTCTACTGTCCACTAAAACTCCTGTATAATAAGAAAACCT TTTTAAACAAGTATTCACGTCCTCTAAAAGTAATAAAGTTATTTGGGAAA CGAATGAGATAAAATTCTTCCTAGCATAAAAATACCTTTATGGTTTTTAT TTTCTATAGAAAAATTATTAATACCCATTCTATTTCCATTATGTTGATTA TTAGGCGGAATTCCAATCAACATGTGTTGTATATCGGTGAACACATTTTC CAAATAATGAACATGTAGGTATCTGAACTTTGGCTTTCTTCATAGACATC ATGAAAAAAAACATTTTATGAATAACTCACAAATTTTTGAATTTTATTTT TTGATCTTCGATATCCGAAGCAGAAAGATGTCAAAATACATGTGAAGAAA TACACAATATTTTTAAGCATTAACTTACAAATAAGTTCAACTACAAGGAG TTTTATTTTCTAATGTATCAAAGGGTCCAAGAGAACAGGAACAATAATTT CCGAGAATCTTTTCAATTCTACTTCATATTTGCACATAAAAAAATGTGAG GTTTCCATGTTTTGAAGTTTAAATGATAATTGATCTAAAAATGGCGTCAA AGGATTGAATCTGTAATAACAAGTTCCTTTTGCAAGTAAACATCTAGAGC TACTTAAACTACATTATAGTATAGCGTCAAAAAGAGACTAACTGAACTAA AAGAGGATAATAATTTATTTTATAAATATTTTTTTCTTAAATTCTTCTCT CATCATGTTTTTTAGATATTGACAAATTTTGAAGTCAGATAATTTCTGAA TAAATAATACATGCTTCAGTAATAACTTGGCTTTAGTAAGTCAGTAAATT TTTATTTTAAAAATTATGGCAATATAACATATAAAAGAGACAATACTCAT CTGTAAGATATAAAGGGGGGATTCACTTTCTGAACCTTGAAATTCTTCCT TGGGCAGAATTCCTACCTGGTTGTTAGATCTATTACAAGGTTTAAATATT AAATGTAAAGATAGCAATAATAATATTAATTAATTAAACTAAGAGTCTTA AAATTATATTTCACCTGTATCATAATTTAGGATTTATATACATGGAATAA CATAATTTAAATAAGTAAACATTTTATAATCAATAGGAGCAGTTACAAAT ATAAATTCATATGGTATTGATTCTTTATAGGAATTTAGTTATTAGAATAA ATTTATCTTAAGGTAAAATAAGAAATGTGTAATATTCCGTAATTTTGGAA GAGAGGAGGCTCAGATGACGATTTACATGAGATCGTTCAAGTTCGGAGTA CCTACAGATTATTTTTAATAAAAATTATATGATCATAGGAGAAACGTTAA TAATAAGAAGTAAAAGCCAATAGACATGCAAATTGAAATAAAATATCTAT AGGCCATATAACATATACACTCTGCACAACGCACATGTATGGAATTCTAG ATAACTTGATAAAACATTTTTAACAAATTACCAAAAAATCGTAATTTTCA TGTTATTTTTATATAAACCCTCAACGAGCGTTTAATAATACAATACAGTA CTGAGAAGAAACTTCCAACAAATGATTTCATATTGCCTTGGAAACTCAAT TCCATTATCTTTATGATGCAAAAAATCTCATTTGCACCACATGTTGCCTC CTTACAATATATAATATTAGTCTAATAGTTATATGTAACTACGATTAAAT ATTATTTACTTATCTTTTCCTTATAATATAGGGCACATGCCCTACCTTTC ATTAATCCATTTCTTGATGATTTTTTTGTTAAGACTGTAATGATTTGTAG GGATCCAGAGATAATACTCAAATTATCCCAAAACCTATAAAAGATCTTGA TTTTAATTTTCTGGAGAATGTCTACAGATTATACTTTTCAGTAAAACATC TTCTTTATTTATTAAAAAAAATAAGTATTCATAGTTAAATTATAATTAAA TTCCGCTTAAATATAACTACTATTTATATATTATATATAAAAGGAAAATT TAACAAATAAAGACAATACTGATATTAGTGATATCATATTAAACAAAAAG CAAATTTCTTGTTTCATTTTTTTTAACACATTATCTTCTTTTTGTCTAAC AAATTCTAAGCTTGCCAGTTTATTTTGCAATTTATTTCAGCTGAAATCTC GATTGCATAATTTTCATTTAAATTAACATCCAAATTTATTGTCGTTTCTG TTTAATGTTGATCATTCTAAATAACTCTTAGGTATTCTTTTTTAGATCAA ATTAATGTTGTTATGCGTCATTTTGATCCATAACATATGGTCATAAATAT ATTTACGGTAAGGAAGCAAAAAATAATATACCTCTGTTCCTAAACTTTTG TATATAACTTTTCATTTTTTATCTATTTTGTTCATTGATCGTATTGAATT CACCAAAAACGAACTTCATTTTAACAATCAACTGCTACAAGTTTTTATTA GGTTATATATCATACACTTATNNNAAAAAACAATGTATATTATAAAWAAT AAAGTTTTTGTGAGTAATTGAAACTAACACCATTGATCATTCATTAGTTT TCGTGTCTTAAATTTTAAAATAATTTTATAATACTAGACTGCACTAAAAT TAATTTTCGAACAAATTAAGATGCTCTTTTAGAGTTGATTGATTCTAACT ATGAAGCAATGATGGAGCAATTTTATAATCCTGGTTCTGAAATAGCTCTT ACCTGTATTATTCGAAGTCGTGAAGATTGGGCAACAGATGTAATGTGGAT GAAAGAAAATACGCTTCTGGATTTGTATAGTAAACCATCGATAAGGTAAT ATATTTTAAAATAAGCTTATAAGTTTGATAGTTATTCTCTATATTCATAA AGCAAAGTCTATCACTTTTGAGTATACACTTAATATCTTAAAACTACGTG AATAAAAATCTATAAAAAATAAGAATGTAGGAACGAACGTGTTTGATGTT CAGCTTATCATTTAGAAAAAATGTTTAGTTGATTATAAAGTGTTAATAAT ATATATCTTAACGCAAGACCAAAGTACAAAAAGAAATACTTTAGTATCTT TGTTTGCAATTTCGAATCATTTAACAAAAAAATTGAATCTAAATTTTTTT AAATTTCCTTTAAAATAACACTGTTCAACAGCAAAAAATTGTACGTGAAC AACGTATACTCAACTTAGTAGAGTTAAACCCCCTTAGTTCCAAATATGGC CTTATTTTTTTCTGCTAGGCTCTTGTCCTTTGAACCTAACAAATAACTTT AAAAAAAAGTTGTTTATTTCTAAAGCTTTTTTAAGTGATTGGTGTTGAAG ATTAGGAAAAATTATGTGAATATATTTAATGTTAAAAAATTATAAAAACT CAAGTTATCTTTGTTTAGAGATGAAAATAATTGTTTTTTATTCAAAGACT CATAGCTGCAAGACGATTATATTCCAAAAGTAATATGTTGTCAATTTGGC AATATTTCAAGGATAAATCTCATTTTTGAATTGAAAGAAAAGTGTGTATA TTTGCATGCCATACTCATGGCTAGGAAGAGAAGGAAAGTGGAAGAAAAAG ACAGAAACAAAACAAGAGATAAAAAAAAAGWATGTGGTAGAACTTAAAAA GTGTGAAATGAAATCCCTCATGAGAGTAGGATCCCAAATTCGGAATCGGT GATCATCAATGGAAAAGAGTGTATGTGTCGAAAGGAATTCCTTGCAACAA ATTCCCTGCTAAACTGCCCCTGGCCAGTAGGATTCGTTCGAAGGGCTCCC TTGAATGTCCGTCTTTTGGAATACCTCACTCACTACGGATCTGCAACGAG TCATCTGGTGTCTATGGATGAATGCAGTGAAAAACAAATATAATTTAATT TACTTTCTAATTAAGTTATAGCCAATTAGTATGGCCTGCAGGATGATCTC TTAATCACATTTTGGCTAACATCCAAAGTTTTTAAGAATCCTAACATTCA TCAAAAATCTATCTCTCTATTGTCTAGTTTTATTATATATATATATCTAA ACTATGTTATTACATTGTTATACATTCGTATTTCCATGTTGAAGATTAAG GTAGACTATTACAAAATTACGACTTTTCATTGGGACATATTACTTTGATT ATATTAAAATATCATTACTTATTGTTGCCATTGTTGTACTTTATTTATTT TTAAAGCCCATTGATGGAGTTTAATCAAAATTTCTTCAAAACTTATCCAT TTCCTGTAGTAGAAATATCAACTTTAAGACCCCAAAAGGTTGTCTTTTTT AATTATGATGCAATTTATGATGTCAGTGAAACGGATCTATATAAGTTGGT ATCGAATAGGATCTCCCAATTTTCTTATCTTTTTAAGTAAGAGCCGCTAT CCAGAAATTTTGTTATCACAAATCAAGGGTTCCTTCTCTGATGATGCTTC GATGTCTTCATATTGATCAGGTAAAGAACAGTTGGTTACAACTTCAGCGG TACACCTCCCTCCATCAACACCGATCCGAGATTAAACTCAGAAAAGAGAT GTATTATTTTACATTGACTTTTAATTCACTAGTACGAGTTATACCGCTCA TGCATCCTTATTTCAAGCTCCATAGCCACAAGATGACGACTCGTTGCAGA CACGTAGTAAATAAAGGATTACAAAAGACGGACATTCAACACTCTTCTCC ATTGATGCACTCAGATTCCGACTTTGGGATCCTACTCCCAAGAGGGATTT CATTTTCACAATTTATAAGCTCTACCACCTCCATTTTTTTCTCCTTCTTC CTTTTTTCTTCTTCCTAACTATGAATATTGCGTGCTAATATTATTAACTT TTCTTATGGGATCAATTCAAAAATTAGTTTCATTTTTGAAATATTGCTGT GCCTTATTTCAAATGGACAACAATGTACAGCGTTTTTGGGTAAGTTCTTT AAAAAAAAAAAAAAATCAGACTTTTAGATATCAAGTCAAGTACTTTTAAA CTTTTTAAATAAATTTGTCTTGGAGCTATGAGCCTCAGAATAGAAAGCAC CTAATTTCAACTTTAAACAAAGATAACTCGATTTATAACCTTAATAAATA CTTTTATTTTTTAGAATTTTGTATACTTAGGCTTTGAAATATTTTTACAT CATAATTTATCCATATTCTTCAAAACCAAGAGGTGTTCAAAGCTTTGAGC TTTAAAAAAAATTATAAAAAATATGGCCTTTTTCTGAAGGCAATGAGGCT AATAGGGGAAAATAAGACCATATTTTTAATTAGGGGATCGAATTCTAATA TTATGTTGTTTTTTAAAAGGGTGTGATTTTGTTGGATAGTATAATTTTAG CCTTAAAAAAAATCCTTTTGAATATAGGCATTAATTCTTCAGGTATATAG CAAATTCACAAAAATGTCGCCTGTTTATACTTGAAGATTAAATTATGGAA GTAAAAATGTTAGCTGGAGTAAATAATTTTAAAGACTGTAGTAGAGCCAA ATAAAGCATCATAAATCAAAAGAAGTCTCGAAACTATACCTAACATTCTT AATTATACATTAGGACATTCTATTATTTAAAAGATGTCTATGAAATATTG GTCCATTTATATTCATTAAGTATATTTTTTTCTCATATTCTAGAGTTAGT TCAAGATTGTTAATTTGAGATGCGTCATAATAATATTAGTTTTGTGTTAG TCCGTATTTAGGACCATAGACTGGAGTTCCGTCCAGTTTAGTACTGCATA TTTAGTCCTAAAAACCTATTAATTTCGGTCCTTGATGACGTCACTCCACT TTATTTCTATTCTTTTTTAATCAGTTATAGTACTTACAATCAGAAGGACC GGTCCGAAGGACTAATAGGGCCGTATCTAAGACTGGAATTGACTGAATAG ATAAGAAATGACACACCACTACATTTATTATTAACATATTTATTTGTGGT ACATATAATTGAACATGCATGAAAAATAAAGGTCTTTTGATGTAAAATCA CCTTCTGAAAGCTCTAAAAATAGTCAGTTTTTCTTTTATGTATCTGTAAA ACTTTTCTAAATTGTCATTTTCAAGATAAAGAACTTAATATATCTACTAT ATATTATTATTTTCTTTAATGTAAGGTTGGTATTTTGCCCATTTCCTTTC CTACTGATATGAGATCAAAACACCCATTTCGTTTATGTACATATTCTTTA GATACCGAAATTTTAAAAAGGAAGGAAAGAAGAGTAACACTGTGCAACAA AATTCATTTTGTTTTTCAAAAAAGGTTTTAAAGGGCGAATCTATTGCGGT TGAAGGTTTTAATGATCATTTTTGTGTTATATGGGCTTAATAATGATATA AATGTGTTTTAGCGGGTGGTAAAAAATGCTGATGTATACTGTAATTAATA TAACTTTACTTTCTTTTTTATAATACAAATATTTATATATAAATATATAT TTCATGTGGAAGATGCAAATTATTAAATTCAATGCCTTTATAAAATTTTT GGTTTATATTTACTCGGTATTATAGTCCAAACATAAGCCCCTTTTGTAAT AAAANNTGTAAYAWAAAWACCWAAAYWAYAAAANTMTTKAAATTACTAAW AYAWAAWAAAAWATTKAWAAAAATGGCCATATGGTAATTTCGCCGATAAA AATAGGCTTTATTCATCAATATAATCACCATCAAGACCAACACAATCATT CTAGCGCAGCTCTAACATTGGAATGCCACTTTTANNNNNNNNNNNNTCTT TTGCCTAAAAATAGTCCTCAGTTCAGTAATAATCTCTATTTTGGAGCGAA GTTTCTTACTGTTAAGCATTTTTTAGGTCTACGAACAACCAGTAGTCGCT AAGAGCTAAATTTGGAGAGTATAGTGGATGCAAAAGCATTTTTAAATTCA ATTAATGTTGTTTTGCCATTATTTCGATTNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCGTTGTCACAAGTTAATCAA AACAGCAATTCGTGTAGTGAAACGGGGCTTTCTTTTTCTTCAAATGGTAT CGATTCTATGAATATTATGCCACGCACATCCAAAAATACTCAGGCCATAA TCTTTCCATCTGATTGTTGTGCTTTCGGGCACTTTGAACGAGGTTTACTA GTTGCTGCCCACTCAAATGACTATCATTTTGATTCCGGAGAAAAGTGACG GATCCATATTTCATCCATTGCCGCATACCTACGCAAAAATTCTGCTATGT TACATTTAAATATGGCCAAACATTTCTCAGAAGGAACAGCATGTTTTTGT TTTAGGTCAACTGGAAGCAAATGCAGCTCACATTTCGTACAGAACTTTCC TATTGGCGAATGATTATGCAATATAAATGCAACACGTTCTGTTATCTTTA CGATATCAACTAACTTACGCAACTTCACTTTCCGATAATTAAAAACGATT TTGCTGATTTTTTTTCTTCTGTTCTTACTACCTCATTTAGAGGTCCACTG CGTTCAACATCATTGTTATCTCTAAGACCACGTTTGAAATTAGGAAACCG ACGTTTTATTGTTGTTTTTGTTTCATAACATTTGTCAAGCCATTGCTTAG CTTGTACTGAACTTTCCCATCAATTAGAAGTGTAAAATTAAAACACAAAA TTGTTTTTGATCCATTGTTTTGAAAATAACATAAGGTGCCTCAACCTTAG CACAATAACTCACAAACTAAAGAACATATTTTCATGAAATTTAGATAACC GTCTCTTGAAGGTTGGTACTAACTAAAAATGAGGTGAATTAAAAAGAAAA ATCCCATCTATGTGTGAGGCCCAGGACTTTTTAGCCCATGTGCTATATAT ATTGGACATTTTGCCTATCATATAGAAAAATAAATTTATAGCTACTTCTT TAGTAAAATATTACGAAGCAATATTTTGATACATTAATGAATGAAATACT ACGTAGGATTTTAGTATTATGAAATATATATATTTTGAAATTGTCTAAAA ATAATATGACAATGAATAATCTGGGAGTACTTAAAAGATAAATTGTAGTT CATATGGTTGACTTATTTGGCTAACTACCAAATGATTTCAGGCTTTTCTT CTGTTTGTTTTTTTGATGAAGGTTTGTGTGATGCAATGAAGGTAACGACG TCTATATTTATTATTTAATTAATTTATTTTTAAGTTTTTATAGGTTTACA TATAATTTTTTTTTCAAAAACTCAGCCCAGGCGGCAGAAAGTGTTTATGT TCCTGATACTGTAACAGCCATCGAGAATGCGGATAAAATGATGGAAATCG TTGAGTCCGACCGTAATGTTTGACAAGGAGATAAAATGGGGTAGGGGGGG CATAGTGTTAGTAGGCTCAAAAAACCCTGAGGGCACTCCTGCTCGTTTTT TAGAGCAATGATCTCTCTCAATGCTCCTTTTTTCGTTCGTATTTGAACTT TACAACTCTTTATGTAGCAAATACCTTTTTTACTTTATGACTTGAATGGG TAACGCAACCTATTGAAAGTGTGTGCTATTTTCTTTAGTTACATTCAATA CATAGAAATAAAGTGAAGAAAATATTATTCAGTTTATTTGGTGATATATT AATTATAATTATAAATCATTAATCAGAATTGTAGACTCGGACAACGGTTG TAGTTAACTCTTATTAAATTGGGACTTAGAACTCCAGGAGGAATCGATTT GGACTAGGAAAAAAGAATTTTCAGATTTGACTAAGACTCAATATAAAAGA CTCGTAACTCGAATAGAATTCGTCATCAGATCGACAAGGTTAAGATTTTA ATAGGACTCCAGGCTTGAAACTCACTAACTCACGTACCCAAAAACTCACG ACTAGACTTGGAGTGGTGTTATATTGGACTTTACTTTTGAGACTATCTCT CAATAGTTCAAATTCTACTAGTGGTCGTAAAAATTACTTGTGAACAAGTA TCTTTACAATGTACTCGTGGCCTTGAATTTCTATTTGATATGTATCGAAA TAATTCTACAAAAGAATTATCCCTATCAGACACAATTTTTAATATGGAAC TAAAAACTATGTTTGTTCTTGAATTCGACTTATATATTTGAAGATAAGTC ATTTAACTGACGGAAAGAAAAAATAATGCCCTTGTTCCAACATTGTTTAT GATTTCGATACAAAGTTTTACAGTGAAGACACAAGAGAAATAAATTAAAT TAGAAAGTAAAACTAATCAACCTTTATTATTTATATTTTATCAAATTTCT TTTAAATGGTTGAGCTCTATCAACTTGCGCACATCATAATGGATAAATAA AAAAATGGTAGTAGTTCATAATATTCTGGCATTGACTGACTTATATTATG AACCTTGTATATATCTTGATATATAAAGAACGACTCATTTACATCTTGAC ATCTGTATCAGTGTCATTAATGTCAACATTGGGTAGTGCTTGATTCACTA TTTGTACAAATTCATAAGGATCTTTTTAAATGCAACACTACATTATCAGA GATTTGAAAATAGTCCAATGACAGTATAACAATAAAAAATCATCACAAAA TAAACGAAGGCTTTATTAATAACAGCGGATTTCTAAACGCAAAAATGATA ATATAGACTTGTCCTATATGAAAATATTAGTCGTTGGAGAAAGTAACTAA CACATGCTACTATAATATTATACTAATAGATTTATTATGCTTAACTCTGG ATAGATACTATAAATATTATTAAGTAATAATCATTTTCATATTAATTTAT TTAAGGAGTTTCGATGAAACTGATATTAGAAGTACTGTACCTGTTCCCTA ATTTTTGAAATTGCTCCTTGCTATTTATTAATCATTATTTGTCTAAAATT ATGTCTCAATTATCTATAAAATATATCCTCGGAAAGTTTGTAAACATAAT TATAATATTAATATAATATAGTTTGCTTGATTCTAAGCGAATAGTATCAG CATTTTTTTAAATACTAACTAAGAGTTTTAAGACAATAAAATTATTATTC AATTAATCCGAACAAAATTGTGGTTTATGAACATTGAATGGATAATGACT ATAATTAATCATTAATGAATAGAATAGTTATATATTTAGCATTAAATAAT ATAGAAATAATTATATATGTAACTACTAATAAGAAAATGAATATCATGTA GTTCTGTAAAATACACATGCTCGTTGTTAGCGTTCAAGTCCTGTAGTAAA AGATTTCTTTGTTAAGTATGTTAAAAAAAGTTTCAAATTCATTTTTTTCC TTTTAAACCTGTTTTGTCTAATAGATAATAGTAAAAAAGACATTTCGATA CCAAAATCATTTCTCTAGCTTCAATATTAAGGAAATTCTGAGCAATTTAT CATCGGAATTTCAATATTTCATGATCAATATTTTTCATTAGTGCTTCATA AGATTTGAGATCTAATTTCTGCTATATAATATTTTTCAGCTTTTCTTCCA GTATTAAGTTTTCTGTCTAATTTACCCATAGTCATATAAATATATAAAAT ATAATAACCTTTTTTTTTTTAATTTCTTGTAGAAAGTATTCTTAATCTAT CGAATAAGAGATAATACAGGCCCAAAAAAATATGTAATTACTAGTATAAA TATAAAATATTTTAAATTTCTATAAAAAAAAATACAATTTGTGTAAACAT GACGGATCCTTTCATTTAATTTGTCCTTTAATAAATATTTATAAAATTAG TCATTATTTGACAGTGACAAATAGTTTTTTCTTTTTTTCACTTTAAATAA TATTTTTTAACATTTTCCTTTTAGTTCTACAATATTAAAATATTAATTAA TTCATATACCTACATAATAGTTTAGCTTAATTGTAAAACTTCTATACATA TATGTATTTTATTCCAGCCAAAAGTAATTTCATTCAAACAAAAATCATGA ATGGCTTTAATTTAATAATTAAAATAATGTAATTGATTAAAAATATTATT TTTTATATTTTTAATGAATTACATTATTTTAATTTCTTTCTATTGTCATA AGGTTAATTATCTTACATTTTCTTTTATTCTATTTAATCTAATATTAACC TTTTGTTGTAACTTTTATACATAATAGCTACATGCAAACAGATTAGTAAT TGATTTTTTATTACATGTATGTTTTACGACGTATCTCAAAATCATCAGTG GAAAAAAAGAAAAATGGATTTATACATTCTTCATTTAGTTATATTTTAAA ATCATAGCACTTTTTTTACTTAATTTTATCGAATATTTTATTAACTGCAA TAAATTGAATTCATTTTTCAATTCAAGGTTGCAGTCTTGTGTATAATATT CTTCCGATTTTTTATCAAAATAAACATTTAGAGCCATGGAGCAAACTAAA GCGTTAAAATTATACTTAGTCAATTTGTTCCCTCTTACCTGAAGTCCTTC CTTATTATAAAATGAAATCCTCGTAATTATTAAAGGATGAAGTAAGAAGA ATGGAATGGATGATAATTTAAATTATATTTGATAGAGATTAATAACATGC ATCATACGTCCGGTTATTCTTACGTCACAGTTCTATACATCATGAATGAA ATTTTGGCATAAGAATGTAGATTCAAAGGCAACATTATGTAAGAAAAAAT GGCAACGCGTGTACACTGAATTTTTACAGGCTAGCTGCCCGATGCGCTGC TTTAGTTTGCTCCATGATTCTAAGTGTTTATTTTGATAAAAAATTGAAAG AAAGAATATTAGACACAAGACTGCAACCTTTTAATTGAGACAATCTGATG TGAACTCATTACAAATATACCAGTGTTATTATCAATTGAATTTTGTCTGG ATTTATCTAAGCAACCCTGTAATTAAAAAATGACTTATTCGGGAAAAGGA AAATACCGTTTTTATTTCAGGTATCTAGAGTTCAACGATAAGTGTACTTA AGGATACCTAAATAATTTATATGAGAAGGTGCTGTAGGATGTTGCTCCCT TTGTTTATATTACTATAATGTTCGCTTATAACTTTAGTTATTATTGTCTA GAATGATCAGAGTGGGACTTATTATTTTGGAAATATTTTTACATGTACTT GTGTGTACATTTTCTATATTGTAAATCCATTAAATATACATACACGCGTC CCCATGGCCCATCTTATTTATTACTATTGTCAAATAGTCTAGAGGAATGC ACTTTATTTGATTACATTTATTAATGCTCAACATATAGCATTATTTCCAA TACAAATTTTACTCGTTTAACAGACCACTGTACTATAATATTTTTCATAG CAAAAATTTGAATGGAATACAGTAAAAAATGAGATTTTTTAAAATATGTA AAGAAATAATACATTTCTTTGACATTCAAGACTAAATAGGTGTCTGGTAT ACATATTTGATACAACAACATAAGAGATAACGACAAATATTCATACAAAA TCAAAAACTTGGCTTCATCACTCTGGACCATAGACGTGCCATTAAGGATT AAGGCTCCACCGATTCTTGAACTAAAAAGATCAAGCTATCTCCTCTACCC AGGATACTTAACAAAAGCTACTTCTTCCACAATAACAGACTCTCTGATCA CAACCTCCCCTTAATAAAGACATTTTCAAGCATAGTTTTTATTATAGATC GGATTCCATACCTTTTATGTTTTCCTCGGGATATTGAGGCTGGCCTCAAG CGATTTCGAGTTATTTCTTTTTGTGTACGACATATTTGCACCACATACAT CGAAAACTATGTATCTTATTTACATTGTGGGATTATTGTAATTTTTTTTT TGCACTTTTATGTTATTAAAAAAAAAATTAATATTCTTATTTTAAATGTA TTACTTTTACTAATAATGATTATTATTATATTTTATAAATACTAAATATA TGTCAACCTTTATAGGATTTGGTTATTTCCAATGATCGAAAATAAATAAA TAAACAGACATTGGAAAAACATTATTATAAATGGAGTTTCTTTAACCAAT GAAAGAAAGTTTACCTAATACAAAATATCCTTTCTTTTATTTTTGGCAAA AATAGAAATTTTACCATTTATTTTCATGGCTTTATTTAATTGATATGTAA AAAAAAAAATTAAAAAATGCAGTAAGTTTTTAGTACTTCTTAGTTCTAAT TTTAACTATCATTTTTTATTTATAATAAGTTAAATACATACTATATATAT ATAGGTATTACTTTTCAAAAACTCCACTCTCAGCAGCTATACATCTCCCC ACCTAAACAATTAGTAAACTGCATAATTTTAGGGTTAACGCTGACATTTT AGCCTGTTGCTCTTACATGGAGGTCTCTAGGATGTTAAGATTTTGTTGGT AGGTAGCACAGCATTTTAATGGCACTTTACACATAGTCGTAGAGGGGATT CTGGTTTGTTGATGAAAGATATCAAATTTGTTTTAGCCAAAATTACTAAG TTAATAACTTAATAATAACTAACAGTCACTATGATCCCAAGCCGTAGCTA AAAGTGTCTATAAGTTAGGCGAGTGAAAAAGAAATCGTAATCCCTCCATT ATATAGTCCCAGTTTTAGCTATTACTTAAGAGTATTACTATTAATAGTCT ATTATTAAATTAGCCTATTTCTATTAACCTTTGAAAATTAGAATTTATTA TTTACCAACTCAGCTGTTGCTTAATGGACGCACCATAGTGGGGGAAAATA CATCACGTTTCCATTCAAATAATAAAAAATCATGGCAAAAAGTCTCTTAT GCGTCACTTTCTTTTAATGCTTTAGAGCAAACCAAAAGATCCACGCTCAT CGAACTCACTCGTGCAGGCCGTGGAACAGTAGGTATCCTCAAGCTCACGG GATACAACAGGAGCACTGTCTACAATATATACACTAGGCTCAAAAATGAG GAAAGATCCCCACATAGTACCAAATCACTCCTAGGTTTCTGGCAGGCCTG AAGAGGATCGCTGATCCATCCTTAAATCAGACAACGCTGCCCAAGAGGTA AGGTATGGCTCGCAGCACCATCCAAAAGGCATAGGGGGAGCTTGGTTAGA CCTTCTACAAGTTGTTTGTGCGTAATTTGTTGACTGAGAGACAGAAGGAG GTGAGGTTGGGCCATTGCAAGACTCTTCTCTCTAGGCTTAAGACGTCCAA TGTAGGTCACAACATCATTTTCTCAGATGATAAAATATTCACTATTGAAC GCAAAAAGAACTCTCAATGTAATAGATGGCTCTCCACGTCCAAGTACAAT CACCCCTATGTTTACAAGTCTAAGAGTTCATTAGGACCAACTTTAACGAT TTCTGGCCCCACTAGACCTGGCCATCCAACTCTCCCGATTAGAATCTGTT TGATTGCTTCTTCTATGAAAAGTTGGAGAAGGAGGTCTGCTCAAAGCACC ACAACAGCTTGGACAGCCTGAAGGCAACAATGAAGAAGGAGTGGGCGAGG ATCTTGGCTGCAGATGTGGGGAATTCCTGCAAGAGCTTCAGGGCCAGGAT TGAGAGTGATTGCCGCTGAGGGCAGTCACATTGAATAAATGTCAAACAAA TAATCGTTGTTTTTATTGCTTACGMCTCTAACCAGTCTACAATTTTATCT CGGCAACCCTCGGTATATTAGTATTATTTTAGCAAACTTTGTCTATCCGA GTATATGTATGTATGAAAAACAGTAAACGGATACAAAGTATATTGCTTTT TATACCATATACATATTTTTGGTCTAAAAAATAACAATGTAGCCGTATTA ATGGAATATTGCAGGCGCATTCATGTAGCATCGAATATTCAGCACTGTTT ATGTTTGTTTTATTATTTTCTTATCCATATCATAATATATGCATTTTCAG AATGTCAAGAAATTGATGTCCTCTTTTTCAGACAACCATAAATGAAAATA AGTTTTCCATTGTGGTAAAATTTTATTTTCCAATATATCCACTATTAACT GTTATGCATTTTTTTAATGCTTTCTGGCAATTAAGTTATCCAAAGTTTCA TATTAAATTTGCAACCAGACAAATCTTCCATTTTGGACGAGAGTTTCTTC ATTGGTTGCCGCAGTAACTTATTGATCTTATCACTAAAAGATTCATAGAT TTTCTATCGGAGACAAGTCCGGACTATTGCTAGGCCATACATACTTTACC CAAAATGAGTCCAACTTAGCCTGAAGCCATGCTTGAACCACGTGAGAGCT ATGGGCAGGAAAGTCTTGCTGGAAAATGGCTCTCGACTATTTTGGTAAAA TTTTATGCATCAGAAACGATCCATTTCTCGGCCCTTTTGCATCGCAGTGG TAAAAAATTCTTGAGTATTGTCTCCACATAGGATGAAGACGTCACAGTTT GTCCTGGAGGTATAAAATGATATTCACTAAGAGCCCAGTAGCTCATAATA CTCCAGACGTGAATTTTCAAAGGAAACTTCACTTTCGGAGTCGGTACAGC ATCTTGAGAGACCAAACGCGAATAGTTTGACAATTGGAATGGTGAAATAG TTCGAAAGTTGACTTATCAGAGAATATAACTCTCCTCCAGTCATTTATTG ACGAATTTTTCTTCTCACAATTAAAATAAGTCGGTTTTTTTATTGGTTCT CCGTGAGTTTCGGCTGGRTTTGATATCTGTAGGGTAAGACCTTCAGCTAT TCCTTCATGTACTTGCAGACAGTCTCATGTGATACTGCATGACCTTTTGA CGCAATCTGGTTTCTAATTTCCTCAAGGATTGGCCTTTTTTATAAGACTT TTGGGGATGGTTATTTTTGCAATTCTTCAAAGTGTTTTCTTCCCTCCACG TCCTCCTTGTTCTCCATGCTTTCCCCGGAAAAGTGACAGTTACACCACAT TCAAATGGTTGGAATCGAAGCTCCAAGGTCTTGAGCGACCTCAATCTACC TTTTTCCGGCCTCAAGTTGGTGTATGGCCCTGCTTCGGGTGCTTAAGGAG TGCTCCTTCACCATCCTGTAACATCATATTTTTAATAGTCATGTGTAAAC TTTAATCTAAAAGAAATGCATAAAGGATTATTACAGTTGATACAGATTAC TGAGTCTCTAAGCCCACGTGCTTTTGTTTTAATTTTTTCCCTATTCATCT TTTTCTTCTTTTTAGAGAAACGGCAATTTCAAAAAGAGGACTTCAATTTC AAATAATTACCAAATTAAAAATGTATCTAAATGCAAACTATGCAGTAAGA ACTGTGAGTGTATAAAGTACATGTAGAAAAATTATTAATGACTCAAGTGG GAAAAATAAGGAAAACAAAATAACGTCGATAAACTTCCACATATCTTGAA ATTCATACTTTAGTCAACCAAATTTCGACTTATTTTTGCCCTAAGATAGA GATAGTGTGTTTTTGATTGGATTTACACCGAGAAACATGAAAATGACCTA TATAATATAAAGTTTCAACTTTTGTGGTATACAGAGTGCTTATTAAAACA TACTTTTACAATTTCTTCACAATTTTGTATTGTTTTTCGTCTTGAAATAT TTAAATAATCGAAAAAAGAATTAAATATATTGTTTATAGGTACATGCTGC TAGTTACTGAAAATATTTCAATTATATCTGTATCTTTTCTTAATCGAAAA AAATGCTTTGTACATAAGTACAAAAAAAATTACGAAAAATGGACCCTTTC CTTGACAACTAATACATACCTCATTTTTAATAACAATGATAAAAATCATA GTTTTTCGTAAAGTAAAGATATACAACTTCATAATAAAAAAAACAGTACC TTAAAAAAATTAATACTTTTGAAGCTGCTGTGTTTTTTTCACCAGCCACT TCTGGTTAGTTCACTACTACATGAACTACTACACTGTAGTAGTTCATCAA TTTTTTTGTTTCTGTTGAATTACCTTTAAAATGATTTATTTTCTTTAAAA ATCTTTAAGAACGATTTACATATGTTTGACTCGTTTTTTTTATTTTTATA AATCGTCGGTAACCGAAATGGAGGATAATCAGGATGACAGTTTGGTCTCC CATCTACAAAATTGTATATCACAGAATGCTTTTGAGGCAAACTATTGAGA TGTATTCTGCTATGCATGGATCCACTTTTACATCTGCTTTAGATATCTTC TAAGGAATGCAAAAAATTTATTCATTCTAATTTTATCCTTGCTGTTGGAA TACTTAATTTATTATAAAACATATTTGGAATAATATATTTTCAGTATGTA ATTTTTTTTATATAAAGCAATATTTGAATTTTTTTTTTTTTTTTTGGGAT GTTCAACATTAAAAAAACACGAATTTCTTAACAGATGTCGTTTTCCTTAT GGTGGTGTCGAAACTTGTGAATAGAGATGCGGGKATTCATTGTATGATGG TATACAAGTTTTCATGGTATATATTTTTAATATACTATTTTAAACAATAC CAAGTCCATCACCTTGAAAATATTTAATGACGACATCAGTATAAAAATAT TTTGAGAATGGGATATCTTCTGACTTATGATAAAGTTCTTAAAAAACGTC TCAATTCAATTTTGGGTTATACCTTGTATCCTAATCGCCTTTATTTTTAT ATTTTTTCATGATAGTCCTCGTAAATAATAGCTTATTTTTTTAATGATCG AAATATCAGGTCACAAGGGTCTAAAAATGTTTCTCTTAGTCAATAAATAT CATTGGCTATCTTTGAAATATATTTTGAGAAAAATATTTACAGGTAGCTC GCTGCTCCTAAAGTTTTCTAATTTTACACTTTTTTTATTGAAAAAAATGT GTTATTCTTTTGTACACATTACAGCTTTTTGTACAGAAGCACAAATTTAA ATAAACAAAATTACTAAAAACAATATTTTATAAACTTTTGTCAGAATTCC TTATCTACATTTACAAAAGAAAGATAACTGTAGTTACATGAATTGTAGCT TTCTACCCATCTGTCTGTTCTTTAGTGTATCACAGCCAAACAATTTAACT GATACATAACAAAATTTGCAGGCAGGCACATTGTTTACTTAGGATAAACA AAAAGTGCAAATTTGGATGACCTTTATTTATGGAAAAATACCTATATAAC TAAATTTTATATAGCATAATTAAAATTTAGACAGAAAACGTTTCCTAGAA TCAGATTACAAACGTCAATGATCTTCAACTACTTGGAGGAATAATTGCAG CTCTGATTCATAAACCACTATATTCTTTCATTAGACCCACTCTACGCTCC AATATATTATTAACAACTTTGAGTTGTTCAAAAGTATCTTGAGCCTATTT ATAGTCATTTTTGCCACTCCATATTGTTGGATCGGGCAAAAAAAAAATGT CTCAAACATTTTAACCTCAAGAGAAAATATTGATGGCAAATAGGATTGAA AAACTCAGCCAATTATAAGTTCTATAATGTGGTGTCTATAGGGGATGTGC AGGGTCTTTTTTCCAATTTTTCTACAGGAATAGAGGCTCCTGCGTTCCTA CATTTATTTCAATTTGATTTATCGTAGCACATGATTTTAATAAAATCACC TATTCCCCAGTCTTAAATGGTTTCGTATTCAAAATAAGCTTGAGTCTCAC ATATACCGGATGAAAGCTTTGCAACATTAAGTAATTTAGAAATTATTTTC TGTGAAACTGAAATGTGCAGTCGATCAACCTTCTTTTTCTCTATATGACT AGGAATCATTTTATTCTCGCATTGAATTACAAGACCAACGTTACTTTTGA AATTTGTCTTTATTTAAATAGCTTTTACTTGTCGAAACTATGTTCGTTTT CGGTCAATTATGTGTCTATGATGAGAAAATTGATCTATGTTATGTACGAA GTATATAAAGTAACCAGAACTTTATTCTTGAACTTGTAAAAAAAGATCAC ATTTTTTAATTTAATTTTTGTATTGGTAAATGTATGCTTGAAATTCACTT TTAAGCTATGATTTCATTAAAAGTTTAAAGTCAGTTATAGAAAATTTATT AAATATGTATAGCTAGTGTGTAATATTTTTTTATATACTATTTTTTCAGC ATCGGAATGCAAGTTGAAGCAGAACACGTTCTAAGTCGCCTCTGGATACG TGAAGCAAGTCTTTCAGATTCTGGAAATTATTCCTGTATTATACAACGAA AAGAAAATATACAATTCCCTAGAGCAAAGGTTAATGTACATGTTGTTGAA GGTAAATTTATATTATTATTATTCATTTTAAGTGTGCGAAAGCTGAGGGT AGACATAGACAAAAATTTACCCTGAAAACGAACGTAACCCTATAAATAAT AGCCAAAATTTATGTAAATTCGTCTGTTTTTTTCTGACTTTTCACCCACT TGTGCAAATTTGGTTATTTTTTTCTTCTTGGGTCCTTATTTTCTCTTATT TACGCATTGATAAACAAAACAAAAAATAAAGGAACTATTATAAAAATAAA CAGGACTAAAAGTTATAATATTCTAGTCTATATAGTATATATCCTTGCAT TGTAGAGGGGATATTTCTCATTTTTTGTAAATTCGTAAAAAAAGTAAAAA AAGATATAGACTTTATCTGAGAAACTCCTAACAACCTTAAAATTAAGCAA TTCATAATTTGTATCATGACATGTATTCGTTTTTTTCTTTCTATGTAATA CTTATGATAAATTTTGAATAATAAATTTATCCCATGTCCCGTTGCAGATC CCATAGGAAAATTTCTCTCACACATCCTTTACATCCTCCTAAATTTTTGC TTTAAAAAATCTATTAACAAAACCAAATTTTTAATATTTATATAAAGGAG TATATCGTGAACCTGGAGCAAAAGTGTTACAAGTGACATTTTGTCATTTT ATTGTTTTGATATATATGAAAGAGTGTTTTTATTATCATATTTTAGATAT ATTCTAAAATATATTGGTTTTGAAAATTGAACTGTTGGAAAGATGATAGT TGTTAAATGTTAGAAGTATGTCAAATATGATAAATAAAAATATTTTTTCA TATATTAAAAAAAAAGAATTATAAAATGTCACATGTAAGACTTTTGGTTT AGGCCCACGATATTTAGTGTACATATTGTAATTCCGTACAATTTGTAACT TGCACAAAAAAGTTATACAAGTTGCAATTTATCTGTACTATAGTAGGTAA AGTCATATCTAATTATAGCTTAATCAATTTTAATTAMCAGCCATACATTT ATGCCATCATTTTATTTCATTGATTAAAATTACTTATTTTTTATGTTTTT ACGGGTAATATATAATTGTGCTTTTGAAAATTTATAACAAGCCATGAAAT AGAACACTAATCAATTATTAATATTCCTCATCATTATTTATTATGAATAA GTTATAAGGGTCTAAAGAAGAGTATCGTTTTTTATACAGAATCAATAAAA AACACTTTTTTATCATTAGAAACACTTTTACATAAGTTTTATTTATCCTA CTTTTAATTTTGGATATTTTTTTAGGGTAAAAAGTGACTCTGAACGATAA TAGTCCCGAATTAATATAATCTCAGTTATTTATGAAATTCAAATGACTAA GAGAAAAACTGAGATCAGTTTGATTATTTTCTTCGATACATTTGTACAAA ATTTCCCATAACCAATTATTCCCTTGTGTGATTCAAAAAACAATAAATAT TATAACTTTACAAACCTATTCAATTGGAGAATAATAATCATCTTAGATTA TGTGTATTGCTGAATACTAGCACATTTAAAAACATACTTAGTATTATTAT TTATTTATTTTACTAGATTATTTTAGATTAGATATATTTATTCAATATGG AACTATAGGAAACTAAATAAATATTCACTTTTAATTTTATTGAAGTTTTT TAATTTTATGGGATAAATCTTTTTTTAAAGCTCTTTTGTTTTCTTTGACA ACTGTACTTACTGTTAATTTACGACGTATAATTTTAGGCGAACAAATTAA ACATTTTTTACTATATTTTATCCGAGAAGTTGCTGAAATAGTGACTGTTT TCACATTTAGATTTCATTCTCCTTGTTTTTTGATAGTTTTATCCATTGTA GTAGAAAACACTAGTCTCGTGGGCAATGTAACCAAATACTTTTTCCATGA TTACTCTTGAATGGAAATATTACACAATATTTTATAATTATGCATTTTAA ACATATATAAAATTTTGGATGGTTTATAAAAAGTGCCTACAACTTAGAAA ATAACTTCATTTCGTATCTGAATGAATGATTTTGATAATAATTTGAAATT TTGAATAACAAGAACCCTTAGGGCAATGATTTCGAAAAGATTCTGGCATA GATATCTTGTGCTGACAGAACGTTTTCTTCCATAAAAATTGAATACTCCA GAGTTTCTTGTCTTTGATACTTAAACTGCAATCTTTTGTGCCAATTGATG CCTGTGTTGATCTTGGAGGTGGTGATGAGAGGTAGCTCGTCAGATTCGGG TATTTTATGGGATGACATCATCTTTCAAACGCATGTGGATTTATATAATT TATAAGTAACATTGATTACTAAAATTAAAATGGAAGTAATTGCAATACTA AAGTGAATAATTTTGAAGGGGATGCATCTGAATTATGCTATAATTTCGTT ATCTAGGCAATGGTTCCGAAAGTATATTAAAAAAAATGAAAAAAAGAGCT GTCTAAGAGATTTACAAACAATATTTATAGTATTGGGGAGCATTTTAGCA TTCCTTGACTATACCTATGCTCTGTTTCCAAAAGGACAGGAATATAACTA GAAATGCAAAATATTAAAACTTTTTGCTGTTTTTACCTGAATCAAAGAGA ATGCTCCCTTCCTGAATATATGTTTTTATTTACCAAATCTGTCATCCGTA TTCTTATAATCTTTTTTATTCTCACTACATAATCACAAAGCCAATGGAGC CCCAAAGTAAAGTAATGTCTTCAAAGGTTAGGGAAGAACTTGAGGACGAG ACTACAAGTAGATATAGAGATTATTTATTTTCTTAAGTACCCGGAGCCTA TAAACTTGTACTCGGAACCACAAAAACCTGGTGAATGAGGACTCGGACTT GACCTGAAAATTGAGAAAGGGGACTCAAATACAGCTCTGAATATTAGTTC TAATGGATATTTACTCTTTTCTTTTATTATATTTAGTATTTACTATTTAC AATGAGTAATTATTTATGGATAAAAAAGAAAGTTAAGCAATATTGGAATT GTAGGTACAATTAGTCTTAGAACAAATACACTTAAAAAAATTAAACAAGC ATTATATTTTATACAAAAGGAAATAAATTTTTGTTTCATTTTACGGTAAT AGATTACAAACATAGAATTAATTAAGTTTTTATTTTTAAATTAGACATCA TTCTTATTTAATTTTTAATAAAACTTCGGTAATATCTATCACAATTATAC GTTTAAACAATTTGAATTGTCTTTTTGTTTGAGTTTTGATAATGATGATG GAATTGTTCTTTGACGTCCTGCATAATATTGAATTCGATTCTTGGCAGCA AAAATATTATAATAAGAATTCGATTATAAAAATAGATTCGCTACAAATAA AAAGTATCTAGGCTTGTTGTTCATGAAAATGTTTMCCATCCATAAGAAAT AATAAGAAAGGAAGTTGTGGATCAATACAATCAATTGGAATCTAACCAAA GGCTCAAGAGGTTTGTCCAGTAATATGGTAAAAAAAATTACTATCTGAGG GATGTAAAAATGAAATTAATAGATTGTTTTAAGGCATCTCTCGTTCATTT TAAACATTATTACACATTTTTTCCATCTCTGAATATAACTTGATACTTGA TCAAAAAGAACAAATTATGAAATAGCCATGATTTATCAAATGAGACGAGG GAATTGACAGCGAACTACATAATACGTAGTGTATTTTTGTGTTAGCGAGA TAACACTATGTACTTCAACTCTTTTTTATTCTATTAGTTACTCCTTCGTC ACAGAAAAGAGGGTGAGTGACATCATGAAGGAAAGGTTTTTTATAAAAAT AAGGGAGCTGAGGTCAAAATATGTCTTTGAGAAGTTCGCACAGAGTAGAG CAAAAAGGAAGAGGAACTGAAGCCCCGAGGTGGGTTTATGTCTACATATT GTGTTGAATGATCCCTCCTTTATTATCTTGTTTGATAAAACTAATTAATT TATTCACAGGTAAAAAATATAATAGTAAAATATATTCAATCTGTTCACGT AAGATTATAATATCATATGTAACATCTATTAAGGCTAAAGTAACAGAGGA TTAATTATGGTTAAGTTGCTCTGCCTAAGGAATAATTTAAAATGTATAAT ATATATACTTGAATTTATCGTTTATAATTTTGCTTTGATCAATTTGCTGT ACAAATCTAGAGACATCTACCCCCGGTCAATATAATTTTCTGCTAGCTTG GGAAAAGTTTGGACTTGTTATTTGGTCTGAATTAATTAAAAGATTGGCTT AGTTATGTCTAAAAGATTGGCTTGGAAATGTCTAAAAGATCTCTTGGATT TATTTTTTTAAGATCAAGATAGATCCTTCCCTTTTAAGTCTAAGCAAAAC GTTCAAACAATTATCTTCTAAATATCGGTATCGAATTGTTCGTGGGTAAC ATATGAATTGACAATTGTCCTCTCTGATTCCATATCTACAGTTGAAATTA GGACTAAAATTAAATTTAGTATTAATTCTTTCCTAGTATAATGCATAGGG ATATAATATTGTGCGTGTATGTGTGTAAAAAACAAGCATGAGATAATGCC ATAAAAATATGATAACTTTAAGAAACGACATATCTGCCGACAGAAAGTGA TTACAATTACTATTAACCAAAATTAATTTAAATTGTCCAAAGTTAAACTT TTACAAAATGAGGCAGTAGCAATATGGAGGACAAAAATTATGATACGATA AAAAAATCTTATAAAATTATTGCGTTAATTTTAAGATATGTTTTCATTAG ATTGAAGTTCAAAATGTTGCACAAAAATATTGCTACCAGTCTTTTACTTA ACTTTTCTTCATATCAAATGAGTATTAATCATTGTGAATGAATTTGAGAT AATCAGATTATAAATTCAAATATACGATGCCTTTTTGAGCAAAAAAAAAT TAATCGATTTACGGATCTTTTTCCATATATATAAATAAAAATCGTGTTGG TTGGTTAAAGCTACTATAAATTTTTTGTAATATATCTGAGGAAATAATGA AACAATAAATATATTTCGCCCAAAAATGTATGTTATCAGGCAATATAAAT TATATTTAGAGGATCTTTTACTTTTAAATTTATAGCAATAGTTCTATTTT TTTAGATAAAAAAATAAAAATCATCGTAAGTGGACTTATAACCGATTTTT TTTGCCGTATGGACATTTCACCATCGGACAATTTGTGAATACAAATTTGT CGAACGGATGTTTCGTCGAAAAACCATTTGGCCAAAAAATTATATCAAAG TAAGCAATATAATTGTGAGTAATTTCGTTGCAATTTATATTATATTCGGA TAATAAAATTATTGAATAATGAAGAAACTTGCCATGAAATATTCCTTTTA ATATCCCCCAGCCCATAGGTTGTACAGGTGAAGCGCTGGGCCCAAAGCAG TTTAAMCTCCNCCACCGCCGTGTTCATAAGCATTTGTGACCCTATTATAA TATGCTATAACACCCCCAGAACTAGAGGTTGTGCAGGTGAACAGATGGCT CCCAAGGTAGGTCAAATTCCATCGTCACGGAAACTCGCAGTTAAATTTGG CAGTATCTGGTCGATTTTTTTCACTTAGTGGCTAAATTTGTTAAGAATAC CATGTGAATGGTGATCAATGCTGCTAAAATGTTTGAAAAGAGTGCATTCT TGACACAAGAACATCAACTATTCCATATGGAGCGTTTGTAGGAGTCTTCC TTATGATCTCTAACATAATGATAACCTGGTGATTTTCTTCCCGATGAAGA ATTGACTAAATGTATAGTTACTTAACGCATTAATATTCTATATGGCAATT TGTTGCACAAAAAATTAATATATATTGGTCGTTTTTGATTGCTTACTCTA AAATGGTCCCAATATTGGGAACCACTGGTCCACACTATGGAAATAAGATT GTATTTTAGATACAATGTAATGTAATTATATATTTTTAATACATAGTAGG GTCTAATATTTAATAGAACTAGTTATTAAATGAATAGATTAGTAGGATAG ACAGCAAAGTTTAAGTCATTTTATTCGTTGATCCCATTTTGATATATAAA TACACAGCAATGGTTCATTATTTTTCTTAATATTAATAAAAATATTATTT TAATTCTTGTAAAACTTGACTGTATTGGCTTCCAAAATGGGCGKCATCAA CAAAACTGACGTCACATAAAAATACACTGTTGTAAAATAAAACATCTATT GAATTTTTTATTTTATTTAACCAATTTCAGTCCATGTTTTATATAATGAA CTACTGCAGAATTTATATATACTGTTATATATAACTATTTATTGAGCATC CTCTTGTTATTGAAGAATATCAAAAGTCATTATAGTTTAAAGTTTTTCTC CGCAAATACTTTTTATATGGTGTAGTTGTTTGTGATTTGTAATACTTTTT CCTTCAAAGAAACCTTAAAATTCAGTTTTTACTGCACAATTTTTTTATTC AAAGTTTTACTTATATATAGAGTTAAGCAAAAAGACGGGGAAAAATATTA CATCTTCAATAATAATAATATGAAAGCAAATATATATATAAAAACGGTTT TTTTGAATGAAAAGTTTGATTTTGCATTTTTTTATTTAATTAGAAAAACC ATTTCAGAATGGTTTTATTAGAAATATTGTATATAAAAAATTATTTTAAG GATAAGTCTTTATGAATATTTAATAAAATTAGCTCTGATTAATTTTTTTA AAGAAAATACACAAAAGTGGCTGSATTACTTGTTTTTTAAAAGAAAATAA TTAATTAAAACAATAATTAATTCTTGATGCAAAAATAAGAAAGAAACAAA ATGTTGATGATTAATTGTTGCGTTTTGCAAATGAAAATAATATTTTTTTT AATTACTAATATATTTTTTTAAAGAAAAAACAGGAGATAATCAATAATAT GCCTTTATGGAAGAAATAAAAATAATACTTTTGTTACTTAATTATAAATT CAGTTTTATAAATCGCTAGATCAATCAATGTCTCCTTTTTTCAACGTCAA TTTAGAACATTAAAGACTGACTAAGAGGTAGTATACATTGTAAATTCAAA TAAAATTATTTTTCTCTTAAAATATCTCATTTCTAAGTATGTCAGATATC AATCACATCTTAAGATGAGTTACCACATGTAATGTAAATTGTTAGGTGGC CTGTTTTTTTAAATTGGTAATCTGAAGAATTAGATACATAAATTCTATAA AAAGACCCAAAAGTGGCCTTGTTGTACTTTTTTATAATCTTGGTGATCTA TGGGACCACATTTTCCTACAACACCATCAAGTAGTCGGCKGCAGGTAGGT AACTGGTATCCAACAGAAAACCAAATTGGAGGCATTTTTTCTCCTGTTGA TGCCACAACTCCCAATATCATCACAGAGGCTGGATGTTTGGKCTTGGTGA CTGTCTTTATGTCAGCCTTACCAAAGCATACCACCCGATCATTTTGGTTG TTGTAGAAAGGGTCAACAGTAAATATATTTTCATCAGGGGAGAAAATTAC CCGGTTGCTGTTTTGTTTCTGATAATTCAAGAGTTGTTGATATCGCTGAA GACAGAGTTTTTTTGACGTTGCGACAGGAATGGCCTCTCAATTCTTCTAA GCGATCTTTCCCATGCCTTTCGAATGGCCTTATCCATAGTAGACCGATCC ACCTTCATCTTCTTTGTGTACTCTGACATCTTCATCGTTGGGTTGGCCTT AAATGCCTCCATGATGTCTTCAGGCTTGGGGCTTCTACTCATGGTGTTGT CCTTAAGGTTGTACCCATCAGCCAATCGATTTATGACCTGACAAGCTGTC GCCTTGATGACATTCAAGGCCTTCATGATGTCCAAAGTGGTCCTCCCGGC GTGGATTAAATTGCCTATGATACCCTTTTTGCCTCCATCGCAACATATAC ATAATTTTTGATTACAACATGTACATCAATCAAAGGCTTAGAATCTAAGA TATTCAAAATAAACGGGCTTTAAGATTTAATCAACACCACCTATTCAAAA CTGTATTTTTGGAAGGTGTCATTACTTTTTTTACACCTGGTACAAAAATA AAAGCTATGGAGTTTGCCTTATTAAGCTGTAAAGGTATGATTTCAGAGAA GTTGACGGCAGTGGTACATATCAGTAGGTATGTTACAAGATACCGATTTA CGGTGCGAAAATAATTAGCAGGAGGAGTCTGTAGAAGTCTATAAACGCTT TTGGAATCCATATAGAAATGTTTGATTGTCATTACTTAAATGGGGAAAAT CAGTTTGACGTCATTTATATTTAATGTAGATAAATTCTTAATCTTTCACT AGTTTAAATTTTTTTCTATACGTTGCTTCGTTTAATTGTACCATTGGCTG TAAAAAAAGGTCACTTCAAGATAGCCTTCAAATCACGGATGGAAAAGAAT GGATTATAAAAAGGTATAATGGACATTAAAATATTTTTTTATCTAGTATG TTCTAAATTATCCAAAAATCTTTCGATGCGAAGCAAATAAATTTACCTCC AACATTAGTACCTTCAATATTTATTACTCTAGAATATGAAAGTATTTTTG TTTATAATTATAGGTGTTTAAAAGTAACAACTTTTGCATAATTCTGTACT TTGTAATTGCTGAAAATTTTATTCAATTATCTTGATATATAAAAAGGTTG TGTTATTTAATTGAAAGATCATATTTGATCACAAATTTTGGTGTAAATAA TATCATTAACAGTAGGAAAAAAAGGGAAAAAGGGTCATAACTTCCTTAAT ATTAAAGTTAAAGACATGATTTTGTTATTAAAATTTTTGTCTTATTATTA TCTATTAGACAAACTAGGTTTAAAAGAAAAAAACTTATTTTTTTGAAACA TACTTACTGTCAGAGTTGAAGAAATCAGAGCTATTTTCACCGTAGTGGCA GCCCGATATTCTGATTTCTCCTTTAAGATCCAAAGGGGATATCAGTCTTT TTGAAACAATCATACAATACTCATTGTCAGATAAAAACATAAAATTCTTG CACTTTTTAATACACAATTATAAGAATTTTAAAAGCTATTCCGGATCTAC AGAATTAACTCAGTATAAAATCATTGAGCTTCTTACGTTATTTTAGTAGG ATCCTCTGTTTTCTAAATATATATATTCTCCTTGCACCTTGGTAAGACTT CTTGAGATATTTAAAGTTTGATTTTTTTTAATATTTGCATTGACAATATT GGTTTTTATATTAATTAAAGCTTCTCTGTACTAATTTTCGACGAGGAAAT TAATCTCGTCCTGGACATTGACATCGCTATCATTGAGATCATTCAGGACC TCTAGTCTATCCTGGGCTTTATTTCTCTCAGCTACCGCCTCGCAACCTCT CTTAATCAATAGTGAGCGGCATCTGGCCTCTATTTCTTCAAGAACATTAA AAGCTGAATAACATGTCTCCTCCTTATGGCTAACACATTCTATAATGATT CTTGCTAATTCTGTGTATGACTTGTTGTCCTTCAAAAGGGAGATATTCTC TTTAAAACGGCTTTCGGACTCTAGTAGGGGTACAGAGCGTTGCCGTTAAG GGGGGGGGGGTATCTGAATGGTATGAAAGATATACTATTAGTTTTTTAAG GACTGCTGCTATCCTGGGAGAGGCGAGTATGTAATCCAGGCGGCGACTCA CTCTTGTTACTTAGTAGCTTCTTTTTTATTCCAGAAAAAGTCAATCTTGG TGGGAGTGATATCCTACCTAGCCCAGGTCTACGTAGTTGTACTCCTGAAT AATCCTTTCAAAGTTTCAAGTATCTTTCTTATTTCTTGATCCCTCGAAGC CTTTAGCATCTTTCTTTACAGATCTCGTAACGTTGATGTCGTGCCAAAAA GAATGATATATCTCTCCTTTTTGCGTGTTGTTGTTGTTTTTTTCAACAGC AAGGTCTTTATTGATAATTATTAGAAGTACAATAATAAATATAAACACAT AAAAGGAAATTTGTGTCTGCATAAAACATCATTTAACATTATGGTTAAAA AATAAATTTCCTTTTAAAGACCTAAAAAACAATCGAACTAATAAATACAA AGCTTCACATATTCACACATMCCWTTTCTCAATCATMCCACAGTCTCTTT YCCCGCCAGCCGAACCTACGCCACTTTTAATATAAGTACATTCAATCTTT TCATCTGAAGTAAAAATTTGAACTTTATTATTTTCGTCTACTTTCAGACA CAGGGTCTGAAAGTCAAATTCTCCAAAAAATTTATTTACTCTCCCTCCAT TTCGTCATTACTTTCATTCACAGCATGCACCGTACCCTCAGAGATATTTC CATACTGTTTCTCACCCTCAGGAGGAGATCCACGACCCGAACGGCACGTT AAAGAATCATTACCATTCTTTAACGTCTTATTTCACCTCCATTTGTCTGC AATGACCATACATCTATCACTTTTGTTCCTTTCCTGGAGAAGAGCTTTCT CATTTACCTCATCCTTTTCCTCCTCCAAAAAGTTTGACGAGAATAAGCGM CCACTACTGTACAAAACTAGCCACCTCTCTTTGCTAATCTTGCCTAAGAC TTAAATTTTTCATGATATTCTTGAAAATAAATTCTCGGAGACACTTTCTT TCTTTTCATAGAGTCACTTAATTTTTGTACAACTTCTGTACAGTAATATA GGAAATAATAGGAAAAACTGCGGTATAACCATAGTTTTTTTTACTTTTAC CACCATATTCATAGACCTGATAGGATTCGTAAATATTTTTTGGTGAATAC CCCATCATATTCTTCTGGCTTCGGAGCTTGATAAAAAGTTTCAGCATCCC TGCGTAGAAAACCAATCACCGATTTTACTTCGTCAGGGTTTGCTATTTTT GCAACATTAAGAATGACAAAGGTCTTCTTTTTTAGACCTATTGCTACTTT AATTAGCTTGTAAGTTTTAATTTTGACTTTGGATTGTTATTTTTATCCAG TGCATTTTTTTTATCGTTAAGATATATTATATCACAAAATTATTCAAACA AGGTTTCATAGGTAAAAATTAATTTTGAGATGTTCTACTTTTCTAAAAAT CAAATTTTTTGCTTAATATATATTGTACAATGTATTTAAAAAATGTAATT TCATATAATATAAAGCAACAAAGCCAAAAGATCTATATTTAATATGAGTT TTATGATAAATCGATGGTAATATTTTAATTGTTATGCTTCAAAATCATAT TATTAAGGATAATTTCTATATTAAAGCTGATTATTTCAATTGCTTATGAA ACTATGCTAATATTACTATAGGATTGAAACTTTGCACAGCATGTTTTAAT ACCTAGAAACAAACATACGAGAAGTATTATCCGTACACAAATTTAAAATA AAATATATTTTATAACCACTCTACTGTATAACAATTATTAATTAATTAGT CTTTATTCAATCTTAACGAATATATTCCATATGTATTTCAACATATTATG GATCAAACTAGAATTGTACTGATGCATCATAATCTGCAAGTCTGCATAAT CTTTATCAATTTATTTTTTCCATATAAAATAAAAATCGTTAAATAGATAA AATATAGGAAAATTATGTTTAAAAAAAACATAAATAAACATTTGAGTTAT AAATAAGTTTTCCTTTTTATGATCTCTTTATCCAAGTATAAAATATAAAC TAATAAAATAATAAATTTGTGTACTTACAACTATAATATTTTTGAAACCT ATTGTATTTAAAATAAACAGGAAAAAACACACACACAAAAACAAACAAAA AAAGACAACTCAGTCCGTAGTTTCTTTCTTGTACTTCTTATATCGATGAA TAATTAGCCTAAGAGTCCTTTCATACTGGAGTAAGATCAATGTAAAATAT TTAATTAATTCGATGGTGTAATTTGAAGAKGAKTTTTGTAWTKGCTGRWY CCGCCGGKTWAAATTGGTGTGTCCGATGGCAGCCAACATCAAGATAATCC TCATATTTCTTCTGTCAATCCCTTTTAGTTCTGTGNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAGCAATTAAC CCTTTACAAGTTGCTGATAGCTTCATAATTTGTTTTTCCATCGTCTGAAC TATGATTCCTATTACTCCGAATATCGAATAGCACAAACGCTACCAAATAT CTTGGCTAACAATTTACAATATGCCTGGAATTATTTAATGTAAAAGAATG TATAATTTTCAGAAATGGACAGTGTACAAAAGCGTGTTTTTTAACGTTGT ATATTCGTCAACTGTGTTTGCAATATAGCGAAAAGCAAATCAAAGTTGTC TATATTTGAAACTGGTGGTTGAACTTTTGACCATCACTGATGCCATTCAA AGAACGCATAATCCTCGTATCCTATGTTGAAAGTAGATTTAAGTTCCTTA TACATTCTATAGGGATAATATATGGTTCAGTAAATATCAAATCATCATAG TTAAATTTTAGATACCTAATTGTAAGAGGAAGATTTCGTCCATCTAATAC TTTCCCACTTTTGTGAACAAAGCTCAAAATTAAAACATTTTTGTTATTTT TCCTTATTAAGACCTAAGACTCCGATTTTGATGTGTCGAAATTGAGAATA GACCAAAACCATAAACAAACAGTCTCAACACAAAGACCGGGCTCGAAAAC CACTGCACTATTACATCATATGTAATTTTGTACAAATTTATCAGATCGCA ATTTTTTTCTGTTGCAATATAGCGATATCAAGATGAGGACCGATTGCGAT ACTTCGATCAGCGATATAATATTGCCATATTGCAATTGATCGCCGATCAG AAAAAAACTCTGATCAACTAACCTAAAATTTATTCATAGAAATAATAAAA TGGCTAATATATATATTATATAAACGACGAGGGATCAACAAGAGATTGAT TGTATTACTGTCCTTTTGGAAACGATGCATAAGTATAGAAAAACTTCATA CTTTGATTATTTATCAAAAAGAATAAATTATGAAATAGGCATCATGTATC AAGCAAGAGGAGGGAATCGACAGCTGAAATCAAAACACATAGGGTATTTT TGGGTTAGCGAGGTAATGCCGTGTTAAATGTTTTTTGTTGCACATATGCA ACCACATCCAGGAATCACCCAAGGAATCCAGGAATCACCCAAGGAATCCA GGATGACCGAGAGAAATGAGGAGAGGAAAGACGTACAGGAATAAAACTAA GGTTGTCTAATAGGAACAATTATATTCTTATTAACACAAAAACCTACTCT GATACATCCATAAAATACACGACTATTTATACTTAAAACGAGGTAAAAGA CTGTGCTTTACACATATATATACATATAAGAAAATAAAAGAAGTAAGAGA ACAAGGAGGAAGGAAACATGAATACAGAGTTTACTACTTCAGAAATCATT GATAAAATCCATGATATGGTGATGAATGACAGAAGAGTGAAGGTGCAGGA GATAGCTAGTGCTGCAGGCATCTCGAGTTGAAACCCTCTTTCCATTAATT TTGTGACCACATCTTCTAAGGTGTGAGCTGGTGCATTGTCGTGATGAAAA TCWCTTTTTTTGGGCCAATCGAGGGCGTTTTTCTTGTAGCTCGTTTTTCA AACGATCCAATAAAGATGAATAATATCTATCTGCAATACTGAAAAAAATT CCAATATAAAATTTTTTGGAAAAAATAATTGTAATATTAAATTTTTTAAA GAAAAATTGCAGAAATCTACAGCCATCCACAGAAATAAATAAAAAATCCA CAAAATTGGGAAACTTATAATTTTTAGAAAAAAAATTCCAAAAAGAAATT TTCGGAAATTTTTTCAAATATTAAGTATTTTGGTCTGTTGCATAATTTGC ACGTATGACCTTTTTTTAAGAAAATAAATCTTTCAAAAAAACAATTTTAC CCCTATTTTTGCGTAATTTTTTTCTAAATTGGGGGTGGGGCTACAGCCCC TCCAGACCACCCCTTCAGATGTCTCTGCAGTCTAAGCTCACTTAAATGAT CCATTTTTATTTAGCTAATTTGTTCTTTTAAGAAGAGATATCGCGTCTGC TGCAAAGAATTAAAAAAATCGAAATATCTCTTGAAAAATGCGTCAAGTGG TTAATATATTTATTAATAGATGAAATATACCATCTATTTAAATATCTCAA GAATAATAATCTGACTACTGTAATAAAATTAGATACTCAATTATTTTAAA TGCATTTTTATTGTCATTGGTTATTTAAATTTTTTAACACACATTACAAG TTTTGTTGCAAAGTCTTCTTATGGCTGAGGATCGACTGCACCACGTTCTA TAGAATCGACAAAATCTAGATTGATCCCTGCAACTCGTTCCTAGAGAATA GTGATAATGATTATATGACATCTTGGATATGAAGATGATTTAAATACCTC CAATGCATTGATATGCCTTATTCAGTTTTTGAATATCCAATGCTGTCATT CCAACTCTATTTCCTAAAATACTTCCTCCAGCACGGGTGGCCGTCATTGT GGGTCTACCGTTTCTTGAGAAACTATAGTTTGGAGAGTAAATAAAGGAAT TAATGTCATTATTTAATCTAATTAGAAATGCCCAGGGGTGTCTGCAATAT TATATTTGAGGGGAGGGGGGATTGGCTTTTATAATCTTTTTGAAAATATA AATCAAAAATTAATATTTTTTGGAAAAAAAAATTTAAATAAAATTTTTCT AAAAAAATTGAAAAAGCTAATTGTTAGGAGAAATTTTATATATATTAATA GAAAAGTAAATTTTTTGAAAAAAAATTCAAAGTTGTTCACAGAAATCAAA CTTTTGGAAAAAAAAATTCAAAAATTAATTTTTTAATTTTTCAGAAAAAA ATTTCAAATGTCCACAGATATTCACAGAAAATTAAATTTTTGAAAAAATT ATCAAAAATTAATTTTCAAATATTAGATTTTCTAGTAAAAAGAAAAAAAA TCTTAATTTTTTTTTTTGGGGGGGGGGGGTTWTCCCCTTCAGCCACTCAC TGCGGACGCTCCTGATACCTTACCTTGTCCTTGAATATTGCATTATGGAT CGGTAATCATAAGGAAGTCCTAAGGTTGTGGCTGKTATTCCATTATAGCA AWTACTATAGGGCGTAAGAMTTCTAAAGTTACAAAGTGCTATATTTTCTC CAGATGCTCGAGCTCGAGCAAATTGATAATATCGATTAATTGTTGGAATG ATATTATTCCAGCTCACTAAAATAAATTGATCCCTATCTGGGCGATTTTG TTCATGGAGAAAACCAAGTGCATGAAGTAACTCATGAATAATTGTGGCTT KACTCTGAAATACAAAAAWAATTAATTAAMCTAAGCAGTGTTAATTTCGT CAGCTACATATATCTAGAGCAAAGACGGGCAACTCACGGCCGGGGGGCGC AGTGAGGACCTCACCCTCACTCAGTATGGCCTGGAAATCGATCAAGAATA ATTAAAAAAATAAAGCAAAAAAAACTTGAAATTATACGGTTAACCGATAG AGGGCGCCATACACAAACAATAGCTGGGCCCAGTCTACATTTTTGCATTT GAAAAGAAAAAAGTCAAGAGCCATACCCACTAGCAGCGACAAAAAGAGAA AACTTGAGCTAGAAAATTGCACTTTTCTGGTCAACCCTCTGGTACATTAG GTTCAATTAATGTAAAAATAATTCATATATAAAATTTTTTGAGAAAATTA CAAATATTAAATTTTTGGGGGAAAAATTTCAAAAATCTATAGTTATTCAC AGAAAATTAAATTTTGAAAAAAAAAATCTATTAAAAAGAAAAAATTCCTT TATTTGGGTGGGGCTMCAGCCCCTCCAMCTCCTCAMCCCCCTGCGGGTAC CCATATTTTTTTCTCCGCGAAATATTAGACTATACTAAACGGGACAAAAT GTAATAAAGAAATGAGACGAAACAAAACAAAATGCACACTATTTGTACAC ATTAACAAATGTTGAACTTMCCATGCAGCCATTTCTATCTAAATTCACTA CAAGTGTCGCTCTATTTAAATTAAATCCTAATGCAGACGCAAAACACCCT TCCTTATCATTTCTAAATTGAACAAAGTTTCTTTGACTGCTTCGAGGTAC AAATGTTACACAAGACTGTGCTTGAATTGTATTCATCGCTCTTTGAATCA AGGATTTTTCGTTGGGTGTAAAACTTGGTCCAAAGGTATAAGGTACTTGT TTATTTGGCCAGAGATTGTTGTTACCAAAAATAAAATTTCTGGACATCAT TTCAGCCTTATTATGCTTGTCAAGCATCATTTTGCAGCCATCTGTGAAAG TGAAARAAAAAAACAATATTAATTTGTATAGCCATTATCAAMCCTTCCGA ATTTTTACCTTCAGCCTGGTAAGGCGGAATGAGGATGGAAGCAACTGTCA GGAGTAAAAGATATGTAATCATCTTTCTTGTWCTATCTGNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGCATTACATTAAAT TCATACATCAAATTAGGGATTTATTTTAACAAATGAAAGAAAATTACTCA TTTAAAATGAAGCAAAATGTAAATTTTAAAATTGATTTTTATAATTAGTA AATTACACAAGGTATACATACCATTATGTGAGCAACAAAATGATGWGTCA TGTCCTAAAATTTGTAAAAACAAATGAATCAATCAGGACTGTGGGAAGCT TTTTAATAGTGTTCAGCATTTCTTCGTTGAATGCCCTTTTGTGACAATAC TTGAAGAGTTCTTGTCATGGAAGATGGATATGACAGAGCACAACATTTGG GAAATTAAAGCCACAATTTTATTTGGAGTTTCAGGGCCGTCTAAAGGATT ATATTTTTGGGGGCTTGGCTTTTGGAATTTTTTTGCAAGAAAATCCAAAG CTTTTCAATGAAAATTTAATTTTTTGGAATTTTTTCTCAAAAATCTATAG CTATTTACAGAAAATAAAATTTTTTGTAAAAAGAAATTTAAAAAAAGTAA TTCTTTGGGAAAAAAATTTAAAAATACACAGCTATTTACAAAAAATAAAA ATTTATTCGATTCTTTCTTACATCAATTTCCAAAAAGCTTAACTCCAGGA AAAATTTCAAAAATTAGATTTCAAATATTAAATTTTTGGAAAAGGTCCTT TTTCTTTATATGTGTCGTGATAACATAAAAACAAACTGGGATTTTTTTGA TAAAACAGAAAAACGCATTATAAGTTTTTTACTTTTATGAAAAACCGAAG ATGATTTTGAAAGAGTCAAATACAATATAAAACCACTGAAAAGCTGTCCA AATAGTTATTAATATGATTGATATTTGTTTCAATTTTTACATGAACATAT TATATACATGTTCAGTCAATTTGAGCGTCCGGTATTTGAACTTTAAATCG AATTTTGATATCATTAATACTATCATTTTTAGTTGGTGAGACTTGTTCTT AACCAGTTAATCCCTTTCTTGTTTTCATTATTCCTGCAACGTGAATAATT ATACACTCTTTGCAAATGTATAATCAATAGTTTGGGCATTGATGACGTCA CTCAAGTTATTTCATATTTTTTAAATCAGTTCGAATACTGACAGTCCGAA GTGTATACATACGTAGATGATATGAATTAGTCCTTATTAAGCTGCGAACT GTCTGGCCTTTTTTAAAAATTTATTTAAGAGGAGAAGTTGAGAGATACAA AAATTTAATGTTATTATAACAATAATTCTAATAATAACTACTAGTTAGGG TCAAATAGTAATAACATTGTAAGTATGTTATAAAAGAGGGAGTTGTCTAA TCTTTATTCTCCCCCACGTACTGAGTTGCTCGAACAGCTGATCAAAAGAA GTTTCGTGACGCCTAAAACGTCATAAATATATACTTATTTTAAAATATAT GTTTGAAGACTTTTTCTTAAAATATTAGAAAGAATGTACCCTAATAATGT TTTAGGGAGCTTAAACTATATTGGCATTACAAAAAAATCATGAAAAAGTC CCAATATACAGATTCATTTAATAGCTTAAAATGACCTCCGAATTGGCTTC GACTTTTTGGGCCAAAAATGACCTTTTTAGTTAATAGATAATTTTTTTTT AACAAAAGCAAGCTTGAACTTTTTCTATTCATTAGTAAAAAAAATATATA AATTGATAGACAGAATCAGTTTTAAAGAGATGAAGCAATTTGTAGTCGCT AATAAATAGAGTATGTAATGAACTGCAGATTTGCATGGTATTTTGGGCCA AAAAATCACACCTTTCAGTTGACAAATAATTTTTTTTTAATGCTAAGGAA GCTTGAATATTTTTATATTCATTAATGGAAAAAATATAAAAGTTGATTCG CGGAATTAGTTTTATGAGATGAAGAAGTTTGTAGTGGCTAATAAATAATA AGACTATATTTTTATCTTCAAATCGGCTTCGACGTTTTTGGCCAAAAATG ACCCTTCTAAATAATAGAGATTTATTTTACTCTAAGAAAGCTGGAACATT TTTCTACCCATTAATGGAAAAAAGTATATATAAAAATTGATAGAGAGATC CCAGGATCGAAATAATAAAGCGATCCATTCCTCTTTAGAGTGGAGAATTT TAATATTTCAAAATGAGATCACTTAAAAAATACAAAATGGAACATAAATC CTTGGGGATGCATATTGTTTAAATCGATCTTTTTAAAATTATACATTGAA TATTTTTTTATGATATTCCTCATCACTATGTATTATGAATAAGTTATAAG GGTATTTTTCAGCCTAAAAATGGAAATATAACGAGATCAGAACAATATAC AGAATCATTAAAAACATTTTTTAATCATAAAAAAAACAAAAAAAACAGTT TTACATAATTTTATTAATGCTTCTTTTAATTTGGGGATTGGTATAAGGGT AAAAAATGACTGAACGATAATAGTTCTGAATAACTAAAATCCCAGATAWT TTCAAAATTCAAAAAAACTGAGAAAAACTAAGATCCGTTTTGGATTTTGC ACTCATAGATAAATTCAATTATTGTCTTCAATTCATTTGAACAAATTCCC CCCCAMCCCCAAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACTGTTCCA GTCCACAGAACCCCTAGAATTTTGCTTACTATGTTAGGAATTCCCAATTT TTTAAYCTARAAACATAKATTMAATTWTKTTCATGTATAAGATAATTTCA CTTTATAATTTAATCAAGATCTTTTAATCTTTCATAACTCGTATCTAGAT AGGTCTTATTCATATTACACTCGTATTCTTGTAGATGAATCATCCCAAAA GATTCGTAGTTTCATGTTTCTTAATTATTAACAGATGTAACACTTTATAT CAAATGTATATATGGATTTACCTACACCATTTAATCTAGGTATAATTGAT ATATACAGAATATATTTATGTATAATTGAGATTGATTTGAAAAGGATAAT TTAAGGTAAGATAAATCAGCATAATAACTCATGAGTCAATATTAAATAAT GATAATGATTTACCACGCAATAAGATAAGAACAAACTAATAAAAGTTCAA AGCTGCAATATGACAAAGAGATCAATCATATTGTAAAAACCCTACTTAAA TCCAATCACAATGATTCTGTTCAAGTGCACTTTCGTTCGCGACCAGCTTT TGTATGTGTTACCGGCAAAGTATGAAAATCCGGCATTATATATAATACCT GGGTAATGTATATAATGCCTGATGATCTCAAGCAAACTATATAATCAACG ACATTTTATACATTACCTAAGTATTATATATAATGCCGGCCTCATATGTA AACAAAGTATGAAATATATATAAGTTACATACTATAAATAAAAATACAAT ACAACAGTGCATAGGTACTTGTGCTTTGTGCGCGTTAACTTATTTCCTGT AATCAATAACATATTTCGGTTACATACTCATCGAGCTTGCATGAACTAAA GCATTTGAATTTGGACAAAGGGGGGGGGGAATTTCTTTAAAATATAACAT TAATTGCCCCAAACCTATTTGAAGATGCAAGAAGGGGGTTTACCGTACAA ATTGAAGTTTTTATATAACCAACCAAGATAATTTGGGTTTGAATCTGTAC AATGAAACTGTCTCTAGTAAGAGCCAACGTTGCTAAAAATAGGATTTATT TTTCTAAAACTAGATACCAAATATCAATTATTGATGAAGTGAAAAAAGCG AAGGCAATCACTAGGAAGACAATGTGAGCACTGCCAGAAAAAAAGGTGCT AAAAGATTTGGCAAGGATTTACCAAATGTATATGCAATACAAAATGCCAA AATAATAGGTGCCTTTGCGTAAAAAAAAAGTTAATTGCAATTCAGAATAT CATTCTAGTCTTTCCAGCTGCAATAAGTCATATGTATAAGTCTGTTTCTT CGAATGTAACAAGATTTTTTAATGGAAAGATGTATCTGTGTGTAACATCT GAGTGTCAGAATAGTTTTTTACAAATAATATAATAACTTGTGCCATTCCA GTTTTTCCATTTTCAGTCTCAGTTTTGCTATCATTTTTTTTTTGAAAATA ATATTCATTTTTAAGGTTTATTATTCCAAATGCCTAATTCATAATAAAGT TTTCTAATCCCATTTTGTCAACATTTAATACTTTGTCTAACCAGTTACTG TAATGTAATACATAAGGAAAAGGATAAAAAAAAATCATTCATTAAATAGT TTGTCTGACACCATCAGGCATTATATACATTKCCTAGGTATTCTATATAA TGCCTAATTATACATATCGCCAGTAGCATATTCACTATCAACCTCGACTT TTTAAGGAAAAATTTGAGAAAAAAAAACATATGGTAGCCACCTCTTCTGT GCTTTTCTTGTTGACAACTGGTAATTATTATATACAGAATATTTATTCAT TATTTGACATTGAATTGACAATCTTATCAAAAGAAGTATCAATGATAGAT TATAAAATTACACAAATTATAAACGAAGGTTCTTGATTAATTCATGAATA AAATCCAAAATCTTTCTAATACCTTTTTTGAGTTCATAATACGTAGAGTT GGCTGCTTTGAATAATACAAGAGTCAACTTATGAAAATTAATGAAAACAT ATGAAATCGAAAAACAATGTATCTTTGTACTGCTTTCAAAATATCCCTTT TGAGGTACATCTAATGACCGACTTTAATTATTTGACGTATACAAATTTAT CTTCCCTTACAAAATTAACCTTCTGAATTGAATTAAAACTCTGAATTTAT GGAAGTTGAGTAATTAGTGCAATGCGAATATATATAAGGTGTGTCGATAA GAGATTTCTTTGTTTTTGTTTTGAATTGTACTGGCTATTTTGTTGACATC ACATTTTAGGAGGGAAATTCAAATTTATAAAACAAATTGTATTAATAAAT CATATAGTATTTATTTTTGTTACTCTACAATACTATTAGTGTAAATTTTT ATCTTCCAACGATTACGGTACTAAAATTATTTTTAAAAAATAAATAATTT AAATCTGTTTTTAATAAAAAAAAATTAGGTCAGAACATACATCTTCAAAT AAATATAACCATCATTATAGCAAAGAAGTCATATTATTATATATATTAAG AATAAGTGTATATTATGCACTAAATATGAAATGCTTAGGTGAAAAACATA AACTAACAATAAGATGTTAATGTGTAATTTTTCTTAAAATAATAAATATA GAGTTCAATTTTGCTAATATAATCGAATATGATGCCTTGAATAAGCCTTG TGATTTTGACTATTCTCTCTAGAAAGAAATATATATTTTAGTAATTCTAG ATAAATCTAGTTTTCTAAAGCATTCCCACTTTCATATGGCTTGGAATAGT TTGTAATATAGACCAATAATAGTTCTTTAACTAATAATAGAAAGGTTTTT TAAGTTTCTACTCGCTTGACAAGAATCTTAATAACGAAATAGCATTTGCA TATTCAAAATAAAACTGAATGAATCAATAAGATAAATAAAATAAAATAAT GGAGAACTTATATATAGGAAATTTAAATTGTGAAGAATATTACTGATGTT CTAATTATTTTTATTTCCTCAATTAATTCTCAAACAATCGTATTATTATT TTGATACATTTTAAATATTTTCTTCAATCAAACAACTTATAATCAGCTGG TATGGCACACATTTAGTAATTTATTTATGTTGGTAAAGATCTTTGATCTT CGAGAGAGTAATATTCCAATATACTAACAAGCAATTTAGGTACTTAGAAG AGGATTCACGAGTCCATAAGTTTAGAAATTGATACGACATTTAAATATTC TAAATAAATCTACAGGACTTAAGAAGTCACTTATATTTTGTAACACATAA TCCCTTAACAGTTCCCAATAACAATTTATACGCAATAGTAGAATAGAATA TGGTTTGCAGACAAAACTATTGAGAAAAAAGAGGCATATTATCTTAAAGA GTCTAGAAACATCTTACACTTGTTTTCTAATCACAAAAGAGACACACAAG TAATAAATAAATCACTAATCAGGGGTGAGGCTTAAAGTGTCCAAGTTATA TAATTATCCAAATAGACCATAGATCACAAACTATAGCTTATAAATTTAAT TATTATAAAAGTAATTTAGGTGAGTTATTTCTGCTTGATATACATTGACG ATATTATGAAATAGTTTCCTATAGTTGCTTAAATTTATGTTCTAGTTACG CTTCTGACAATCTTGCTGAGGGGGAGCTTGAATTTTTCAAATTTTAATTT TGGGGAAAAAAATTGAAAATTTAATTGATTTATTCCGAATCATGTTAGAC ACATCCTTGCTTAGTGATCTGGTCCTCACACTTATTTTTCTTCTCTTGGC TAGCTTCCTGGTAACATTGCAAGTCTCCTTGCKCAGTTTTCTTCTTCTTC TTTTTTTTTTTTTTGCTCTCCAAATGGTTCTCCTGCTGACGTAGACTGAC TTCGTCTATGATTTTTTGCATATTTTTTGCGTAATTATTCATTTTCGAAT TGACAACCAATACCTTTAAAAAATAAATGTGAGACTAATTATTCTACAAA TAAATCATTAATATGAATGAGATATACTCCTATAACAATGAAAATTGTTT TCGTATTACAGATGTCAGGAATATTTATATTTTTCATTCATAAAAGTGTA AATATGTATGCAGCAGTGACGAATAATTATAAGTGATAAAATTCAAAGGC GTCCGCAGGAATATATTTTGGGGAGGGCTTGGTTTTTCGAATTTTTTGGA AAAAAATTTGAAAAAAACTGCAAATATAATTTTTTTTGAAAAAAACTGCA AATATTTAATTTTCTAGTAAAAAGCAAAAATTCCTTAATTTTTCTTTTTT TGGGGGCCCCCCTGCGGACATCCCTGAAATAATGTGTATTTTGGGCATTT AAAAAAAGAAAACTAAAATCGACATGGTAACCATAACAATTTGAATATTT TTTTGGAGGAGAGCTGCTTAGCTGTCATGACGATTCATTAGATCATCTAC AATAATTGAATCGGTTCCTTAGGTATTTTTTTATACGATGAAGGACTGAG AATGATCGTTCTGCTGACCTCAGGAAGTTTCTCTGTATAGAGGCAAGAAT ATTTGCTGCTGGGGATGTTACGTGAGGTCTCTTCTGATGGGTCTATGGCT ACAATCATCTATAACAAGGGYGAAGGGAGAGAAAAAAATAAACAAGGNTA TTGGTAAGAAATACTTCGATGTCGATCTTCAATTCACTCTGAGTCCAACA AGGACTTGCATTCATAACTCCGCAAAAATCATCAGGGTTACTCTCCCCAT CGTTTATGAGCACACATTAATGTTCAATCAGGGAATATTGTTGAATGTAA TAGGAAAGGAAGATGACTACTTAGTCTGAGTTAAATAATAATAATAGCTC ACAGAAAGAAAATTCATTCTCCAGTTACCAATTCTAAAAAAAAAATGGAA AGCTATAAAATACATTGAATTTTCTTCACTACTAATAGTAATAAGGAGGA TTTGTGAGCGATCGCTCAATCACAAAAAAAAAAGAAGCTGTTTCATCCGA GCCGACTAACAATGTGAATCTTAATATTAATAATTAGAGAGAGGAGAAAA AAAATTTTATCACAATTTTCAATAATCCTATATAAAATATTATTTTTTGA CTTACAAATTTGTTAGCGTGAAAAAAGTGTTTAGTAGTGTAAGTCGTCTG TAGAGGATAGGCTAGAGGGACTGCAATACCCCTAAATCGATTAATTTTGG TCATCCATACATCGTTATTAAGTTTTTAACGTGCCTCAAATATTGTTCAT TTTAGAATGTGATCAATTATGTTACACACGATCAAGAGTTTAAAGCTGAT AGTGTTTTACGTTTTGCAAATGTTGATGGACCTAGGAAATCCTTAATTTT TTGTTAATTTTTTTTTCTCCCTCTAAAAGAAGAATTATCGCATCTTTGGT GTAAACTGATTTAAAAACGCATAATAAAATTAATATACTTGTGTACTAAT GCTATTTTAAATGTAGAAGTTTCTCCTCTTTACACCACTAAATTCATTTT CTCCCTCCAAAATCATTAAAGAGGCACCTGATATTAACAAGGGTCTTAAT TTGCTTCGTCTAAAAAAATATATATTAAATGTAAAAAATTTCAAAAAAAG TTATTTGCTCAAATTTAGTGTCTCCCAAATAAATTTAACTCTAAAGTTAA AAAAAAAGTTTTTCAATTCTTTCCCTTTCCCCCTAAACCAAAAATCTTAC GGAAACACCTGCACTTTCAAGAAAATAAGTTTAAGTCAAATTTTTTTTCT TAACAAATCCTCACAGATTTTCTAATATTTTTAAGGGATATATAATTTTT TCTTGGAGCAACCTCAATTCTTTCTCTACAACCATGAAAAATTATAAATT AAGGAGCATTAAAAAAATTAAACGTTTTTAGCTATGAACAATTAAAATAT TTAGCCGATTTTAGAAGTATATATGTCTGATTTTTCTTCAACCCKCCTGC CAACACTAGATATCAAATATGATACCCACGTCTGTTTTGGTAGTGTTCAC TATATCAACGAATCGATTACTCATTGTAATTTAAAAAAATAAAGAACACG TTTTTCAGTCTATAGTAGGGTNTAAAAAATAAAGAACACGTTTTTCAGTC TATAGTAGGGTGACAGTTATTTAACTATTTATGCAAAAATAAACTGTTGA TTCCAATTGAATTCAACTAAATTTGATATTATATCCAAAACAGCTGTAAT GTGTGCTGTGTGTCATATTTGTAGAGGATATTTAAATAAAACAACATTTC TTTCAAAAAAACAATTGGTACAAAATTTCAAAAATTTATAAAATTATTTC AATTTTGTCAATCGTATTTTTTATCAAAAGAAATGTTTTTTTAACTCTAA GACCTTTACTTTGGAATAAAMGACACCYTAATGCACAGCTTTATGAAGAA AGGTTTAAAGCATGACACGTGCAATATGGTGGTTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGT TGGCTGATTATACTAAGCAACAATATTTGAACTTTCTTAGTGGTRGGGGT TTCATGATTATTTTTATTTGCTTTTATGTCAACCCACCTGGCAACACTAG ATATCAAATATGATACCCACGTCTGTTTTGGTAGTGTTCACTATATCAAC GAATCGATTACTCATTGTAATTTTAGATATTGTTTTTTCTGGTTATTAAA ATGAATTAAATAAACTAATGAACTTATAAACAAATGCAATCAAGAAGTTT CTCACAATATTTTGATGAATTCCAAATTGATATAAAAAATGAGAACCTCT TCGTTGTATTTCTAACTTAATTCACGAAATGTAGTTCGAGTTTATCGATG ACACTTTCATGTTTAATCAAAAATTTAAAAATGACCATACTTTAATAGAA GTTTTGCGAATCAGATGCATCTTAGATACTTTGTAGTTGACACGTATATC GATCAAAGTATCATATGTTATTCAAAATTTCGTCAGATAAAATTTTTTAT TATACGATTTTATATATTTAATCGTGAAAAAAGTGGTTTTGTAACGTTTA AAAAAATTACATTTAACTATATTTTGCTTGCACGACAGTCACTAATGTGC TCAAATTGAAAAAAAAAAATACTTCTTCTAATTGGTCAAATGGTGTTGCA TTGATTAAGTATAATATATATTATAGTATTAAAATTACTCTATTTGACCT ATGAATCGTCGTCCCCTTCTCTGGGAGTGACCGTGAATGGAATTTATGGA TGTAATTTATCCCTAGCGTGTTACCCACTGAGCTACGTCGCTGCATCACA AATTTATTTGTTCATTGCATTTTCTCTCCTATAGTACAAACAATAAACAT TTTAGAATACAAGAACGATAGGGAAAGCAATACGAAGCTGAAGAAAGGAT TTCGATTGTGGTGGGYATAGTAAGGTTGCAGTAGGTTAAAATCTTCAGTC TGTAGCAATAAACATCAGCTATAGGCGGCAAGTGTTAGAAATAAAGATAC TGTAAAACTTTGATATACGAGTGTCACAACATATGAATTTTTATCAGGGT ACAAGCTGGTGGAGAGTTGTTGACAGAACGCGAGTTCCATAAAGAAAAAT ATAAATAAATGTAAAATACATAAAACATAAAAATATTTGACGCGTCCTCC ATGTTCTTGACATACCTATTTATTTATATTAGAATTTCAATGTTTAGGTA CACTATGACGCCACGATTGCGTCAAGTTCTTTTTTACATAATCACTCTAT GTTTCATCTCTATGGCAAAAGTAGATAAACCGTCACCTGACATGAAAATA CATTTGAGTGCTTAATTTTTTAGGGATATTATTCTGTTAAAAGTTGTATT GTTAATATTTCATTTTACAAATCTTAGTTACAGTTAGTAATCTATTTTTT TTTCTTCTTCTTTTTAATTGGAGAATATAAATAAATATAACAATAATCCA TATGTCTGCAGAATGTAATGATGAACAAAGATTTGGAATTTCAATCTCAA AATCTCAATCTACTGAGACACTTTTTAAGTTCAAACTCCTCTTTTTTGCT CTTTTTCTTCCCCTTTCTTCATATGGGCTGCTAATAAATTGACTTTTCTT ATAATATCAATTAAAAAAAGAGCTATATCCTCGACATATTGTGATGGACT TATTTCAAATTTTCAATGATGTAAAGCAGTTTTGAAGGCTTTTATAGCTA AAATTTCATATTTTAGCTATTAAGGATATATTTGTACACTTTATGGATGT AACTATTCTTATCGGAGATGAATTTCTGAAGAAAAAGCACTGTCTTTCGA ATTCAAACAAATGGGTTTGAAGATCTTTAAACATAAGGCTTTTATATATT TTTGATGTTGAACAGTGTAATTGGATACTATCAATAAGCAAAACAATAAT GTAATTTAAATACTATTGATAAATTATAAGCTTCCATAAAAATAGTTACA GACAAAGTACCTCAACAATTTGTTTTTGTTTAATTTTTTCTTTTGTTCTT ATGGCAACATTTATATGCATACTTTCTATGTATGTATTTAAATTGTGCAT TGGTATTTTATTTGCCAGATATAATGTTTTTATTCACCTTTTGAATAAAC TTGTATTAATATTAAAAACAGTGTGGAACAAAACAAAAATGAATTAACCA TTAATTTATCTTTTTCAATCAAAATGAAGTAGTCACGATTCATGACAATA AAGAGCACGTTTTTCAGTCTATAGTAGGGTGACAGTTATTTAACTATTTA TGCAAAAATAAACTGTTGATTCCAATTGAATTCAACAAAATTTGATATTA TATCCAAAACAGCTGTAATGTGTGATGTGTGTCATATTTGTAGAAGATAT TTAAATAAAACAACATTCCTTTCAAAAAAACAATTGGTACAAAATTTCAA AAATTTATAAAATTATTTCAATTTTGTCAATCGTATTTTTTATCAAGCTA ANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNGGCTGATTATACCTAGCAACAAAATTTGAACTTTCTTA GTGGTCGGGGTTTCATGATTATTTTTATTTGCTTTTATGTCTAAAATACA AAAACGGTACATTAAATTGTACACAAATATCTCTAGTTTAAAAAAATATT TTCAATATTCTTTTATCTTGTGTTGAATTTGAGAAAATCACTTACCGATG AGTTCTAATGATGTTTTTCTTTTGAGTCTTAGAATTTCCTCATTTCAGGC TGAGTCGATTAGAACCTTTAATTATAAACATTTAAAAAAAAAGAAAAAAC TTTGAAAGTGCCTTTTATTTAAAGCCTAAGATATAGTTTTAAATAGTGTA AATGGTTCCAGATTCAAAAAATATTTTAATAATTTCAGTCTCTCTTTATG AATCGGAGAAACTGCCTTGTAAGTAAACAAAAAAAAAATGACTTTCGTAA ATATATCAATTAAATTCACTATTTTTGATCACAATGACAAAAAATATACA GGGTTCCAAAGCAAAGCATGGACTGAATGACGGATTTTTAGAAAAATGTC AATAATTTTGATTTTTTTTTTTAAACTTTGAGACACGACCTTTGTGAACA TGTTCACTCAATATGGCCGCCCTCAGCAGCAATNNNNNNNNNNCTCCACA CGGAGGCGGAAATCCTTGCAAGAGTTGATGATTAATTTCTCGGACAAGTT GATCCACTCCTTAGCAAGGGCAGCCTTCAGGGAGTCCACGTTCGGGTGAG ATGTCCGGTTAGTTTCCTTCTCCAAAGTGCCCCACATAGCAAAGTCCAAC GGGTTCAAATTTGGGTTAAGATGATGGCCACATGTCCTTGGGCTAAAAAT CAGCCATGTTAACCGGCATAATCTCGTAAGTTCTGCGCCGACAACATGGT TAATGTTTGGCCACAGGACATGTGGCCATCATCTTAACTCGGATTTGAAC CCGTTAGACTTTGCTGTGTTGGCACTTTTACGCCATGCACATATTCGTGA TTTTATTGAGTTGAACCCGGTTTATACTTCGAGGCAAGGTCTTGAATAGT TATAAACAAAACTCCAGCAAAATGTAAATAGKAACAGTGAAACAKCAGCC GATAATATGGAGAGACGTCGAGTCTTAATTTTGGAACTTTCCGCGCGGGG AAAAACTCCCACTGAAATMGACAAGGTTCTGAKCTSCAGCCGCACCACTG TTTACAGCGTGGTAGCCAAAGGGACTCCTGAGGCGACCAAAAGATCTAAG TCAAGGTCTCGAAGGTCGGACGAAATGGTTGTGCCGTGAAAAAGTATGTC GAGGAKAAGAGAGGCAAGGTCACAGRCASCAGCCTCTCCAGGGAGTTCAA CGTCATCAGAAGGACCATGGACCGGCTGGMTAAGAGAGATCTTGGCCTTA AGGTCTGCAAGAGAACCCCTCGTCAAGCCCTCAAGCCGRAAAATTTAAAG GAGTGTTCAGTTTTAGACGCGCACACCTTTATATTAATATATTCTATAAG TCTTCCCCATACATACGAATTTTTGAGATTTTTATTTTTTACAAAATTCC ATGTTTTTTCATCATAAAAAAACTTTTTTCGTATAAAATAAAATGCTACA CATAAAACTTAACGGTTAAACTACTTTTTATATAATGGTTATAAATATAC ATAAATCAGTTGTTGCGCTTAAAAAACCTATAACAATGATAAAAATAGTT TTACTTAAATTATGTTACTATAAATACCCAAAAGTGAACATGTATTTTGG GTAATCACAACTGTATTATTTTAATTTACTTATAGCACTTTTATACAATT TTACTCTGTATATAAACTCTTATTATGGTCTTAATGTATAAAAGTTATGT GTGCCTTGTCAAATATTATTATTTTGTAAATCTTAGTTTCTAGAGATATG TCAAGCTGGAATGATTAAATTTTAGTAAACATTGTAGTACAACAATTACT ACAATTGACCAAGGGATTATCTATGAAGTTCATATACATAATCTATATTT TCTTCCTTAGGGGCAACTGAGTATCAAATCTACGCTCATTGAGTCAAAAG AATTCTCCCGGGTGCATTGTCCATTGAGCTACGTCGTTTCATTTTTTTGT TTCCTTGCTGTTAAAAAATTTCAAATAATTGTGCTCATCAAGCTTGTTTC CGAAATAGTTTCTAAAAACGAAATAATATATAAATAGAAATATACTCACA TACCAGTGAAACATATATATTCCAATAAAAAATTATCATATTTATCTTAA TGAATTTTCTTCTAACTTTTAGAGGTATCGTATAATTTTGAATAATTAAA CAGTTTTTTGGAAGATGTAAAAAGTATATTATTAACCCTCATAATTTAAA AATATAAACATCCAATATTGTAAGAAAGTGTTTGATATTTTATTTTAAAA TAAGTGATAGGGATACGTCAAAAAAACTACAACTATTAAATTTATGTAAC ATTATGATTAATCGTTATACATTATATAATGTAAATACATTTGGAGAAAC AATAATATTTTTGCAAACTTTTCTTTAAGATATCGGGTAAAAACTGTTTT TGAGGGGCAAAAATAGTTTTTGAGGATCATTATTCTTATAATAATACAGT CAGTCTTTTTTTTCTGTATCTGATGTCATTTGAATTATTGGTTATTTTTC TATCTAAAATAGATAAAAACAATATAATAAACTAAAAACAAGTAAAAAAA ATTGAATTTAAAATATTTGTGATGTTTCATTTTCTTAAAGAATGATGTTG AGTCTTCTTTAAAAAAATCATTTTCCAATCCATGTTTAATGGACTCTCTC AAATAATTAACCGTGGCATTATTTATTCTTCTTAATCACTTGTATAATTA CACATTACATCAAGCATTTTTAGACAAACTAGAGCACTAAAAAGTTTATT ATGTGTTAATTTTTCCAAACTATAATACCGATCGGTGATTTATAATATCA ATGTTTTCATATCTTAATCTACTATAATAAATGGAAATTTAATAATTCTA TTAGTTTATTATTAATTTTATCTAAAAATGTTATTAATTATATTATTTTT TTTTAATTTTTAACTCAAATTTGATATTCTTCACTATTGCAACATTCCTA AACCAAACCGACAGCTCCAACATTTAACGAGTTGCATTCAACTGCAATTT GCTAGAAACTATTGATTTGTATTACCTTTACATATATTTAAACAATAGCA AACTCATGTAGGTATGTTGTGTTGAAATTGAACGAGTCTAAGTCAAACCA GCTTGGAGCAATTGAACAAAAAATTTGTGTTCCTACTGTCCCTTGAATCT CCGATTGTATACGCTAAAAGTTGCGTTGATATCACGCAACCTTACATATA CGAGGATTGTCCGAAAAGTTTCCGACCTAGAAAAATACAAGACTGTATTT GGTAACTCTATACACTTCTCTAGTGATGCTTCCATCCCTGAAACCAGTTT AAATAGTACTGTTGTTTTTAATGACTCTGCCCTTACATGTTTCTTTTTTC TCACATTTCCAATAAATGGTATTGCAATTTTCTTTATGCTGTTAAACAAT TATTTGAATTGAATTTGAGTCAATTAAGATACTCTCTAAAAAGAGCACCT GAAGAAACATTCTTCAAAAGCTCACACTCTACTCGGAGGAAAGAGATCCC AATACCTTTAGAGACTGCCTCTTAAAAACCGACAATATTTAAAAATGGAA TATTTATTTATTTTTAATACTTCCTTTGATTCTCTACAAATTATTATTTT CAATTTTTTTTCTAGTCATATTGTGTATTGAACTACATTAAGTAGATAAG CAGATGAGAGACTATAGTAGGGGAAGAGTAATGACGGGATTCACTTGTAT TTCCCGCTATTTAAAGATTCATGATTACATAGTTTCTAATCCATAAATAC CATAAATCATTCATATCCGTCTCCCATCCAACATAAGTCATCACTCATCT CCAGTGCCCAATGCCCAACCCTCATTATATAGCTATACACAAAACAACTA GCTAGGTTAGAAACATAAGCCGTTTGACGTCATTAAATAGCCCTCTTCAA AATGTGAAAATGAATTTTACAGGGAATTAAATTACTAGGAATGAAAAAAC AGGAAATGGGAATAAAATTATCAGTCACGATAAAGGCTATAGTTATAGCT GCAATTAAATCTACTAACGAACTAAAAATGTTCCTAAAATTTATTACAAA TAAGCGAATAAGTGAATTTTTTGTAGTGTAAATTTACATTAATCGGATCA TAATAATACAACTAAGGTTACAAGAGACAATCATAAGAGTATTTTTTTTT TTGGGAGGGGGGGGGGGGGGGAGTTGTGATGATACTTTTCCAAATATTGC AAAAAATATGTTATAAAATGTACCAGAAATTGGAAATAAAGTTTTGAAGT TTTATCATTTTGTGGCAAAATTGACGTTTCATGATAAAATGAGAAAAAAA CGAGAGAAAAAAAAGAAAAATTATTCAGAAAATGTCAGATATTTCAGTTA AACATCAATATTTATGAGCCAAATTTATATGCAAGCAAATCTACAGACAA ATTTCTACAAACTTATTTTATTTAAAAATCCGATATTTCATGATATGCCT TCAAATTTTTTTGTTTTTGCATTTTCCTAGTTCCATAAATTTATTTATTT TTCGTAATTTCCACATGAAAAAATTGTCCATTCTACATTTTGTGGGATCG ACGTTTTGTACGTTTAATATTTTGTCCTACTACGTTTTGTATTTGGACGT CATGTCCAAACATAATTTATTAAAGATATTATAATTCTTTATTTTATTAT TTATGATCAGCAAATATTTCAATAGTAGGTCAATAGTCTCAAAAATTTTC AAATTGCCAATTTTTTCAAAAAAATAGTTAATTATTCTTTAATTATCATG AAAACTGTTAAAGATACAGCTTTTTATATTCCATAACTTTTTAAAAATGA CTAAATTTACTATAATATATAATACTGTTTTATATGGGTAAAATTTTTTT TAATTTGAGTAATATTGAAAAAGAGTTGAAGAGAAAAATAATACATATAT AACATATCGGGCAGCATGTTTTTATATATATTTGTTTTTCCTACAAAAAA TCCAAATTTCATGAAATATTTTCATATGGTTTTAGACGGATAATTATTTC TTTTATTAAAAATAATACCATTGTTAAAGTGTATATTTATAGTGGATTTT TATAATGATAATTTCTTTATTAATATATGATAATTTATATGATAAGAAAA AATAGTTTCTACTTTATCCAGCATTATTATAAAATTTGCAAATTCATAAA TGGTTATCTTTTTTTATTGGGAGACGATCGAACATATCTTTTCCAATTAG ATTAGACATAATTTTACCACTCCATTGGATTACCAGACGAATGTAACATC GTAAATTTGTTTTAATATTATTTTATTCTCTTCATCTATATTCAATTCTC TTACTACATATAGTACTTTGCTTAAGAGCAAACTCATTAATGTTTCCGCC CATACCCTTGACTGATTCTGCTAATATAAAAACAGTTTTTTGATTATACA CTTTTGTGGGATCAAGAGCTAATGAAACTTCTCAAGTAATTAAAGTTTTT CTTCCTCTTCTAAAATTCAATTGAGTATACCGTAGTTCTACTTCTTCCTT AATATTTTCCCTCTATAAATATGATACGAGTATAGTTCCATACCAAATGG ATTTAAATTGTAAGCAAAAGGACTTCAGATTATGCATATCAGAAATTATG CTTCATAGAGGACGCTTTGATATTTAGGACACCTCTGAAGGACCGATAAA TGGGACTAATGTAACATCCCAAATTAGAGACATATACAAGTTAAATAAAG AATCATGTTTTTTAGAAGAAATATAGTAAAAATAATTGCACGCAACGACT TATTTATGTTTTAGTTATCTCTTTAACTATTATACATTGTAATTCATATT ATGAATATTTTTTATCTGAATACATTAATCTATCTTAGAGTAAAATTATA GAACATAAAAAGCTGTACTGTGAACTTTTTTCACAATAATCAAGGGAAAA GTAATTTTTTTTTGAAGAAATTGGCAATTTTCAAAACTTTGAGGCCGTTG AGTTACCTCTAAATATTTTTCAATTTAACTGAAACTGTGCCGATTGTATT TTTATCAATAGGAACAGATTTTAAGGCGGCAACACGGACATTTCAAAAAA AATAAGAAGAAGAAGAAGAAACAATATAACTTGTCAGTTATTTAAAGTGT GCCTGTTAGTAAACGATATTTGAACCCTTTGTCAGGAGAAGTTAGGAATT TAATTTTTATAGCAATTATACAATCTACTGGGCTTCGTTGGGATATATTT TGTCTTTTTAAATAATTTTGGAAGGGCAGAAGGGAAGGGCAGTTTTTGAA CATTTCCATAGGAAGACCATTTAAATTTATAAAAGTTTTGATCTCAAAGG CACAATTGGTTTTTGGAGATTCGATAGGCCTTTAGAGGCAATTTGATTGA TGAAGGACTTCGAATATAATCAGAGCGATACCGGTGCATATGATTGTTAT GTTCATTTTATTTAAACTTTCCCTCTTCGGCATCTCCCACTTCAATGAAA GTTCATATTTTTCCAGAATGCTTTTAGATCCATCACAAAAACTTTTTATT CGAGCTGAAAATCTTGACAGTATTGATAATATTTTTGAGAGACCATACTG TGGTTTATCTAAAAATCCACTACTTTCCCGTATCAAAACACGATTAAGAT ATTCCTGAGAGAAATGTTCCCTGTACTATAGGTTACGAATCCAGATGCTA GAGAGAATCTGCAGTGTAAAAGGAACATAATCCATAATTTTTTGTTTAAA AAACATTTTTTGAAGAACACTTGTTAATGCAATAAGCGATGATATATGAT TAATTTATATGGATTGAATTTTGCATCATAAGAGGACGTAAATTCTTACG ATAGCTTTTTGGGAATTAAAACTATTTTGCTTTCGGTCCGAAGTCGGGAA AAAATCCTAGAGCCAATACCTTTTCATAAAACAGTAATAAAATAGGACCC AAATAAAAAGCAAACTTTTTATAAAATTCAAACGTAAGCCGAGATTGACC AAGTGCCTTGTTCATTTTAGCTTCCTTGACCGCTGACTTGATTTTGTCAA TTCAGTTTTAATTTAATTGTTGTCATCATAACCGATCACACGCTTGTTGT CCAATTCACATCTCAATTTCTCGTAAAAATCAGCATTGTACATTTATATC TTATGCACAGAGTAGAATTTTCAAAGTCAATACATCTCGAACAGTTTCAT ATAATAGGATAAAATTTTATTGCATAAAAATATAGGATCCCTGGATGTCA CACCTGATTCCACTATTAAGTACAAATCATTGTTTGAGTTTCTTTGACTT CCTTGTTTTAAACAATACAACCTGGGGTTTGATGGATCATATATATGCTC TATTTTGAGCTTGACACAATGAAGAAGATTTAATATATTTGATCTATTTT ATAATATTTTTCCGGAGGAAATATTTCATCCTCATTGATATTTTCAATTT GATTAAGACGTTTTCGTCTAATTTGGCTCCAGCTCTACGAAAAACATTTT TGATTAGTTTAATCATCTTATGAAATGCCTTGAAAAGAACGAGATCGATC CTTGAAGATGCAAGTCTCCTTTGTTTGTCAACAGAAAAGAATCTATGAGA AAAATTTCGTACTGCTTCCCCAGCATCAATAAGTTTGAAGGAAGCTATAA TAGACGAGAGAGCTTTTGTAGCTCAAGGTATGAAAATAGCTGAGTTATTT TTTTAATCAAGGCTTGATTTTAACTTGATTTTAAAATTTCCTCCTAGAAC AACCGCTCTGTGAGATAATATTGACACAAGCTTAGCATTGAAAAACTTTG GATCATCAATATTAGGCCCATACAGCCCAATTAAATAAAAATTAGCTTCA AATGCTTCACATCGATGTTTGACAAGATTTCCTTCAGAGCATTTAAACCC GAGTTTGGGATTTTGTGATTTTTTAATCAATAATGATACAACTCTTTTAG GATTTAAGAAGTATTCATTATGAGATGTGTAAACCACTTCTCATCCGGTA ATGAGAAGTGGCTATCCAAGTTACATCTCGTATCACATAGAATGATAACA TCAGGGAGTACAGGAATTTTAGCAATATAGAGAGACGATATTTCATCTCC AAGGTTTGAAGGGAATTAACATTTAAGGATAAAAAATGAAATAATATCTG TTTAGACTGTTTATGGGATTACTCTTCACCATTTTTGACTTGTGTTAGTT ATGATACAGGTCTTCTGGGATTGAAAGAAGATCTTGATCTTACTATATTT TCAGTAGAAATWCTTTGGTTCCTTTTTTATATCCTAAGTGACAAATAACT TCCTTCCTTTTTTTTTTTTTGTTCTTCCCATCATTCATTTGTAATACAAC TGTTTGGTGTGTTTCAATTGCATGTTCCTTTATCATCCTTTCCACATCTA TAGGTTCATGTGTATAGAAAGATGCAAACCCATACCCCGACAATTGTATT CTCTGTAAAGCCAAACAACAGAGCAGCATTATAAACCATGAGTTGTTTCA TATTAACATTTTTGAATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNCCTWAAAAAWARCCRSCGGYCSCCCCRCAAAWAGGACC AACTTTCWTTACAATTCTCTTTACAATAGTATGTATGTTAACATAACATC AATTAATGCCAGTCAATCAAATCAACGTTCARAATAAGTTATAAGTTAAC AAAGTAGATAAGTAAACAAATCAACAGTTAATCAAAAAGCACATTATAAT TATTTAAAATTTATTGCATAAAAGCATAATATTAGAAACAAGGTGCCTTA TCTTAAGAGGATCAAAATTAAATTTGAATGTATGTATAATGAATCTTTTG CATGATTACTAAATTAAATGTATATTGAAAAAAGTTGAAATTCTATGTGT TTATCTCAAAAAGCGAAACGGTGACCTGTGATACAAAATATCATTCTATC ATTTTTGAACAACAACATATATGTAGATAAAAGTCAGAAAAATAATTTCA ATTCATCTGGCCCGCCGACGGTATTTTAACTTGTTTGTATTTGCATACAA TTTATATATTCATAAATTTCAGAATTACTTTCATCCTTCTATCAGTTATT GTATATTATTTATTGTCAATTAAATAGGCGACCAAATGTTATTTGTGGGC GTATTCACTCACACATACAAAACTTGTAATCATAATTATAATATAAAGTA AAAAAAGAAAAGAATAACTTAAGAAGGGTTACCACATCTATCATGGGTGT ACACTCTACGTAATACACAATTTATGTCGAAGAACTTTATATATTATTAT TATCTTCAACCTCAACAACTCTCCCTTATAAAATAAGAAGACCTCTTGAT TTAAAATGTTTCTGGTTTTGGGAGCGAAAATGCCACGTTAGTAATTTTCA TACATCCAAAATTTAAATTATCATCATATTTTCACTCCTACAGGCAATAC ACTTTTAAATCAAGTAAATTATTTATCTTGAAAGGAAGAATTTTTGAGGT TTGAAGGTGCTTGAATATGTAAAGTTCTTTCAAAATAAATTGTCAATTGG TCCGTTTCAAAATTATACATTTATATACGTGTACAGGCATGATATATGTG GTAACCACCCTTAAGTCAAAATTTTGAATTTAAATCATACTAATCAAGAG ATGGTAAATTCTAAATAACTAATAATTACACTATGAAACAAAATTCAGGT CATGGAAGGACTGCCAGCTAAAAACCACATTCATTATTGTTATTTAAGAC ATAATAAAGTGACCATTAAAATTTTCAATTGCGGTAGATTTATCCTTTAA AGCCTTTTTAAAAGGCACATTTTATATTGTAATTTTGATTTAGAGGCCTA TTTCAAAGTGAAATAACTATATAAATAAAAATTAAAATTAATAACAATCA ATAAGTAATATTCCAGTCTTCAATAAATAAATTATTTACMAAGTTATCTT GAATACAGTTCCTACAAAATGCGTCTAATTATACAAAAATGAAGATTGAT ATTTGAAAGGTAATATTTTTTTCAATAATTTACTTTATATTTTATAGCTA AAACTAAAGATTATTAATTAATTATTTTACGATTAAGAAAGATTTGCCCT AAAAAAAAGTTCGATTTTAAATAATTTTATCAGTTTAACTTTTAATTTTC TAATGGAATATTTAATAAAAAAGATTAAGTGAAGTTCCTAAATTAAATAT AAATATGTCGATTAGATGACTTACATCTAATCAATTAATACGTTCGATAT GAAACAAATTTAAATTTATGTCTCAAAAATATTACTACTAATATTATTAA TCAATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC AAACCTACTGCGATTAAAATTTTAATGGTCCTTTGCGTGTTCTATGGCTA AAAATAACTATAATAAATGTATGTTTTAGCCGGTGGGGAAAAATTCTTAT TGTATAGTGTTATTATTGCTTATCTGTTTGTACAGATTTGCAACTTGTTC ACAAAAATATTTAAGTTTACTCATTTACATTCCCTCCACCCATATTGTCT TAAACTTTGATGGTAATCATAATCAAAAATTCAAATATGGATCGATACAT TTTTTATCCGGATCGCACTTATCATTGTTTCAATTATCCGGTGGTATTTA TAAAAAGTTTTTTAACTTCTGTCAAGTACTATTAACAAATTATATGTTAA AAAAGAAATTAATCCAAATTAAATGATATATTTTCAGGAAATCTTCATGC TGCTATCCATTCAAATATATCTTACATCTTGAATCCAAATGTTATTCTAA CTTATTTTCTTATTTTATTGCATTTTACAATTTATAACGAAAAAAAT
back to top
Add to Basket